1XVEE

Soluble methane monooxygenase hydroxylase: 3-bromo-3-butenol soaked structure
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
166
structure length
166
Chain Sequence
KLGIHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVHLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methane monooxygenase component A alpha chain
publication title Product Bound Structures of the Soluble Methane Monooxygenase Hydroxylase from Methylococcus capsulatus (Bath): Protein Motion in the Alpha-Subunit
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 59
structure length 166
sequence length 166
chains with identical sequence F
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 2004-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02964 MeMO_Hyd_G Methane monooxygenase, hydrolase gamma chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1xveE01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1xveE02
1XVBE 1FZHE 4GAMC 1FZIE 1XVGE 1FYZE 1FZ4E 1FZ7E 1XMFE 1XU3E 1FZ5E 1FZ0E 1MHZG 1MTYG 1XU5E 1FZ9E 1FZ2E 1XVFE 1MHYG 1FZ6E 1XVEE 1XMHE 1FZ3E 1XMGE 1FZ8E 1XVDE 1XVCE 1FZ1E 1MMOG
chains in the Genus database with same CATH superfamily
3C95A 3RMAA 1FZHE 4M3TA 4GAMC 4FJJA 4J2EA 2JQTA 4JS5A 3QETA 3NGIA 3RMCA 3SPYA 3SQ1A 2B8IA 1FZ7E 5IREA 4JRQA 3UO3A 3C94A 2JPNA 4QNDA 3L0MA 3UIQA 3WSOA 4FJ9A 4KI4A 3KD1E 3RWUA 4J2BA 3J2PA 1MTYG 1FXXA 1XU5E 4FVMA 1FZ9E 4DTXA 3RMDA 4FK2A 1IH7A 3C6NB 4EP9A 4FK4A 2DEBA 3CFPA 1FZ6E 3C6PB 5IZ7A 3CQ8A 2OVRB 1FS1A 4FJXA 1FZ3E 4IT5A 3SQ4A 4J2AA 1FZ8E 2VJ5A 2K5SA 4AKHA 1FZ1E 4I9QA 4M45A 3TAFA 2JHCA 3TL8B 3QEIA 2P1MB 3SNNA 2PFTA 1FYZE 4JRPA 4AI6A 3E4WA 3TABA 3SQ0A 3SUOA 3LZIA 1XMFE 2PFVA 1NEXB 1FZ5E 4I9LA 4KHUA 2DTUA 4FJNA 2OYQA 1WAFA 1P22A 3NDKA 4FJGA 2E32A 4HCCA 4KHWA 2H4TA 3QEPA 2OVQB 4FJ8A 4DU3A 2B7MA 4HCBA 4M3XA 3LDBA 1XMHE 3QNNA 1XL3C 3N1EA 1FPOA 2B1EA 3L2OB 3SQ2A 4KHYA 4FK0A 2DY4A 2RCUA 3MKSB 4JS4A 3LDSA 1LDKE 4RL5A 2MMBA 4B08A 3SI6A 3SCXA 2OZMA 3SUPA 4DTNA 4DTSA 3TAGA 2JH8A 1XVGE 4M3YA 2MZWB 4AKIA 1FZ4E 2RKHA 2FW3A 2P1OB 3OGLB 1XU3E 2VJ4A 3OGMB 4EYWA 4ICGC 2P5OA 4FJ5A 1IG9A 2JHPA 3QEXA 4X5MA 4M42A 3LZJA 2P1NB 3NAEA 4DTPA 3SUQA 3K2OA 3SUNA 3TAEA 4FJIA 2OVPB 4ADNA 1FZ2E 5IBKB 4KHSA 2QXFA 3L1NA 3HGKE 4M3WA 1WAJA 4DTMA 3C6OB 1MHYG 3HGLA 3LD8A 3NCIA 1Q9XA 2FYOA 4DTOA 2OZSA 4I6JB 3V7DB 3TJYA 4FJLA 4M3ZA 3CFRA 2YB5A 2P1PB 3NE6A 1XVDE 3QEWA 2LF6A 3QERA 2VIXA 4M3UA 1XVBE 4FJMA 