1XVFE

Soluble methane monooxygenase hydroxylase: chloropropanol soaked structure
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
166
structure length
166
Chain Sequence
KLGIHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVHLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Product Bound Structures of the Soluble Methane Monooxygenase Hydroxylase from Methylococcus capsulatus (Bath): Protein Motion in the Alpha-Subunit
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Methane monooxygenase component A alpha chain
total genus 62
structure length 166
sequence length 166
chains with identical sequence F
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 2004-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02964 MeMO_Hyd_G Methane monooxygenase, hydrolase gamma chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1xvfE01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1xvfE02
1FZIE 1FZ7E 1XMGE 1FZ1E 1XVDE 1MHZG 1XU5E 1MHYG 4GAMC 1FYZE 1XU3E 1FZ8E 1MMOG 1XMHE 1XVBE 1FZ9E 1XVFE 1XMFE 1FZ3E 1FZ6E 1FZ4E 1XVGE 1FZ0E 1FZ5E 1FZHE 1FZ2E 1MTYG 1XVEE 1XVCE
chains in the Genus database with same CATH superfamily
3K2OA 3NE6A 4AKIA 3OGMB 2QXFA 2MZWB 2RKHA 4FVMA 3SJJA 3QNNA 3SI6A 2B8IA 2P5GA 4KI4A 4KHUA 4ICGC 3QERA 4M3UA 3RMCA 3SVIA 4M3ZA 4JS4A 3QEXA 3SQ0A 4FJJA 4GAMC 3NCIA 1FYZE 1N1CA 2OVQB 3NHGA 4RG8A 3QETA 3KD5E 3UO2A 4QNCA 3SQ1A 1XU3E 2P1MB 3QESA 4M42A 2VJ5A 4QNDA 2P1NB 5H37A 2JHCA 1XMHE 4DTRA 1XVBE 2VJ4A 4JS5A 4EYWA 1JW2A 3SUOA 3TJYA 3C95A 4KI6A 4M3WA 4DU3A 4AKHA 2P1PB 3SUQA 3N1BA 2JH9A 4J2DA 3UO3A 3SUPA 4DU1A 4FJGA 5IREA 4FJNA 3HL8A 2DTUA 4J2EA 1FS1A 3CFRA 1IG9A 2OZSA 2DEBA 2JH8A 4KHNA 3QEIA 2YB5A 4JRPA 1XVDE 2B7MA 4IT5A 2P1QB 4I6JB 4DTMA 2LF3A 2E31A 4M41A 4FJIA 3TAGA 3LZIA 3SUNA 3V7DB 4B08A 4FJLA 3E4WA 2K5SA 4KHWA 1NEXB 4FJ8A 1FZ8E 3RMAA 3SQ2A 1LDKE 2HD0A 3J2PA 5IBKB 3L2OB 4DTOA 3RMDA 4J2BA 1FZ9E 4FJKA 3TAFA 1FZ3E 1FZ6E 3J27A 4KHQA 4FJXA 3NAEA 4FK2A 1WAFA 1XVGE 4I9LA 3HGKE 4DTUA 2JHPA 1FZHE 4HCBA 4HCCA 4FJ5A 4I9QA 2FW3A 3CQ8A 3NGIA 1FZ7E 4M3TA 4M3XA 1FZ1E 2FYOA 3C6OB 3NDKA 4DTPA 1IH7A 3TAEA 4RNGA 1MHZG 3LDSA 1XU5E 3C6NB 4E3SA 3S9HA 3QEPA 4KHYA 3SPZA 3C94A 4FK4A 2PFVA 4M45A 3LZJA 4E4BA 2OVPB 4FJ9A 5IZ7A 4DTXA 1MMOG 2OVRB 4EP9A 3SPYA 3HP9A 3N1EA 1CLQA 4RL5A 4M3RA 2B1EA 3WSOA 1FZ4E 2P5OA 4FK0A 1Q9YA 2JPNA 3HGLA 4X5MA 1FPOA 4ADOA 1FZ0E 2VIXA 2H4TA 4X5NA 3SNNA 4FJHA 2E32A 4AI6A 