1XVOA

Trypsin from fusarium oxysporum at ph 6
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
224
structure length
224
Chain Sequence
b'IVGGTSASAGDFPFIVSISRNGGPWCGGSLLNANTVLTAAHCVSGYAQSGFQIRAGSLSRTSGGITSSLSSVRVHPSYSGNNNDLAILKLSTSIPSGGNIGYARLAASGSDPVAGSSATVAGWGATSEGGSSTPVNLLKVTVPIVSRATCRAQYGTSAITNQMFCAGVSSGGKDSCQGDSGGPIVDSSNTLIGAVSWGNGCARPNYSGVYASVGALRSFIDTYA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords trypsin
publication title Extraction of functional motion in trypsin crystal structures.
pubmed doi rcsb
molecule tags Hydrolase
total genus 56
structure length 224
sequence length 224
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2004-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1xvoA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1xvoA01
6ESTA 2W3IA 3PV4A 4DIIH 1O3OA 2PLXA 2NU1E 1Z8JB 3U8OH 2XWAA 5C5OA 3QDZB 3SV6A 1LKBA 4CRAA 3SGAE 1K1MA 3NUMA 5FXLA 5EG4A 5C67A 3IWMA 4WXVA 2BTCE 1XXFA 2A1DB 5FPYA 1L1NA 4HFPB 4X8TH 1G3EA 1YPJH 2IPHA 2Z7FE 3A7YA 3RXJA 1XUIA 3L33A 2I6QA 1DM4B 1A5GH 1C5ZB 1FN8A 2G81E 4QT8C 3E90B 1J16A 4XOJA 1VCWA 2QGRA 1SR5C 1O2VA 4H4FA 1N8OC 2AMQA 4YLUA 2HNTE 4ISLA 3PLKA 4Y0YE 3BG4B 4GLYA 2ZECA 2D8WA 1YCPM 2IOTA 1KDQA 2W5EA 3E1XB 4MPUA 1QA7A 4AB9A 5DP9A 1BBRE 3A7ZA 2CHAB 2XWBI 5DO4H 1JIRA 1L2EA 1NT1A 1MZDA 1TRNA 3RXHA 5GIBA 4U30A 2WPHS 1F5LA 1RTFB 2GDEH 1AE5A 2VIQA 2Z3CA 1ELDE 1GI6A 1MTVA 5GDSH 4AFUA 1OYTH 3LGYA 4AFQA 1V2LT 4CRGA 1QJ6B 3U8RH 2VIPA 2AGGX 4ABHA 2ANKH 4ZHAA 3RXKA 4UONA 1KDQB 1CA0B 5JBTA 1CT4E 5C1YA 2SGPE 4NIVA 1ARCA 1LDTT 1BTWA 1V6DA 1Y3YA 3GOVB 4VGCB 4X8VH 3TITA 1IQNA 1CA8B 1TABE 1GJ5H 5BRRE 1OP8A 1UTKA 4WWYA 1AFEH 4CBNA 3SHAH 3T29A 4MPVA 4E7NA 1MKWH 1PFXC 2F9NA 3LGTA 5EPYA 4B74A 2FI4E 4E06H 4ZROA 2A4OA 1MKWK 2ZHDA 2BOKA 4Y79A 3BF6H 3RC5A 4YTAA 4IW4E 2NU0E 1RXPA 1W14U 2F9BH 3PMJA 3QZRA 4ABIA 5DG6A 2BLWA 4D9QA 2AIQA 3SNEA 1TNIA 1NY22 4DCDA 4NCYA 1HXEH 3STJA 3SV9A 1P2QA 3K6YA 3ESTA 4NIYA 1Z1IA 1QIXB 4THNH 1Z8GA 5EGMA 2LPRA 1EJNA 1TPSA 4D76A 4U2WA 1GBLA 1ZSLA 1FDPA 2HGTH 5JDUB 2J34A 2FLBH 3F9GA 1ANEA 1GBDA 3GCTG 1SOTA 1O3DA 4BAQB 3B8JA 3RM2H 3VEQB 4FUIA 4X6MA 1PQ8A 3SV7A 3SJ9A 1PJPA 2PKSB 1HJAC 7GCHG 3R3GB 3CP7A 4K1EA 1SOZA 2A45B 1EJAA 3M37A 3SU5A 4Y7BA 3ZV8A 1SL3A 5EQRA 4O9VA 2H6MA 1BTHH 2VJ1A 2A32A 2F9VA 3M7UA 2ZKSA 1V2MT 4FUBA 2GMTC 3SNBA 4XSKU 1O2QA 2IJOB 4H42U 1C1WH 1SGNE 2ZDMA 3A83A 3IITA 1K28D 2FOHA 1SG8B 4BAOB 3P6ZB 2EI8A 2OBQA 6GCHG 2ZHWH 1QRXA 1TYNA 2TGAA 3A82A 5DPAA 3GY7A 3MNXA 3ZZ9A 3HKJB 1FZZA 1ORFA 2G00A 1ZPBA 4YM9A 5CE1A 3T2NA 2AMPA 1FJSA 3OYPA 4HI3A 2BOHB 1SVPA 2ZHQH 1O2TA 4ZMAH 1TPPA 1OS8A 1L0ZA 1HV7A 5DP5A 3LU9B 1CGIE 1ABIH 3U9AH 4DW2U 1MAYA 1A5IA 2QXGA 1O33A 3SU4A 2NU4E 2SGFE 2XCNA 1HXFH 3VGCC 1A3BH 1T4UH 3A7TA 2D2DA 1Y5BT 2P93A 3PLPA 4TYDA 1BRCE 4CRBA 3SBKA 1TPOA 4R0IA 3CS0A 4BAKB 2WYGA 1IOEA 3A88A 1OP0A 3VPKA 2BDIA 3EA9A 3ZZ7A 2Y7ZA 7LPRA 1IQKA 1O5CB 2VVUA 2ZCLP 5K0HA 1GBAA 2WPMS 3ENSB 1WTGH 1EAUA 1MH0A 2TGPZ 2Z6BD 3RUOA 1YPGH 2R2MB 1C4U2 1J15A 4ESTE 1XUFA 1TFXA 4AFZA 3PTNA 4MNWA 1GJCB 1BTPA 1ZMNA 3PMAB 2OBOA 1ZPZA 4Y6DA 1F0UA 2A4QA 4DIHH 2Z3EA 2EEKA 3MHWU 2BY8X 3A81A 3QX5H 1OKXA 3EGKH 1OXGA 3GDUA 1U6QA 1VJ9U 3HKIB 3I78A 1F0SA 1MMJN 1AWFH 4NG9H 1GHZA 2GV6A 1ZZZA 5EW1H 4NFEA 2FEQH 2VU8E 3N7OA 3DD2H 3K9XB 1NESE 2J95A 1C1QA 3F68H 5DKMA 