3L8BA 3S9HA 1FZIE 3QESA 3RMBA 3NHGA 2MW2A 4EPHA 4DTUA 4RG8A 4ADOA 2JH9A 3QNOA 4X5NA 5H37A 4DU4A 4M41A 4E3SA 3E4YA 2JHAA 2P1QB 4M3RA 1FZ0E 3HP9A 4DU1A 4FJKA 3KD5E 1MHZG 4FJ7A 4DTJA 1Q9YA 4RNGA 4E4BA 3SPZA 3BVOA 1XVFE 3QEVA 1N1CA 3HL8A 4QNCA 1JW2A 3OGKB 3UO2A 2HD0A 3SVIA 4DTRA 4AKGA 1XVEE 4KHQA 3SJJA 3CFOA 3N1BA 1XMGE 2E31A 2P5GA 4J2DA 1CLQA 4FJHA 2LF3A 1XVCE 4KHNA 2ATQA 3J27A 1MMOG 4KI6A
chains in the Genus database with same CATH topology
3C95A 3RMAA 1FZHE 4M3TA 4GAMC 4FJJA 4J2EA 4JS5A 3QETA 3NGIA 3RMCA 3SPYA 3SQ1A 2B8IA 1FZ7E 5IREA 4JRQA 3C94A 2JPNA 4QNDA 3L0MA 3UIQA 3WSOA 4FJ9A 4KI4A 3KD1E 3RWUA 4J2BA 3J2PA 1MTYG 1FXXA 1XU5E 4FVMA 1FZ9E 4DTXA 3RMDA 4FK2A 1IH7A 3C6NB 4EP9A 4FK4A 2DEBA 3CFPA 1FZ6E 3C6PB 5IZ7A 3CQ8A 2OVRB 1FS1A 4FJXA 1FZ3E 4J2AA 3SQ4A 1FZ8E 2VJ5A 4AKHA 1FZ1E 4I9QA 4M45A 3TAFA 2JHCA 3TL8B 3QEIA 2P1MB 3SNNA 2PFTA 1FYZE 4JRPA 4AI6A 3E4WA 3TABA 3SQ0A 3SUOA 3LZIA 1XMFE 2PFVA 1NEXB 1FZ5E 4I9LA 4KHUA 2DTUA 4FJNA 2OYQA 1WAFA 1P22A 3NDKA 4FJGA 2E32A 4HCCA 4KHWA 2H4TA 3QEPA 2OVQB 4FJ8A 4DU3A 2B7MA 4HCBA 4M3XA 3LDBA 1XMHE 3QNNA 1XL3C 3N1EA 2B1EA 3L2OB 3SQ2A 4KHYA 4FK0A 2DY4A 2RCUA 3MKSB 4JS4A 3LDSA 1LDKE 4RL5A 2MMBA 4B08A 3SI6A 3SCXA 2OZMA 3SUPA 4DTNA 4DTSA 3TAGA 2JH8A 1XVGE 4M3YA 2MZWB 4AKIA 1FZ4E 2FW3A 2P1OB 3OGLB 1XU3E 2VJ4A 3OGMB 4EYWA 2P5OA 4FJ5A 1IG9A 2JHPA 3QEXA 4X5MA 4M42A 3LZJA 2P1NB 3NAEA 4DTPA 3SUQA 3K2OA 3SUNA 3TAEA 4FJIA 2OVPB 4ADNA 1FZ2E 5IBKB 4KHSA 2QXFA 3L1NA 3HGKE 4M3WA 1WAJA 4DTMA 3C6OB 1MHYG 3HGLA 3LD8A 3NCIA 1Q9XA 2FYOA 4DTOA 2OZSA 4I6JB 3V7DB 3TJYA 4FJLA 4M3ZA 3CFRA 2YB5A 2P1PB 3NE6A 1XVDE 3QEWA 2LF6A 3QERA 2VIXA 4M3UA 1XVBE 4FJMA 3L8BA 3S9HA 1FZIE 3QESA 3RMBA 3NHGA 4EPHA 4DTUA 4RG8A 4ADOA 2JH9A 3QNOA 4X5NA 5H37A 4DU4A 4M41A 4E3SA 3E4YA 2JHAA 2P1QB 4M3RA 1FZ0E 3HP9A 4DU1A 4FJKA 3KD5E 1MHZG 4FJ7A 4DTJA 1Q9YA 4RNGA 4E4BA 3SPZA 1XVFE 3QEVA 3HL8A 4QNCA 3OGKB 3SVIA 2HD0A 4DTRA 4AKGA 1XVEE 4KHQA 3SJJA 3CFOA 3N1BA 1XMGE 2E31A 2P5GA 4J2DA 1CLQA 4FJHA 2LF3A 1XVCE 4KHNA 2ATQA 3J27A 1MMOG 4KI6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XVB E;  1FZH E;  4GAM C;  1FZI E;  1XVG E;  1FYZ E;  1FZ4 E;  1FZ7 E;  1XMF E;  1XU3 E;  1FZ5 E;  1FZ0 E;  1MHZ G;  1MTY G;  1XU5 E;  1FZ9 E;  1FZ2 E;  1XVF E;  1MHY G;  1FZ6 E;  1XVE E;  1XMH E;  1FZ3 E;  1XMG E;  1FZ8 E;  1XVD E;  1XVC E;  1FZ1 E;  1MMO G; 
#chains in the Genus database with same CATH topology