4DU4A 1XVEE 4M3YA 1XVCE 3L8BA 3L0MA 1Q9XA 4KHSA 1WAJA 2JHAA 1FZIE 4AKGA 1FXXA 3BVOA 1XMGE 2LF6A 3E4YA 3MKSB 2MW2A 3CFPA 2PFTA 3TABA 4FJMA 3C6PB 2ATQA 4FJ7A 2DY4A 3LD8A 1MHYG 3RWUA 3CFOA 3L1NA 2P1OB 2RCUA 3TL8B 4JRQA 3RMBA 3UIQA 3SCXA 2OZMA 2MMBA 4J2AA 3OGLB 1XVFE 1XMFE 3QEWA 3SQ4A 4EPHA 1XL3C 2JQTA 3OGKB 3KD1E 4DTSA 4ADNA 1FZ5E 4DTJA 3QEVA 1FZ2E 4DTNA 3LDBA 3QNOA 1MTYG 1P22A 2OYQA
chains in the Genus database with same CATH topology
3K2OA 3NE6A 4AKIA 3OGMB 2QXFA 2MZWB 4FVMA 3SJJA 3QNNA 3SI6A 2B8IA 2P5GA 4KI4A 4KHUA 3QERA 4M3UA 3RMCA 3SVIA 4M3ZA 4JS4A 3QEXA 3SQ0A 4FJJA 4GAMC 3NCIA 1FYZE 2OVQB 3NHGA 3QETA 4RG8A 3KD5E 4J2EA 3SQ1A 4QNCA 4M42A 1XU3E 2P1MB 3QESA 2VJ5A 4QNDA 2P1NB 5H37A 2JHCA 1XMHE 4DTRA 1XVBE 2VJ4A 4JS5A 4EYWA 3SUOA 3TJYA 3C95A 4KI6A 4M3WA 4DU3A 4AKHA 2P1PB 3SUQA 3N1BA 2JH9A 4J2DA 3SUPA 4DU1A 4FJGA 5IREA 4FJNA 3HL8A 2DTUA 1FS1A 3CFRA 1IG9A 2OZSA 2DEBA 2JH8A 4KHNA 3QEIA 2YB5A 4JRPA 1XVDE 2B7MA 2P1QB 4I6JB 4DTMA 2LF3A 2E31A 4M41A 4FJIA 3TAGA 3LZIA 3SUNA 3V7DB 4B08A 4FJLA 3E4WA 4KHWA 1NEXB 4FJ8A 1FZ8E 3RMAA 3SQ2A 1LDKE 2HD0A 3J2PA 5IBKB 3L2OB 4DTOA 3RMDA 4J2BA 1FZ9E 4FJKA 3TAFA 1FZ3E 1FZ6E 3J27A 4KHQA 4FJXA 3NAEA 4FK2A 1WAFA 1XVGE 4I9LA 3HGKE 4DTUA 2JHPA 1FZHE 4HCBA 4HCCA 4FJ5A 4I9QA 2FW3A 3CQ8A 3NGIA 1FZ7E 4M3TA 4M3XA 1FZ1E 2FYOA 3C6OB 3NDKA 4DTPA 1IH7A 3TAEA 4RNGA 1MHZG 3LDSA 1XU5E 3C6NB 4E3SA 3S9HA 3QEPA 4KHYA 3SPZA 3C94A 4FK4A 2PFVA 4M45A 3LZJA 4E4BA 2OVPB 4FJ9A 5IZ7A 4DTXA 1MMOG 2OVRB 4EP9A 3SPYA 3HP9A 3N1EA 1CLQA 4RL5A 4M3RA 2B1EA 3WSOA 1FZ4E 2P5OA 4FK0A 1Q9YA 2JPNA 3HGLA 4X5MA 4ADOA 1FZ0E 2VIXA 2H4TA 4X5NA 3SNNA 4FJHA 2E32A 4AI6A 4DU4A 1XVEE 4M3YA 1XVCE 3L8BA 3L0MA 1Q9XA 4KHSA 1WAJA 2JHAA 1FZIE 4AKGA 1FXXA 1XMGE 2LF6A 3E4YA 3MKSB 3CFPA 2PFTA 3TABA 4FJMA 3C6PB 2ATQA 4FJ7A 2DY4A 3LD8A 1MHYG 3RWUA 3CFOA 3L1NA 2P1OB 2RCUA 3TL8B 4JRQA 3RMBA 3UIQA 3SCXA 2OZMA 2MMBA 4J2AA 3OGLB 1XVFE 1XMFE 3QEWA 3SQ4A 4EPHA 1XL3C 3OGKB 3KD1E 4DTSA 4ADNA 1FZ5E 4DTJA 3QEVA 1FZ2E 4DTNA 3LDBA 3QNOA 1MTYG 1P22A 2OYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FZI E;  1FZ7 E;  1XMG E;  1FZ1 E;  1XVD E;  1MHZ G;  1XU5 E;  1MHY G;  4GAM C;  1FYZ E;  1XU3 E;  1FZ8 E;  1MMO G;  1XMH E;  1XVB E;  1FZ9 E;  1XVF E;  1XMF E;  1FZ3 E;  1FZ6 E;  1FZ4 E;  1XVG E;  1FZ0 E;  1FZ5 E;  1FZH E;  1FZ2 E;  1MTY G;  1XVE E;  1XVC E; 
#chains in the Genus database with same CATH topology