2W7SA 1A5HA 3BTKE 2V6NA 3UTUH 3MNBA 2PUQH 3MMGA 2H1UA 2ESTE 1LO6A 1GBEA 2AIPA 2XBXA 3GCHC 1DICA 4X8SH 1LHFH 3Q3XA 4YT6H 1MQ6A 1E34B 4B2AA 1SGRE 1IQHA 1OPHB 3HGNA 3UPEA 2ZZUH 3DA9B 1TBRH 5JBCS 4JZEH 1C5VA 1NFYA 3RXTA 2GT7A 1O2ZA 1P06A 3NZIA 1GL0E 3ATIA 3FVFB 1YPLH 1FONA 1O5FH 1JXPA 1MKXK 2R0KA 4A1VA 2VGCB 2WYJA 1H8DH 1S85A 4X6OA 4GSOA 1C2GA 1H9HE 3TU7H 1AWHB 4OS6A 1P03A 3DFLA 4M7GA 5A2MH 3A8DA 1GMDG 1GHYH 1EAIA 5E2OA 1GHAF 1P02A 1KXAA 2YOLA 1O3CA 1ZJKA 4ABEA 1FQ3A 3SGBE 1MBMA 3TH3H 3SU6A 1DY8A 2ZDLA 3OY6U 3OSYA 1H9IE 4K8YA 1UTJA 3QLPH 1ETTH 2EI6A 3E6PH 5A8YA 4ISIH 4AGJA 1O37A 3Q76A 2A5AA 3PO1B 3B23B 1YPKH 1ZSKA 4I33A 3RXFA 4X8UH 5EQSA 1LPKB 4BTIB 1Y3WA 1TGSZ 3LC5A 1T7CA 1NU7B 2QAAA 2C93B 4D8NA 1K1JA 1SGYE 2FS8A 5I25A 1QJ7B 2ZDVH 1Z6EA 2WPJS 1P2KA 4IC5A 3SUEA 2P8OC 1C2JA 1KLIH 1ELVA 1KXFA 4ZXXH 1CU1A 3PLBA 1EPTC 3KQEA 3LIWA 4NZQA 1CVWH 1DX5M 2FYQA 4DJZB 2ZHEH 1AMHA 1C1PA 5GXPA 3GYMA 1C9PA 3U98H 2A2QH 1C2FA 2RG3A 5GWZA 2P3UB 4Y11E 1KXBA 3V3MA 1LPGB 1QTFA 1P8VC 1LHEH 4JK5A 3DHKH 3O8RA 1ZMLA 1GHVH 4DG4A 4HZHA 4UD9H 3RP2A 5C20A 1TBZH 1SB1H 3PMBB 1O3FA 2ZO3H 3P8OA 4Y10E 4UFDH 3UOUA 7ESTE 2Y80A 2Y82A 4ABAA 2GGVB 2P59A 3I77A 1W2KH 4DVAU 1KY9A 1P2JA 3MO9A 4TWWA 3ZZDA 2VIWA 1T32A 5EXNA 1IQFA 5C2ZA 1O5EH 4AGKA 3TK5A 4MVNA 1G2LA 2ZGXH 1FUJA 1DVAH 1TWXB 3HK3B 5AF9H 3V12A 4AG2A 1RIWB 4YT7H 5E8EH 1K1OA 2ZU5A 1FMGA 1ETRH 1WSSH 2CV3A 1ACBE 3CS7A 4XBDA 2NWNA 2WPIS 2OC0A 5EPNA 6CHAC 3GY6A 2SGAA 1YPHC 2XBYA 3LH1A 1KLTA 4I32A 3BTFE 2TRMA 1SHYA 4ZHLU 1HYLA 1IQMA 3ZZ3A 1C1MA 4ABJA 1Y8TA 3ZVGA 5CHAC 5C1UA 2C8YB 1DXPA 2BZ6H 5DP4A 2ZTYA 1FPCH 1GCDA 2ZG0H 4GAWA 5DJ7A 1C5SA 4Z0KA 2QV1A 3BV9B 2FESH 1Y3XA 1BQYA 1TGCA 4IS5A 3LKWA 3SU0A 2EA3A 5LPEA 2GX4A 1S6FA 3FP7E 1AVXA 1UVTH 3KQBA 3T28A 1W12U 4X1NU 4ISHH 1CBWC 4ISNA 2HWLB 1M9UA 2VVVA 1PPEE 1EAXA 2Z3DA 5DP3A 1ZMJA 3RXLA 1FY3A 3HATH 3MOCA 1Z8IB 1UK4A 3FZZA 3BEUA 1AUJA 4A6LA 1XUJA 3DUXH 4JYVH 2PFEA 1G2MA 4WH8A 4J2YB 3ZZ5A 2BXUH 2H9EH 4CHAC 1P11E 1RTLA 2J92A 2WUBA 3SW2B 1MTNC 3TH2H 1QB9A 2BXTH 5JBAS 1DE7H 2EC9H 1ZHPA 1DWBH 1O30A 1Z8RA 3SNDA 1O3PB 1O3GA 5AHGH 1A0HB 2A5KA 2W26A 1TMUH 5LPRA 2HRVA 1E0FD 1MCVA 1GBHA 5L6NH 2FI3E 3D49H 1AFQB 1BUIA 1DLKB 3A80A 1GBKA 2G55A 1NRNH 3W95A 2ZGBH 3MYWA 1W8BH 1IHSH 2V0BA 1MCTA 2OC1A 2SGEE 3SV2H 1GJ4H 1W0ZU 2FOEA 4BTUB 1RS0A 1BTYA 1UTNA 3A7WA 4GUXA 4CR9A 1D3DB 3ZVCA 1GGDC 4Q80A 3H7OA 1HAYB 1VCPA 1UCYH 3V0XA 3V13A 3QWCH 2JH0D 4Y0ZE 1O2GH 1F92A 1MU8B 3I29A 4JMYA 4ZAEA 1L4ZA 1O3JA 4E05H 1GBIA 5F8XA 1NTPA 4YO9A 1AHTH 1FY4A 3EE0B 3SU1A 3QN7A 2QF0A 1GI2A 4IC6A 2BMGB 4JZFH 1GI3A 2RA0A 1E35B 1HDTH 1O2PA 1ZLRA 1UTOA 1GMCG 2A4GA 3EYDA 3M3VA 2Q6GA 1O2RA 1GMHG 2FM2A 2VIDA 1NC6A 1ID5H 4OGXA 3SI3H 2R3YA 4O3TA 3OX7U 3TH4H 4CBOA 4KTCA 3T26A 4X2WA 3RU4E 2PR3A 2GV7A 1OWJA 2UWLA 1OWDA 2G5NA 1V2TT 3EDXB 4YLQH 4X0WU 1O5AB 1THRH 3LGVA 1WYKA 2OQUA 1SQAA 2H5CA 1HAVA 2O8LA 3NXPA 1C5RA 4DY7B 1EB2A 2F3CE 2A7JA 2THFB 2Y5GA 3QUMP 1HJ8A 1BJUA 2BDHA 1EP6A 2XW9A 3M5NA 1LMWB 1UTMA 1FY8E 2PUXB 3QGJA 2Z9KA 1F5KU 1P57B 3A86A 2VH0A 5FHTA 1KIGH 4Y8XA 4FVBA 1XVOA 2VINA 1D6RA 4FU8A 5ESBA 2WPLS 2ZFQH 1EZSC 1PQ5A 4AN7A 3BTME 4K5ZA 1DWCH 2PTCE 1SGFG 1D9IA 1EX3A 2VB0A 2TIOA 3VFEA 1KLJH 1RTKA 2UUKB 3ZV9A 4DGJA 2ZDNA 2QY0B 4FU9A 4UDWH 2A2XH 1D3QB 1QL7A 4X1SU 5BPEA 1S83A 3Q3KA 1GBMA 3ATLA 3GISB 3SUGA 3FP8E 2BDBA 