 3C95 A;  3RMA A;  1FZH E;  4M3T A;  4GAM C;  4FJJ A;  4J2E A;  2JQT A;  4JS5 A;  3QET A;  3NGI A;  3RMC A;  3SPY A;  3SQ1 A;  2B8I A;  1FZ7 E;  5IRE A;  4JRQ A;  3UO3 A;  3C94 A;  2JPN A;  4QND A;  3L0M A;  3UIQ A;  3WSO A;  4FJ9 A;  4KI4 A;  3KD1 E;  3RWU A;  4J2B A;  3J2P A;  1MTY G;  1FXX A;  1XU5 E;  4FVM A;  1FZ9 E;  4DTX A;  3RMD A;  4FK2 A;  1IH7 A;  3C6N B;  4EP9 A;  4FK4 A;  2DEB A;  3CFP A;  1FZ6 E;  3C6P B;  5IZ7 A;  3CQ8 A;  2OVR B;  1FS1 A;  4FJX A;  1FZ3 E;  4IT5 A;  3SQ4 A;  4J2A A;  1FZ8 E;  2VJ5 A;  2K5S A;  4AKH A;  1FZ1 E;  4I9Q A;  4M45 A;  3TAF A;  2JHC A;  3TL8 B;  3QEI A;  2P1M B;  3SNN A;  2PFT A;  1FYZ E;  4JRP A;  4AI6 A;  3E4W A;  3TAB A;  3SQ0 A;  3SUO A;  3LZI A;  1XMF E;  2PFV A;  1NEX B;  1FZ5 E;  4I9L A;  4KHU A;  2DTU A;  4FJN A;  2OYQ A;  1WAF A;  1P22 A;  3NDK A;  4FJG A;  2E32 A;  4HCC A;  4KHW A;  2H4T A;  3QEP A;  2OVQ B;  4FJ8 A;  4DU3 A;  2B7M A;  4HCB A;  4M3X A;  3LDB A;  1XMH E;  3QNN A;  1XL3 C;  3N1E A;  1FPO A;  2B1E A;  3L2O B;  3SQ2 A;  4KHY A;  4FK0 A;  2DY4 A;  2RCU A;  3MKS B;  4JS4 A;  3LDS A;  1LDK E;  4RL5 A;  2MMB A;  4B08 A;  3SI6 A;  3SCX A;  2OZM A;  3SUP A;  4DTN A;  4DTS A;  3TAG A;  2JH8 A;  1XVG E;  4M3Y A;  2MZW B;  4AKI A;  1FZ4 E;  2RKH A;  2FW3 A;  2P1O B;  3OGL B;  1XU3 E;  2VJ4 A;  3OGM B;  4EYW A;  4ICG C;  2P5O A;  4FJ5 A;  1IG9 A;  2JHP A;  3QEX A;  4X5M A;  4M42 A;  3LZJ A;  2P1N B;  3NAE A;  4DTP A;  3SUQ A;  3K2O A;  3SUN A;  3TAE A;  4FJI A;  2OVP B;  4ADN A;  1FZ2 E;  5IBK B;  4KHS A;  2QXF A;  3L1N A;  3HGK E;  4M3W A;  1WAJ A;  4DTM A;  3C6O B;  1MHY G;  3HGL A;  3LD8 A;  3NCI A;  1Q9X A;  2FYO A;  4DTO A;  2OZS A;  4I6J B;  3V7D B;  3TJY A;  4FJL A;  4M3Z A;  3CFR A;  2YB5 A;  2P1P B;  3NE6 A;  1XVD E;  3QEW A;  2LF6 A;  3QER A;  2VIX A;  4M3U A;  1XVB E;  4FJM A;  3L8B A;  3S9H A;  1FZI E;  3QES A;  3RMB A;  3NHG A;  2MW2 A;  4EPH A;  4DTU A;  4RG8 A;  4ADO A;  2JH9 A;  3QNO A;  4X5N A;  5H37 A;  4DU4 A;  4M41 A;  4E3S A;  3E4Y A;  2JHA A;  2P1Q B;  4M3R A;  1FZ0 E;  3HP9 A;  4DU1 A;  4FJK A;  3KD5 E;  1MHZ G;  4FJ7 A;  4DTJ A;  1Q9Y A;  4RNG A;  4E4B A;  3SPZ A;  3BVO A;  1XVF E;  3QEV A;  1N1C A;  3HL8 A;  4QNC A;  1JW2 A;  3OGK B;  3UO2 A;  2HD0 A;  3SVI A;  4DTR A;  4AKG A;  1XVE E;  4KHQ A;  3SJJ A;  3CFO A;  3N1B A;  1XMG E;  2E31 A;  2P5G A;  4J2D A;  1CLQ A;  4FJH A;  2LF3 A;  1XVC E;  4KHN A;  2ATQ A;  3J27 A;  1MMO G;  4KI6 A; 