 3K2O A;  3NE6 A;  4AKI A;  3OGM B;  2QXF A;  2MZW B;  2RKH A;  4FVM A;  3SJJ A;  3QNN A;  3SI6 A;  2B8I A;  2P5G A;  4KI4 A;  4KHU A;  4ICG C;  3QER A;  4M3U A;  3RMC A;  3SVI A;  4M3Z A;  4JS4 A;  3QEX A;  3SQ0 A;  4FJJ A;  4GAM C;  3NCI A;  1FYZ E;  1N1C A;  2OVQ B;  3NHG A;  4RG8 A;  3QET A;  3KD5 E;  3UO2 A;  4QNC A;  3SQ1 A;  1XU3 E;  2P1M B;  3QES A;  4M42 A;  2VJ5 A;  4QND A;  2P1N B;  5H37 A;  2JHC A;  1XMH E;  4DTR A;  1XVB E;  2VJ4 A;  4JS5 A;  4EYW A;  1JW2 A;  3SUO A;  3TJY A;  3C95 A;  4KI6 A;  4M3W A;  4DU3 A;  4AKH A;  2P1P B;  3SUQ A;  3N1B A;  2JH9 A;  4J2D A;  3UO3 A;  3SUP A;  4DU1 A;  4FJG A;  5IRE A;  4FJN A;  3HL8 A;  2DTU A;  4J2E A;  1FS1 A;  3CFR A;  1IG9 A;  2OZS A;  2DEB A;  2JH8 A;  4KHN A;  3QEI A;  2YB5 A;  4JRP A;  1XVD E;  2B7M A;  4IT5 A;  2P1Q B;  4I6J B;  4DTM A;  2LF3 A;  2E31 A;  4M41 A;  4FJI A;  3TAG A;  3LZI A;  3SUN A;  3V7D B;  4B08 A;  4FJL A;  3E4W A;  2K5S A;  4KHW A;  1NEX B;  4FJ8 A;  1FZ8 E;  3RMA A;  3SQ2 A;  1LDK E;  2HD0 A;  3J2P A;  5IBK B;  3L2O B;  4DTO A;  3RMD A;  4J2B A;  1FZ9 E;  4FJK A;  3TAF A;  1FZ3 E;  1FZ6 E;  3J27 A;  4KHQ A;  4FJX A;  3NAE A;  4FK2 A;  1WAF A;  1XVG E;  4I9L A;  3HGK E;  4DTU A;  2JHP A;  1FZH E;  4HCB A;  4HCC A;  4FJ5 A;  4I9Q A;  2FW3 A;  3CQ8 A;  3NGI A;  1FZ7 E;  4M3T A;  4M3X A;  1FZ1 E;  2FYO A;  3C6O B;  3NDK A;  4DTP A;  1IH7 A;  3TAE A;  4RNG A;  1MHZ G;  3LDS A;  1XU5 E;  3C6N B;  4E3S A;  3S9H A;  3QEP A;  4KHY A;  3SPZ A;  3C94 A;  4FK4 A;  2PFV A;  4M45 A;  3LZJ A;  4E4B A;  2OVP B;  4FJ9 A;  5IZ7 A;  4DTX A;  1MMO G;  2OVR B;  4EP9 A;  3SPY A;  3HP9 A;  3N1E A;  1CLQ A;  4RL5 A;  4M3R A;  2B1E A;  3WSO A;  1FZ4 E;  2P5O A;  4FK0 A;  1Q9Y A;  2JPN A;  3HGL A;  4X5M A;  1FPO A;  4ADO A;  1FZ0 E;  2VIX A;  2H4T A;  4X5N A;  3SNN A;  4FJH A;  2E32 A;  4AI6 A;  4DU4 A;  1XVE E;  4M3Y A;  1XVC E;  3L8B A;  3L0M A;  1Q9X A;  4KHS A;  1WAJ A;  2JHA A;  1FZI E;  4AKG A;  1FXX A;  3BVO A;  1XMG E;  2LF6 A;  3E4Y A;  3MKS B;  2MW2 A;  3CFP A;  2PFT A;  3TAB A;  4FJM A;  3C6P B;  2ATQ A;  4FJ7 A;  2DY4 A;  3LD8 A;  1MHY G;  3RWU A;  3CFO A;  3L1N A;  2P1O B;  2RCU A;  3TL8 B;  4JRQ A;  3RMB A;  3UIQ A;  3SCX A;  2OZM A;  2MMB A;  4J2A A;  3OGL B;  1XVF E;  1XMF E;  3QEW A;  3SQ4 A;  4EPH A;  1XL3 C;  2JQT A;  3OGK B;  3KD1 E;  4DTS A;  4ADN A;  1FZ5 E;  4DTJ A;  3QEV A;  1FZ2 E;  4DTN A;  3LDB A;  3QNO A;  1MTY G;  1P22 A;  2OYQ A; 