1GDQA 2FZZA 1GCTC 1F7ZA 1F0TA 2ZU2A 8GCHF 1AIXH 1A1RA 3AAVA 2ZTXA 4I8HA 1P2NA 1O2YA 1J8AA 2SGDE 1TA2A 1V2ST 3P8FA 1JOUB 3AW0A 1LHCH 2SFAA 5B6OA 1C5MD 3RU4D 3SO3A 2FODA 2ZFRH 1KTTB 1BOQA 3Q77A 3A89A 4MQAA 3A8CA 1WAYB 4A1TA 3PMHB 1VJAU 3ZZ8A 3F1SB 2ZGCA 5F03A 2ALVA 4WMFA 1FV9A 2BQ7B 2AS9A 1Y5UT 1FIWA 2STAE 1JMOH 2OTVA 1RJXB 4MLFB 3HPTB 2J94A 2GVFA 1C2HA 5F6MA 2VH6A 2XNIA 3KF2A 5H4IB 1W7XH 1V2OT 1EB1H 1BMNH 1T8OA 2JETB 1C5WB 1BTZA 1GJ6A 2RA3A 3ZZCA 1Y3UA 3M35A 1F0RA 2HNTF 2WV4A 1LHGH 3P8NA 3RXEA 1X7AC 3RLWH 1YPEH 5A8ZA 1PQ7A 1BRBE 4SGAE 3NPSA 1GJAB 4CREA 4K69A 1DOJA 2GCTC 2BD8A 1B0FA 1FN6A 1TGTA 1ZR0A 1K2I1 2FO9A 4A7IB 1QB1A 1FXYA 2UWOA 2SNVA 1BDAA 4JYTA 1EQ9A 3MH6A 3SZNA 1IQLA 1EZXC 4B1TA 2QXHA 5F8TA 1NM6A 1GHBF 1TLDA 2GCHG 1XUGA 1DSUA 3BEFB 4XE4A 4ZXYH 1MBQA 4IN2A 4CRFA 1GG6B 5HM2A 1S0RA 3M5MA 5T3HA 3P70B 1QR3E 1C5NH 3T27A 1T31A 1T4VH 1OWKA 4Q7YA 5PTPA 3BTWE 5HMAA 2GD4B 1P05A 1GJBB 1VZQH 4OS4A 3H5CB 1FY5A 4Q7ZA 3FAOA 2PGBB 1UO6A 1AB9B 2ILNA 5DP6A 7KMEH 2FXRA 1SGFA 2O8TA 3NKKA 2ZEBA 1DS2E 1LVYA 1FLEE 1BTXA 2P95A 1O5DH 4MNYA 5TJXA 3RXCA 4Q2KA 1HAHH 3UWIA 2XBWA 4BNRA 3MNSA 1DUEA 2O8MA 2Q6DA 3GDVA 5EQQA 3P95A 4RN6A 1QNJA 3ZZAA 1SGDE 4KP0A 4RSPA 1B0EA 1C5UA 1ELAA 4XBCA 2M5TA 1SGTA 1THSH 1AZ8A 1QURH 3QTVH 1NU9A 1P2IA 1V2PT 2UWPA 1PPBH 2OCVB 4BXSA 5DGJA 1HIAA 5E2PA 3D65E 3Q00A 1WTHD 4MDSA 4I31A 2Z9GA 3A85A 1TMBH 3ZVAA 5FAHA 1GI4A 1SHHB 1EASA 1CHOG 1EZQA 1GWAA 1N8OB 5C3NA 3PYHA 1DANH 3TGKE 5FX5A 1FY1A 1O39A 1PPZA 3RXRA 5JYIA 3GCTF 5EW2H 4Y76A 2TPIZ 3SQEE 3BEIB 1QFKH 1LVMA 4ABFA 1KXCA 2ZC9H 8LPRA 3GDSA 2P3TB 4YOGA 1O3MA 7GCHF 1TRMA 3SHCH 1C5OH 1HLTH 4DOQA 5T6FA 1ZRKA 1ANCA 4X6PA 1TNGA 4NA8A 2VVCA 3U69H 1AKSA 4WVPE 1O3EA 1GI1A 1TX7A 1GI7B 1F2SE 1Y3VA 1AQ7A 3UFAA 3LOXA 3RXMA 2ZF0H 1DPOA 3DT0H 2OXSA 1O5BB 3F9EA 2W7UA 4H6SB 2D1JA 3KNXA 4NWKA 4LZ4B 1CT2E 6GCHF 1O3LA 1LQDB 2IN2A 2FDAA 2G4UA 1AO5A 3TLOA 3F9HA 1MKXH 1P2OA 3M7QA 3UR9A 3A8BA 1EUFA 3UWJH 2GDDA 1C1NA 4K8BA 4GVUA 5JBBS 1FI8A 3VB7A 1AKSB 1GI0A 3ODDA 1UMAH 3P8GA 2Y81A 1SGIB 1UK3A 1QL9A 1VGCC 2CGAA 1RRKA 2VWOA 3SJ8A 5L2ZH 1TQ0B 1HAGE 4MTBA 2H5DA 1WU1A 3F9FA 1GBJA 4FUCA 2TBSA 1RFNA 1DWEH 3PTBA 2Q6FA 2ANMH 1UVOA 4MPWA 5F8ZA 1OYQA 1OSSA 1TNLA 1SGPE 4X2YA 5JB9S 1MTUA 2Z9LA 4U01A 1GBFA 2BY7X 1ZPCA 1T8LA 2DUCA 1C9TA 1OX1A 4E7RG 1SGCA 3GY3A 1P0SH 4I8JA 2J38A 3B9FH 2J2UA 4CH2B 2Y7XA 1QL8A 1XKAC 1GDUA 2ZP0H 3LH3A 5GCHF 2AGIX 3RXIA 1Z71A 1V2UT 4D9RA 3MH7A 1HJAB 2BD2A 2HVXA 1BRUP 3M61U 2FI5E 2ODQA 1C2MA 4NIXA 1PPFE 4GCHF 3LGUA 3SJOA 4UE7H 2ZFTA 2OQ5A 1V2NT 5LPFA 1GVLA 1Q3XA 2F91A 1NFXA 2VWMA 2AGEX 4J1YA 4AOQA 1TE0A 2CN0H 1IAUA 2GMTB 1H1BA 3NWUA 2BY5X 2QF3A 3RXDA 3Q3YA 1EOLA 1ABJH 1LHDH 3PM3A 1QHRB 1DWDH 3MFJA 5EXLA 1TB6H 4A1XA 4X1RU 1HAOH 2Y6TA 3A7XA 1RD3B 1W11U 3PB1E 4F4OC 1C1VH 1LVBA 1O2XA 3ATKA 1XVMA 2AERH 5A0AE 4A92A 3GY5A 1O2NA 1ETSH 4ISOA 3FP6E 4I8GA 2B8OH 1YGCH 4XDEA 3URDA 1YP9A 1O36A 1CO7E 5HGGA 4FU7A 1ZGIA 1VITF 4ABGA 4B2BA 1YBWA 3ZZBA 1O2HA 3UREA 1B7XB 1GJ8B 3VGCB 1TQ7B 1C1OA 3PROA 5GJ4B 3BG4C 3D62A 2BB4A 1L1GA 4WY3A 1OWEA 1G32B 1GVKB 1GMDF 4WMEA 1MQ5A 3OU0A 3M5OA 5HYOA 1KSNA 2CHAC 2FWWA 4FVDA 1NN6A 2BLOA 1P12E 3TNTA 4INHA 1PPCE 1QA0A 3LDXH 1YCPH 1ZHRA 2BQWB 1JIMA 1NRQH 4JZDH 3SUDA 4AX9H 1YCPK 3ZVEA 4NSYA 2ZQ1A 2NU2E 1W3CA 4X1PU 1C1TA 2R9PA 2WINI 2PW8H 3ZVDA 1JWTA 1QBNA 4JK6A 