#chains in the Genus database with same CATH homology
 3C95 A;  3RMA A;  1FZH E;  4M3T A;  4GAM C;  4FJJ A;  4J2E A;  4JS5 A;  3QET A;  3NGI A;  3RMC A;  3SPY A;  3SQ1 A;  2B8I A;  1FZ7 E;  5IRE A;  4JRQ A;  3C94 A;  2JPN A;  4QND A;  3L0M A;  3UIQ A;  3WSO A;  4FJ9 A;  4KI4 A;  3KD1 E;  3RWU A;  4J2B A;  3J2P A;  1MTY G;  1FXX A;  1XU5 E;  4FVM A;  1FZ9 E;  4DTX A;  3RMD A;  4FK2 A;  1IH7 A;  3C6N B;  4EP9 A;  4FK4 A;  2DEB A;  3CFP A;  1FZ6 E;  3C6P B;  5IZ7 A;  3CQ8 A;  2OVR B;  1FS1 A;  4FJX A;  1FZ3 E;  4J2A A;  3SQ4 A;  1FZ8 E;  2VJ5 A;  4AKH A;  1FZ1 E;  4I9Q A;  4M45 A;  3TAF A;  2JHC A;  3TL8 B;  3QEI A;  2P1M B;  3SNN A;  2PFT A;  1FYZ E;  4JRP A;  4AI6 A;  3E4W A;  3TAB A;  3SQ0 A;  3SUO A;  3LZI A;  1XMF E;  2PFV A;  1NEX B;  1FZ5 E;  4I9L A;  4KHU A;  2DTU A;  4FJN A;  2OYQ A;  1WAF A;  1P22 A;  3NDK A;  4FJG A;  2E32 A;  4HCC A;  4KHW A;  2H4T A;  3QEP A;  2OVQ B;  4FJ8 A;  4DU3 A;  2B7M A;  4HCB A;  4M3X A;  3LDB A;  1XMH E;  3QNN A;  1XL3 C;  3N1E A;  2B1E A;  3L2O B;  3SQ2 A;  4KHY A;  4FK0 A;  2DY4 A;  2RCU A;  3MKS B;  4JS4 A;  3LDS A;  1LDK E;  4RL5 A;  2MMB A;  4B08 A;  3SI6 A;  3SCX A;  2OZM A;  3SUP A;  4DTN A;  4DTS A;  3TAG A;  2JH8 A;  1XVG E;  4M3Y A;  2MZW B;  4AKI A;  1FZ4 E;  2FW3 A;  2P1O B;  3OGL B;  1XU3 E;  2VJ4 A;  3OGM B;  4EYW A;  2P5O A;  4FJ5 A;  1IG9 A;  2JHP A;  3QEX A;  4X5M A;  4M42 A;  3LZJ A;  2P1N B;  3NAE A;  4DTP A;  3SUQ A;  3K2O A;  3SUN A;  3TAE A;  4FJI A;  2OVP B;  4ADN A;  1FZ2 E;  5IBK B;  4KHS A;  2QXF A;  3L1N A;  3HGK E;  4M3W A;  1WAJ A;  4DTM A;  3C6O B;  1MHY G;  3HGL A;  3LD8 A;  3NCI A;  1Q9X A;  2FYO A;  4DTO A;  2OZS A;  4I6J B;  3V7D B;  3TJY A;  4FJL A;  4M3Z A;  3CFR A;  2YB5 A;  2P1P B;  3NE6 A;  1XVD E;  3QEW A;  2LF6 A;  3QER A;  2VIX A;  4M3U A;  1XVB E;  4FJM A;  3L8B A;  3S9H A;  1FZI E;  3QES A;  3RMB A;  3NHG A;  4EPH A;  4DTU A;  4RG8 A;  4ADO A;  2JH9 A;  3QNO A;  4X5N A;  5H37 A;  4DU4 A;  4M41 A;  4E3S A;  3E4Y A;  2JHA A;  2P1Q B;  4M3R A;  1FZ0 E;  3HP9 A;  4DU1 A;  4FJK A;  3KD5 E;  1MHZ G;  4FJ7 A;  4DTJ A;  1Q9Y A;  4RNG A;  4E4B A;  3SPZ A;  1XVF E;  3QEV A;  3HL8 A;  4QNC A;  3OGK B;  3SVI A;  2HD0 A;  4DTR A;  4AKG A;  1XVE E;  4KHQ A;  3SJJ A;  3CFO A;  3N1B A;  1XMG E;  2E31 A;  2P5G A;  4J2D A;  1CLQ A;  4FJH A;  2LF3 A;  1XVC E;  4KHN A;  2ATQ A;  3J27 A;  1MMO G;  4KI6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...