#chains in the Genus database with same CATH homology
 3K2O A;  3NE6 A;  4AKI A;  3OGM B;  2QXF A;  2MZW B;  4FVM A;  3SJJ A;  3QNN A;  3SI6 A;  2B8I A;  2P5G A;  4KI4 A;  4KHU A;  3QER A;  4M3U A;  3RMC A;  3SVI A;  4M3Z A;  4JS4 A;  3QEX A;  3SQ0 A;  4FJJ A;  4GAM C;  3NCI A;  1FYZ E;  2OVQ B;  3NHG A;  3QET A;  4RG8 A;  3KD5 E;  4J2E A;  3SQ1 A;  4QNC A;  4M42 A;  1XU3 E;  2P1M B;  3QES A;  2VJ5 A;  4QND A;  2P1N B;  5H37 A;  2JHC A;  1XMH E;  4DTR A;  1XVB E;  2VJ4 A;  4JS5 A;  4EYW A;  3SUO A;  3TJY A;  3C95 A;  4KI6 A;  4M3W A;  4DU3 A;  4AKH A;  2P1P B;  3SUQ A;  3N1B A;  2JH9 A;  4J2D A;  3SUP A;  4DU1 A;  4FJG A;  5IRE A;  4FJN A;  3HL8 A;  2DTU A;  1FS1 A;  3CFR A;  1IG9 A;  2OZS A;  2DEB A;  2JH8 A;  4KHN A;  3QEI A;  2YB5 A;  4JRP A;  1XVD E;  2B7M A;  2P1Q B;  4I6J B;  4DTM A;  2LF3 A;  2E31 A;  4M41 A;  4FJI A;  3TAG A;  3LZI A;  3SUN A;  3V7D B;  4B08 A;  4FJL A;  3E4W A;  4KHW A;  1NEX B;  4FJ8 A;  1FZ8 E;  3RMA A;  3SQ2 A;  1LDK E;  2HD0 A;  3J2P A;  5IBK B;  3L2O B;  4DTO A;  3RMD A;  4J2B A;  1FZ9 E;  4FJK A;  3TAF A;  1FZ3 E;  1FZ6 E;  3J27 A;  4KHQ A;  4FJX A;  3NAE A;  4FK2 A;  1WAF A;  1XVG E;  4I9L A;  3HGK E;  4DTU A;  2JHP A;  1FZH E;  4HCB A;  4HCC A;  4FJ5 A;  4I9Q A;  2FW3 A;  3CQ8 A;  3NGI A;  1FZ7 E;  4M3T A;  4M3X A;  1FZ1 E;  2FYO A;  3C6O B;  3NDK A;  4DTP A;  1IH7 A;  3TAE A;  4RNG A;  1MHZ G;  3LDS A;  1XU5 E;  3C6N B;  4E3S A;  3S9H A;  3QEP A;  4KHY A;  3SPZ A;  3C94 A;  4FK4 A;  2PFV A;  4M45 A;  3LZJ A;  4E4B A;  2OVP B;  4FJ9 A;  5IZ7 A;  4DTX A;  1MMO G;  2OVR B;  4EP9 A;  3SPY A;  3HP9 A;  3N1E A;  1CLQ A;  4RL5 A;  4M3R A;  2B1E A;  3WSO A;  1FZ4 E;  2P5O A;  4FK0 A;  1Q9Y A;  2JPN A;  3HGL A;  4X5M A;  4ADO A;  1FZ0 E;  2VIX A;  2H4T A;  4X5N A;  3SNN A;  4FJH A;  2E32 A;  4AI6 A;  4DU4 A;  1XVE E;  4M3Y A;  1XVC E;  3L8B A;  3L0M A;  1Q9X A;  4KHS A;  1WAJ A;  2JHA A;  1FZI E;  4AKG A;  1FXX A;  1XMG E;  2LF6 A;  3E4Y A;  3MKS B;  3CFP A;  2PFT A;  3TAB A;  4FJM A;  3C6P B;  2ATQ A;  4FJ7 A;  2DY4 A;  3LD8 A;  1MHY G;  3RWU A;  3CFO A;  3L1N A;  2P1O B;  2RCU A;  3TL8 B;  4JRQ A;  3RMB A;  3UIQ A;  3SCX A;  2OZM A;  2MMB A;  4J2A A;  3OGL B;  1XVF E;  1XMF E;  3QEW A;  3SQ4 A;  4EPH A;  1XL3 C;  3OGK B;  3KD1 E;  4DTS A;  4ADN A;  1FZ5 E;  4DTJ A;  3QEV A;  1FZ2 E;  4DTN A;  3LDB A;  3QNO A;  1MTY G;  1P22 A;  2OYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...