1LTOA 5FX6A 2C8XB 3M3SA 2SNWA 5EOKA 1XUHA 3UR6A 1D3PB 5A09A 1CA0C 4UFFH 3A8AA 3MU4A 4TY6A 4VGCC 2HPPH 1ZTLA 1V2WT 1Z6JH 3URCA 4X1QU 2QN5T 3KIDU 1C2LA 3RXPA 2FOFA 1A3EH 2ZDAH 1SPJA 4LOYH 1SI5H 5T6GA 1HJ9A 4Q7XA 5AFYH 1HNEE 4HTCH 2A31A 3VB6A 2FTLE 1O38A 1W7GH 1YLDA 1Q31A 3TGJE 1C2KA 3GCHB 1SGEE 2OC8A 5L2YH 3U1JB 1BB0B 4NFFA 4XBBA 3RXSA 2ZGHA 9LPRA 1YPHE 2BD9A 1C4V2 5K7RA 4I8LA 3LJOA 1QQUA 2ODYB 3T62A 1EATA 1BT7A 3OY5U 3LONA 4K60A 3U1IB 3P17H 1WQSA 1O3NA 3MO3A 2KAIA 1FNIA 5FBEA 2C4FH 1FIZA 1P09A 4CR5A 4KTSA 1SQOA 3TNSA 1BMLA 1P04A 1BBRK 1CGHA 3RMNH 1TOMH 2A7HA 2W3KA 2ULLA 3RMOH 3W94A 1AY6H 2HLCA 1EPTA 2PKSC 5ABWA 3K6ZA 5HXFA 4TPIZ 1C2EA 2TGTA 1KTSB 3BTHE 3BTDE 1A46H 4B73A 3LC3A 2A0QB 3BTQE 1K22H 5E0JA 4B76A 1GBTA 2BHGA 2FOBA 1IQGA 3EAJA 1PPGE 2ZFPH 1UTPA 3LGIA 4DT7B 4FUGA 1MU6B 1L4DA 1V3XA 8ESTE 5EODA 4JZIA 2QIQA 3RLYH 1ELCA 1BTUA 4MPXA 2FOGA 4R8TB 4Y8YA 4GPGA 3TJVA 8GCHG 2P8OB 1O31A 1C5XB 1EPTB 1S5SA 2ALPA 2BVSH 4KTUA 1TGNA 1G9IE 3VXFH 3TVJB 2AYWA 1AE8H 2BVXH 1LVOA 2ZTZA 1QJ1B 2PHBA 1TAWA 2ANWA 4D7GA 4HGCA 4B75A 1ZTKA 4BTTB 1TALA 3ATWA 1ZYOA 3RXGA 1BITA 2FTMA 3TPIZ 2BD4A 2PGQB 3ODFA 1NRPH 1V2KT 3DFJA 1HFDA 4KKDA 1O3HA 1P9SA 1YF4A 3G01A 1QBOA 1J9CH 2C3SA 3GY4A 2AMDA 4INKA 1SFIA 1Q2WA 1NRRH 2D26C 5LH8A 3VB3A 3RMMH 1TNKA 3KHVA 3UQVA 1W0YH 1UVSH 1YYY1 1OOKB 2V35A 3GY2A 3T25A 3KN2A 4PROA 1GJ7B 2RDLA 2QC2A 2B9LA 2EI7A 5FPSA 1C5YB 3QGNB 1S81A 4CRCA 2VWNA 3BSQA 3RM0H 1GI9B 1BMAA 1UVPA 1YKTA 1LKAA 4JCNA 1H4WA 1TOCB 1LCYA 1HCGA 1DT2A 3ITIA 2OINA 2XCFA 4BAHB 1OP2A 1JRSA 4X6NA 5JPMH 1HAVB 3E91A 1O35A 3S7HB 1WCZA 3E0NB 1SSXA 2UUJB 3MH4A 1C2DA 2HPQH 3L3TA 3M7TA 4AB8A 5DP7A 1YPMH 1IHTH 1C4Y2 3FZDA 1GHBG 1VCQA 1NRSH 3BTGE 1MD8A 2BY9X 2BM2A 4GHTA 6CHAB 1DY9A 2ZCKP 3FFGA 1E38B 2ZFSA 3TK9A 1A0LA 2O9QA 5CHAB 3T5FH 2C8WB 2PV9B 1IQEA 3O8CA 3ELAH 1S84A 4LK4A 1K9OE 1BIOA 3RC4A 4IMZA 1J17T 3MTYA 2BY6X 1AI8H 1O2LA 5J4QA 2RCEA 1G36A 1XMNB 4CH8B 1P10A 1SQTA 3MU1A 2F9OA 1UCYE 1GDNA 2XYAA 3SORA 1A0JA 1NPMA 2Z9JA 9ESTA 1CBWB 1XX9A 2QCYA 1BCUH 1SLVB 3UNRA 1TGBA 1EOJA 3E16B 1GMCF 1O2WA 1V2RT 5L30H 4BOHA 1C1RA 1GMHF 2VGCC 2ZI2H 4RKOB 2SGQE 2QXIA 1H8IH 1HUTH 1DITH 2PSXA 1AUTC 3TGIE 2V3HH 1P2MA 2FYRA 1A4WH 2ZU3A 5FCKA 1EKBB 2XTTB 2Y5FA 4CHAB 2OP9A 4WJG2 1MTNB 1JRTA 2FLRH 4NWLA 3STIA 1AU8A 2ANYA 1IQJA 1GJ9B 3HGPA 1ANDA 3PO1C 2LNCA 4U32A 3KL6A 1BMMH 2ZPRA 2FX6A 5J4SA 1TPAE 3KCGH 1HAPH 2G51A 2QYIA 4NIWA 2G4TA 2A5IA 1NO9H 1NROH 2CF9H 4FXGH 4AYYB 1LPZB 1PYTC 1K1IA 4ZKRU 1TIOA 3BTEE 1B5GH 2CXVA 2I6SA 2FOMB 3KEEA 1MTWA 1QQ4A 3TJUA 1ANBA 3IG6B 1GGDB 4ABDA 4AYVB 1WQVH 1G3CA 2BD5A 5ESTE 4ZKSU 2Z94A 2UUFB 3MU5A 1ZGVA 1T8NA 2H2ZA 5GPIB 1FPHH 1ZJDA 4KELA 3ZYDA 2NU3E 3MU0A 1O2JA 1TNHA 1TA6A 2AFQB 1O2UA 4UEHH 4OS7A 2FOCA 4TPYA 3PWCA 1N1LA 2BDCA 2C90B 5ETXA 2WUCA 1VITH 4JYUH 3K2UA 2XC4A 1O3KA 5DP8A 1SLXB 3VXEH 2YNBA 3SUFA 1W10U 3S69A 5A8XA 2R2WU 2STBE 2WPKS 2FP7B 4YESB 3MWIU 3E3TA 3EA8A 2BD3A 1GHAG 4CRDA 3ZYEA 1GI5A 3GCNA 4KGAA 1TMTH 4X2XA 1D3TB 1ZHMA 3UUZA 4OS2A 2GZ8A 1HAIH 1O0DH 1C5QA 1O3AA 1ZRBA 3O8DA 1ELBA 1RIWC 1UHBA 3KQDA 4ASHA 2BZAA 1UK2A 3BG8A 1KXEA 3MNCA 4BAMB 3TJOA 1G37A 5EU8A 2VIOA 4BXWA 1C5LH 3UY9A 1V2QT 1C5PA 3MU8A 4YOIA 3UNQA 3L6PA 3QO6A 3OTJE 5GCHG 3K65B 3WY8A 4B71A 3GICB 1MAXA 5E0HA 4I7YH 1GHWH 1SGQE 2B5TB 1HIAB 1MUEB 1SFQB 1ZTJA 4GCHG 1DXWA 1BHXF 2UUYA 2QA9E 1O3BA 2C8ZB 5IDKA 1W13U 5TCAA 4ZH8A 1EJMA 1UHBB 3ZZ6A 4Y71A 3H7TA 4F49A 2GCHF 2BLVA 2HOBA 1A61H 3JZ1B 4K2YA 5HM9A 2ASUB 1BZXE 4O97A 3RXAA 4NA7A 1GCTB 3KGPA 4WF8A 1O2IA 4Y7AA 1NS3A 3RC6A 4GHQA 4AZ2B 1O2KA 1K1NA 1SC8U 2BDGA 3FANA 1QY6A 1XUKA 1XM1A 5JB8S 1PYTD 5TCCA 2BDAA 1ZOMA 5CMXH 1AGJA 3F6UH 3M3TA 3VB4A 1PQAA 3A87A 4SGBE 3RU4T 5FBIA 1G3DA 3SQHE 2XC5A 3QTOH 4ZKNU 2G52A 1VITG 1OWIA 1HGTH 2CF8H 2VIVA 1BHXB 4MG3A 1AZZA 1EXFA 2P16A 1C1SA 2GZ7A 1MZAA 5EXMA 2OC7A 1HB0B 2ZA5A 3SI4H 3S0NA 3UQOA 4AORA 2Q1JA 1G30B 3TIUA 1AVGH 1C2IA 1G3BA 1T8MA 4WMDA 1AFQC 4K1SA 3AVZA 5FCRA 2BYAX 2B7DH 1YM0A 1O2MA 1O2OA 4K1TA 1AN1E 2OUAA 1TX6A 1EP5A 3MI4A 1YC0A 5E0GA 1QRZA 4X2VA 3A7VA 4MNVA 1A2CH 3LPRA 1CHOF 3MO6A 2GCTB 1UTQA 2GT8A 3BN9A 1P01A 3BTTE 1H9LB 3KQCA 3EA7A 1TNJA 3ZVFA 1O3IA 1GBBA 1UJ1A 2JH6D 1A7SA 1K1PA 2R3UA 3U8TH 3RXVA 3TJNA 2P94A 1HRTH 1CT0E 2FOAA 3R0FA 3SGQE 2B0FA 1EAWA 4WH6A 2YNAA 1J14A 2XC0A 3UOPA 4OGYA 4NZLA 5AFZH 2QXJA 4JZ1A 2ZCHP 2ZPSA 4B2CA 1D4PB 1BRAA 2XXLA 1D6WA 3SV8A 1DLEA 1KYNA 4ZKOU 5C1XA 1Y5AT 2ZU1A 1ARBA 1UTLM 3SN8A 4BANB 4NSVA 1JBUH 1S6HA 6LPRA 2XRCA 2CJIA 4NA9H 4Z6AH 2ZU4A 4AFSA 3LGWA 1CSOE 3D23A 4A5TS 3E0PB 2H9HA 1O32A 3AAUA 2F9UA 3NK8A 3RXOA 1GBCA 1GPZA 1IQIA 2A4RA 2PTNA 2BDYA 4INLA 3RXUA 8KME2 1N6XA 2ODPA 2ZNKH 4WXIA 1CHGA 1THPB 3QK1A 3ZZ4A 3GCOA 5A0CA 1HAZB 3ZVBA 5DK1A 4TWYA 4YOJA 4IGDA 4OS5A 1QBVH 4DURA 2ZFFH 5SGAE 1E36B 1C1UH 1QCPA 4AG1A 2F83A 3SOSA 2ZHFH 2BQ6B 1F5RA 1Y59T 1DUAA 1GI8B 3SNCA 2BVRH 5T6DA 2GP9B 1AVWA 3GYLB 1LQEA 4LZ1H 2DE8A 1SMFE 2GTBA 1N6YA 2DE9A 2ZGJA 1SLWB 1TRYA 2FMJA 1ESBA 2FPZA 4K3JA 1Z1JA 3LT3A 2K1QA 1DSTA 1V2VT 1O34A 1HAXB 2GKVE 2FIRH 1O2SA 1L1JA 4RKJB 1MD7A 2CMYA 4IN1A 1ELEE 1VR1H 1ESAA 3A84A 3O8BA 1QGFA 1S0QA 2F9PA 1P3EA 2P3FH 2J4IA 3JZ2B 1K21H 1TBQH 3SJIA 2V3OH 3V7TA 1GVZA 4OS1A 3S9AA 2FX4A 1ZSJA 1INCA 2PWXA 4FUJA 4O03A 1NZQH 4FUEA 3TK6A 4I8KA 4LXBH 1FAXA 5I46H 2BX3A 5G4BA 3SU2A 3VB5A 1P9UA 4FUFA 1BA8B 2ZDKA 2OLGA 2TGDA 1C5TA 3ATMA 5C5NA 1GL1A 2OD3B 1QRWA 1SBWA 2JH5D 2AH4X 4Y8ZA 3BIVH 5IYTA 1HPGA 1OWHA 4XFQA 2G5VA 1CQQA 3M5LA 2WV5A 4MNXA 2AEIH 2BX4A 4ABBA 1BBRH 1QB6A 1BJVA 3C27B 2O8WA 2ZWLH 1WV7H 1E37B 4NGAH 3EQ0H 4D7FA 3AW1A 2VNTA 1GJDB 1WUNH 5LGOA 3HK6B 3P92A 2JETC 1NFWA 2G8TA 1VGCB 3SNAA 4TY7A 1V2JT 3S9BA 2PKAA 2Z9IA 1YLCA 3NCLA 1UVUH 1P3CA 4UFGH 1AD8H 3UIRA 2PSYA 1DDJA 1EZUC 2A7CA 3LJJA 1Z7KA 1ELGA 5A0BA 3GY8A 4FUHA 1S82A 1O5GH 2KAIB 2R0LA 3UNSA 5FPTA 3MH5A 3M36A 1RGQA 1DFPA 1K1LA 2J9NA 2HALA 3SU3A 1CGJE 4FUDA 1TONA 3C1KA 1TX8A 2PKAB 1WBGB 1GG6C 3RXBA 4UFEH 3SJKA 1ELFA 4IMQA 4ZHMU 2ZIQH 4YZUA 3PWBA 4ZUHA 2ZPQA 3RXQA 2GZ9A 3QZQA 2ZQ2A 5AVDA 3CENA 3RMLH 3S7KB 1PPHE 1KXDA 4O3UA 3AASA 3S9CA 1UCYK 1ELTA 2FS9A 1NFUA 2BLQA 2HNTC 2Y5HA 1AB9C 1CE5A 2H9TH 2BD7A 4H6TA 1HBTH 3BIUH 4IBLH 1FAKH 1WOFA 3E8LA 1XXDA 2O8UA 1XKBC 3RDZA 2JKHA 1SLUB 2VWLA 1ESTA 1GHXH 1MTSA 2XBVA
chains in the Genus database with same CATH superfamily
6ESTA 2W3IA 2JIZD 3PV4A 4DIIH 1O3OA 2PLXA 2NU1E 1Z8JB 3U8OH 2XWAA 5C5OA 3QDZB 3SV6A 1LKBA 4CRAA 3SGAE 1K1MA 3NUMA 5FXLA 5EG4A 5C67A 3IWMA 4WXVA 2BTCE 1XXFA 2A1DB 5FPYA 1L1NA 4HFPB 4X8TH 1G3EA 1YPJH 2IPHA 2Z7FE 3A7YA 3RXJA 1XUIA 3L33A 2I6QA 1DM4B 1A5GH 1C5ZB 1FN8A 2G81E 4QT8C 3E90B 1J16A 4XOJA 1VCWA 2QGRA 1SR5C 3U28C 1O2VA 4H4FA 1N8OC 2AMQA 4YLUA 2HNTE 4ISLA 3PLKA 4Y0YE 3BG4B 4GLYA 2ZECA 2D8WA 1YCPM 2IOTA 1KDQA 2W5EA 3E1XB 4MPUA 1QA7A 4AB9A 5DP9A 1BBRE 3A7ZA 1SQRA 2CHAB 2XWBI 5DO4H 1JIRA 1L2EA 1NT1A 1MZDA 1TRNA 3RXHA 5GIBA 4U30A 2WPHS 1F5LA 1RTFB 2GDEH 1KMHB 5DSFA 1WXRA 1AE5A 2VIQA 2Z3CA 1ELDE 1GI6A 1MTVA 5GDSH 4AFUA 1OYTH 3LGYA 4AFQA 1V2LT 4CRGA 1QJ6B 3U8RH 2VIPA 2AGGX 4ABHA 2ANKH 4ZHAA 3RXKA 4UONA 1KDQB 1CA0B 5JBTA 1CT4E 5C1YA 2W6ID 2SGPE 4NIVA 1ARCA 1LDTT 1BTWA 1V6DA 1Y3YA 3GOVB 3F2HA 4VGCB 4X8VH 3TITA 1IQNA 1CA8B 1TABE 1GJ5H 5BRRE 1OP8A 1UTKA 4WWYA 1AFEH 4CBNA 3SHAH 3T29A 4MPVA 4E7NA 1MKWH 1PFXC 2F9NA 3LGTA 5EPYA 4B74A 2FI4E 4E06H 4ZROA 2A4OA 1MKWK 2ZHDA 2BOKA 4Y79A 3BF6H 3RC5A 4YTAA 4IW4E 3N7DA 2NU0E 1RXPA 1W14U 2F9BH 3PMJA 3QZRA 4ABIA 5DG6A 2BLWA 4D9QA 2AIQA 3SNEA 1TNIA 1NY22 4DCDA 4NCYA 1HXEH 3STJA 3SV9A 1P2QA 3K6YA 3ESTA 4NIYA 1Z1IA 1QIXB 4THNH 1Z8GA 5EGMA 2LPRA 1EJNA 1TPSA 1FX0B 4D76A 4U2WA 1GBLA 1ZSLA 1FDPA 2HGTH 5JDUB 2J34A 2FLBH 3F9GA 1ANEA 1GBDA 3GCTG 1SOTA 1O3DA 4BAQB 3B8JA 3RM2H 3VEQB 4FUIA 4X6MA 1PQ8A 3SV7A 3SJ9A 4HG6A 1PJPA 2PKSB 2LELA 1HJAC 7GCHG 3R3GB 3CP7A 4K1EA 1SOZA 2A45B 1EJAA 3M37A 3SU5A 5DN6D 4Y7BA 3ZV8A 1SL3A 5EQRA 4O9VA 2H6MA 1BTHH 2VJ1A 3DSGA 2A32A 2F9VA 3M7UA 2ZKSA 1V2MT 4FUBA 2GMTC 3SNBA 4XSKU 1O2QA 2IJOB 4H42U 5F53A 1C1WH 1SGNE 2ZDMA 3A83A 3IITA 1K28D 2FOHA 1SG8B 4BAOB 3P6ZB 2EI8A 2OBQA 6GCHG 2ZHWH 2KR7A 1QRXA 2QE7D 1TYNA 2TGAA 3A82A 5DPAA 3GY7A 3MNXA 3ZZ9A 3HKJB 1FZZA 1ORFA 2G00A 1ZPBA 4YM9A 5CE1A 3T2NA 2AMPA 1FJSA 3OYPA 4HI3A 2BOHB 1SVPA 2ZHQH 2F43B 1O2TA 4ZMAH 1TPPA 1OS8A 1L0ZA 1HV7A 5DP5A 3LU9B 1CGIE 1ABIH 3U9AH 4DW2U 1MAYA 1A5IA 2QXGA 1O33A 3SU4A 2NU4E 2SGFE 2XCNA 1HXFH 3VGCC 1A3BH 1T4UH 4RT1A 3A7TA 2D2DA 1Y5BT 2P93A 3PLPA 4TYDA 2WZQA 1BRCE 4CRBA 3SBKA 1TPOA 4R0IA 3CS0A 3F2FA 4BAKB 2WYGA 1IOEA 3A88A 1OP0A 3VPKA 2BDIA 3EA9A 3ZZ7A 2Y7ZA 7LPRA 1IQKA 1O5CB 2VVUA 2ZCLP 5K0HA 1GBAA 2WPMS 3ENSB 1WTGH 1EAUA 1MH0A 2TGPZ 2Z6BD 3RUOA 1YPGH 2R2MB 1C4U2 1J15A 4ESTE 1XUFA 1TFXA 4AFZA 3PTNA 4MNWA 1GJCB 1BTPA 1ZMNA 3PMAB 2OBOA 1ZPZA 3NRLA 4Y6DA 1F0UA 2A4QA 4DIHH 2LP6A 2WHXA 2EEKA 2Z3EA 3MHWU 2BY8X 3A81A 3QX5H 1OKXA 3EGKH 1OXGA 3GDUA 1U6QA 1VJ9U 3HKIB 3I78A 1F0SA 1MMJN 1AWFH 4NG9H 1GHZA 2GV6A 1ZZZA 5EW1H 4NFEA 2FEQH 2VU8E 3F3BA 3N7OA 3DD2H 3K9XB 4Q63A 1NESE 2J95A 2F4LA 1C1QA 3F68H 5DKMA 2W7SA 5GNDA 1A5HA 3BTKE 2V6NA 3UTUH 3MNBA 1YLNA 3DCLA 2PUQH 3MMGA 2H1UA 2ESTE 1LO6A 1GBEA 2AIPA 2XBXA 3GCHC 1DICA 4X8SH 1LHFH 3Q3XA 4YT6H 1MQ6A 1E34B 4B2AA 1SGRE 1IQHA 1OPHB 1S6LA 3HGNA 3UPEA 2ZZUH 3DA9B 1TBRH 5JBCS 4JZEH 1C5VA 1NFYA 3RXTA 2GT7A 1O2ZA 1P06A 2PP6A 3NZIA 1GL0E 3ATIA 3FVFB 1YPLH 4I86A 1FONA 1O5FH 1JXPA 1MKXK 2R0KA 4A1VA 2VGCB 2WYJA 1H8DH 1S85A 4X6OA 4GSOA 1C2GA 1H9HE 3TU7H 1AWHB 4OS6A 1P03A 3DFLA 4M7GA 5A2MH 3A8DA 1GMDG 5C94A 1GHYH 1EAIA 5E2OA 1GHAF 1P02A 1KXAA 2YOLA 1O3CA 1ZJKA 4ABEA 1FQ3A 3SGBE 1MBMA 3TH3H 5EJZA 3SU6A 1DY8A 2ZDLA 3OY6U 3OSYA 1H9IE 4K8YA 4M9FA 1UTJA 3QLPH 1ETTH 2EI6A 3E6PH 5A8YA 4ISIH 4Q4LA 4AGJA 1O37A 3Q76A 2A5AA 3PO1B 3B23B 1YPKH 1ZSKA 4I33A 3RXFA 4X8UH 5EQSA 1LPKB 4BTIB 1Y3WA 1TGSZ 3LC5A 1T7CA 1NU7B 2QAAA 1OHHD 2C93B 4D8NA 1K1JA 1SGYE 2FS8A 5I25A 1QJ7B 2ZDVH 1Z6EA 2WPJS 3KQ5A 1P2KA 4IC5A 3SUEA 2P8OC 1C2JA 1BMFD 1KLIH 1ELVA 1KXFA 4ZXXH 1CU1A 3PLBA 1EPTC 3KQEA 3LIWA 4NZQA 1CVWH 3GS9A 1DX5M 2FYQA 4DJZB 5C0UA 2ZHEH 1AMHA 1C1PA 5GXPA 3GYMA 1C9PA 3U98H 2A2QH 1C2FA 2RG3A 5GWZA 2P3UB 4Y11E 1KXBA 3V3MA 1LPGB 1QTFA 1P8VC 1LHEH 3PV5A 4JK5A 3DHKH 3O8RA 1ZMLA 1GHVH 4DG4A 4HZHA 2OK5A 4UD9H 3RP2A 5C20A 1TBZH 1SB1H 3PMBB 1O3FA 2ZO3H 3P8OA 4Y10E 4UFDH 3UOUA 7ESTE 2Y80A 2Y82A 5T1VA 4ABAA 2GGVB 2P59A 4ACBA 3I77A 1W2KH 4DVAU 1KY9A 1P2JA 3MO9A 4TWWA 3ZZDA 2VIWA 1T32A 5EXNA 1IQFA 5C2ZA 1O5EH 4AGKA 3TK5A 4MVNA 1G2LA 2ZGXH 1FUJA 1DVAH 1TWXB 3HK3B 5AF9H 3V12A 4AG2A 5HIYA 1RIWB 4YT7H 5E8EH 1K1OA 1E79D 2ZU5A 1FMGA 1ETRH 2XOKD 1WSSH 2CV3A 1ACBE 3CS7A 4XBDA 2NWNA 2WPIS 2OC0A 5EPNA 6CHAC 3GY6A 2SGAA 1YPHC 2XBYA 3LH1A 4F55A 1KLTA 4I32A 3BTFE 2TRMA 1SHYA 4ZHLU 1HYLA 1IQMA 3ZZ3A 1C1MA 4ABJA 1Y8TA 3ZVGA 5CHAC 5C1UA 2C8YB 1DXPA 2BZ6H 3UAIC 5DP4A 2ZTYA 1FPCH 1GCDA 2ZG0H 4GAWA 5DJ7A 1C5SA 4Z0KA 2QV1A 3BV9B 2FESH 1Y3XA 1BQYA 3W1EA 1TGCA 4IS5A 3LKWA 3SU0A 2EA3A 5LPEA 2GX4A 1S6FA 3FP7E 1AVXA 1UVTH 3KQBA 3T28A 1W12U 4X1NU 4ISHH 1CBWC 4ISNA 2HWLB 1M9UA 2VVVA 1PPEE 1EAXA 2Z3DA 5DP3A 1ZMJA 3RXLA 2CK3D 1FY3A 3HATH 3MOCA 3FO8D 1Z8IB 1UK4A 3FZZA 3BEUA 1AUJA 4A6LA 1XUJA 3DUXH 4JYVH 2PFEA 1G2MA 4WH8A 4J2YB 3ZZ5A 2BXUH 2H9EH 4CHAC 1P11E 1RTLA 2J92A 2WUBA 3SW2B 1MTNC 3TH2H 1QB9A 2BXTH 5JBAS 1DE7H 4AC9A 2EC9H 1ZHPA 1DWBH 1O30A 1Z8RA 3SNDA 3KYGA 1O3PB 1O3GA 5AHGH 1A0HB 2A5KA 3EE7A 2W26A 1TMUH 5LPRA 2HRVA 1E0FD 1MCVA 1GBHA 5L6NH 2FI3E 3D49H 3FN8A 1AFQB 1BUIA 1DLKB 3A80A 1GBKA 2J98A 2G55A 1NRNH 3W95A 2ZGBH 3MYWA 1W0JD 1W8BH 1IHSH 2V0BA 1MCTA 2OC1A 2SGEE 3SV2H 1GJ4H 1W0ZU 2FOEA 4BTUB 1RS0A 1BTYA 1UTNA 3A7WA 4GUXA 4CR9A 1D3DB 3ZVCA 1GGDC 4Q80A 3H7OA 1HAYB 1VCPA 1UCYH 3V0XA 3V13A 3QWCH 2JH0D 4Y0ZE 1O2GH 1F92A 1MU8B 3I29A 4JMYA 4ZAEA 1L4ZA 1O3JA 3OTPA 4E05H 1GBIA 5F8XA 3PRBA 1NTPA 4YO9A 3OE7D 1AHTH 1FY4A 3EE0B 3SU1A 3QN7A 2QF0A 1GI2A 4IC6A 2BMGB 4JZFH 1GI3A 2RA0A 1E35B 1HDTH 1O2PA 1ZLRA 1UTOA 1GMCG 2A4GA 3EYDA 3M3VA 2Q6GA 1O2RA 1GMHG 2FM2A 2VIDA 1NC6A 1ID5H 4OGXA 3SI3H 2R3YA 2WPDD 4O3TA 3OX7U 2YMSB 3TH4H 4CBOA 4KTCA 3T26A 4X2WA 3RU4E 2PR3A 2GV7A 1OWJA 2UWLA 1OWDA 4F48B 2G5NA 1V2TT 3EDXB 4YLQH 4X0WU 1O5AB 1THRH 3LGVA 1WYKA 2OQUA 1SQAA 2H5CA 1HAVA 2O8LA 3NXPA 1C5RA 4DY7B 1EB2A 2F3CE 2A7JA 2THFB 2Y5GA 3QUMP 1HJ8A 1BJUA 2BDHA 1EP6A 2XW9A 3M5NA 1LMWB 1UTMA 1FY8E 2PUXB 3QGJA 2Z9KA 1F5KU 1P57B 3A86A 2VH0A 5FHTA 1KIGH 4Y8XA 4FVBA 1XVOA 2VINA 1D6RA 4FU8A 5ESBA 2WPLS 2ZFQH 1EZSC 1PQ5A 4AN7A 3BTME 4K5ZA 1DWCH 2PTCE 1SGFG 1D9IA 1EX3A 2VB0A 2TIOA 3VFEA 1KLJH 4YXWD 1RTKA 1H8ED 2UUKB 3ZV9A 4DGJA 1COWD 2ZDNA 2QY0B 4FU9A 4UDWH 2A2XH 1D3QB 3SZEA 1QL7A 4X1SU 5BPEA 1S83A 3Q3KA 1GBMA 3ATLA 3GISB 3SUGA 4XD7D 3FP8E 2BDBA 1GDQA 2FZZA 1GCTC 1F7ZA 1F0TA 2ZU2A 8GCHF 1AIXH 1E1RD 1A1RA 3AAVA 2ZTXA 4I8HA 1P2NA 1O2YA 3WW7A 1J8AA 2SGDE 1TA2A 1V2ST 3P8FA 1JOUB 4B6FA 3AW0A 1LHCH 2SFAA 5B6OA 1C5MD 3RU4D 3SO3A 2FODA 2ZFRH 2IJD1 1KTTB 1BOQA 3Q77A 3A89A 4MQAA 3A8CA 1WAYB 4A1TA 3PMHB 1VJAU 3ZZ8A 3F1SB 2ZGCA 5F03A 2ALVA 4WMFA 1FV9A 2BQ7B 2AS9A 1Y5UT 1FIWA 2STAE 1JMOH 2OTVA 1RJXB 4MLFB 3HPTB 2J94A 2GVFA 1C2HA 5F6MA 3F0OA 2VH6A 2XNIA 3KF2A 5H4IB 1W7XH 1V2OT 1W0KD 1EB1H 1BMNH 1T8OA 2JETB 1C5WB 1BTZA 1GJ6A 2RA3A 3ZZCA 1Y3UA 3M35A 1F0RA 2HNTF 2WV4A 1LHGH 3P8NA 3RXEA 1X7AC 3RLWH 4Z1MD 1YPEH 5A8ZA 1PQ7A 1BRBE 4SGAE 3NPSA 1GJAB 4CREA 4K69A 1DOJA 2GCTC 5CHBA 2BD8A 1B0FA 1FN6A 1TGTA 1ZR0A 1K2I1 2FO9A 4A7IB 1QB1A 1FXYA 2UWOA 2SNVA 1BDAA 4JYTA 1EQ9A 3MH6A 3SZNA 1IQLA 1EZXC 4B1TA 2QXHA 2VBCA 5F8TA 1NM6A 1GHBF 1TLDA 2GCHG 1XUGA 1DSUA 3BEFB 4XE4A 4ZXYH 1MBQA 4IN2A 4CRFA 1GG6B 5HM2A 1S0RA 3M5MA 5T3HA 3P70B 1QR3E 1C5NH 3T27A 1T31A 1T4VH 1OWKA 4Q7YA 5PTPA 3BTWE 5HMAA 2GD4B 1P05A 1GJBB 1VZQH 3AK5A 4OS4A 3H5CB 1FY5A 4Q7ZA 3FAOA 2PGBB 1UO6A 1AB9B 2ILNA 5DP6A 7KMEH 2FXRA 1SGFA 2O8TA 3NKKA 2ZEBA 1DS2E 1LVYA 1FLEE 1BTXA 2P95A 1O5DH 4MNYA 5TJXA 3RXCA 4Q2KA 1HAHH 3UWIA 2XBWA 4BNRA 3MNSA 1DUEA 2O8MA 2Q6DA 3GDVA 5EQQA 3P95A 4RN6A 5HIZA 1QNJA 3ZZAA 1SGDE 4KP0A 4RSPA 1B0EA 1C5UA 1ELAA 4OM9A 4XBCA 2M5TA 1SGTA 1THSH 4FOUC 1AZ8A 3PV2A 1QURH 3QTVH 1NU9A 1P2IA 1V2PT 2UWPA 3F0PA 1PPBH 2OCVB 4BXSA 5DGJA 1HIAA 5E2PA 3D65E 3Q00A 1WTHD 4MDSA 4I31A 2Z9GA 3A85A 1TMBH 3ZVAA 5FAHA 1GI4A 1SHHB 1EASA 2XNDD 1CHOG 1EZQA 1GWAA 1N8OB 5C3NA 3PYHA 2V7QD 1E1QD 1DANH 3TGKE 5EIYA 5FX5A 1FY1A 1O39A 1PPZA 3RXRA 5JYIA 3GCTF 5EW2H 4Y76A 2TPIZ 5KGOA 3SQEE 3BEIB 1QFKH 1LVMA 4ABFA 1KXCA 2ZC9H 8LPRA 3GDSA 4FETA 2P3TB 4YOGA 1O3MA 7GCHF 1TRMA 3SHCH 1C5OH 1HLTH 4DOQA 5T6FA 1ZRKA 1ANCA 4X6PA 1TNGA 4NA8A 2VVCA 3U69H 1AKSA 4WVPE 1O3EA 1GI1A 1TX7A 1GI7B 1F2SE 1Y3VA 1AQ7A 3UFAA 3LOXA 3RXMA 2ZF0H 1DPOA 3DT0H 2OXSA 1O5BB 3F9EA 2W7UA 4H6SB 2D1JA 3KNXA 4NWKA 4LZ4B 1CT2E 6GCHF 1O3LA 1LQDB 2IN2A 2FDAA 2G4UA 1AO5A 3TLOA 3F9HA 1MKXH 1P2OA 3M7QA 3UR9A 3A8BA 1EUFA 3UWJH 2GDDA 1C1NA 4K8BA 4GVUA 5JBBS 1FI8A 3VB7A 1AKSB 1GI0A 3ODDA 1UMAH 3P8GA 2Y81A 1SGIB 1UK3A 1QL9A 1VGCC 2CGAA 1RRKA 2VWOA 3SJ8A 5L2ZH 1TQ0B 1HAGE 4MTBA 2H5DA 1WU1A 3F9FA 1GBJA 4FUCA 2TBSA 3F2GA 1RFNA 1DWEH 3PTBA 2Q6FA 2ANMH 1UVOA 2K8IA 4MPWA 5F8ZA 1OYQA 1OSSA 1TNLA 1SGPE 4X2YA 5JB9S 1MTUA 2Z9LA 4U01A 1GBFA 2BY7X 1ZPCA 1T8LA 2DUCA 1C9TA 1OX1A 4E7RG 1SGCA 3GY3A 1P0SH 4I8JA 2J38A 2KX4A 2J2UA 3B9FH 2Y7XA 4CH2B 1QL8A 1XKAC 1GDUA 2ZP0H 3LH3A 5GCHF 2AGIX 3RXIA 1Z71A 1V2UT 4D9RA 4ZCNA 3MH7A 1HJAB 3KYFA 2BD2A 2HVXA 1BRUP 3M61U 2FI5E 2ODQA 1C2MA 4NIXA 1PPFE 4GCHF 3LGUA 3SJOA 4UE7H 2ZFTA 2OQ5A 1V2NT 5LPFA 1GVLA 1Q3XA 2F91A 1NFXA 2VWMA 2AGEX 4J1YA 4AOQA 1TE0A 2CN0H 3N99A 1IAUA 2GMTB 1H1BA 3NWUA 2BY5X 2QF3A 3RXDA 3Q3YA 5C0TA 1EOLA 1ABJH 1LHDH 3PM3A 1QHRB 1DWDH 3MFJA 5EXLA 1TB6H 4A1XA 4X1RU 1HAOH 2Y6TA 3A7XA 1RD3B 1W11U 3PB1E 4F4OC 1C1VH 1LVBA 1O2XA 3ATKA 1XVMA 2AERH 3WWFA 5A0AE 4A92A 3GY5A 1O2NA 1ETSH 4ISOA 3FP6E 4I8GA 2B8OH 1YGCH 4XDEA 5HKKD 3URDA 1YP9A 1O36A 1CO7E 5HGGA 4FU7A 1ZGIA 1VITF 4ABGA 4B2BA 1YBWA 3ZZBA 1O2HA 3UREA 1B7XB 1GJ8B 3VGCB 1TQ7B 1C1OA 3PROA 5GJ4B 3BG4C 3D62A 2BB4A 1L1GA 4WY3A 1OWEA 3SYJA 1G32B 1GVKB 1GMDF 4WMEA 1MQ5A 3OU0A 3M5OA 5HYOA 1KSNA 2CHAC 2FWWA 4FVDA 1NN6A 2BLOA 1P12E 3TNTA 4INHA 1PPCE 1QA0A 3LDXH 1YCPH 1ZHRA 2BQWB 1JIMA 1NRQH 4JZDH 3DSOA 3SUDA 4AX9H 1YCPK 3ZVEA 1YWUA 4NSYA 2ZQ1A 2NU2E 2M2AA 1W3CA 4X1PU 1C1TA 2R9PA 2WINI 2PW8H 3ZVDA 1JWTA 1QBNA 4JK6A 1LTOA 5FX6A 2C8XB 3M3SA 2SNWA 5EOKA 1XUHA 3UR6A 1D3PB 5A09A 1CA0C 4UFFH 3A8AA 3MU4A 4ACAA 4TY6A 4VGCC 2AHME 2HPPH 1ZTLA 1V2WT 1Z6JH 3URCA 4X1QU 2QN5T 3KIDU 1C2LA 3RXPA 2FOFA 1A3EH 2ZDAH 1SPJA 4LOYH 1SI5H 5T6GA 1HJ9A 4Q7XA 5AFYH 1HNEE 4HTCH 2A31A 3VB6A 2FTLE 1O38A 3OAAD 1W7GH 1YLDA 1Q31A 5EJLA 3TGJE 1C2KA 3GCHB 1SGEE 2OC8A 5L2YH 3U1JB 1BB0B 4NFFA 4XBBA 3RXSA 2ZGHA 9LPRA 1YPHE 2BD9A 1C4V2 5K7RA 2KCYA 4I8LA 3VG8A 3LJOA 1QQUA 2ODYB 3WWBA 3N7EA 1EATA 3T62A 1BT7A 3OY5U 2HLDD 3LONA 4K60A 3U1IB 3P17H 1WQSA 1O3NA 3MO3A 2KAIA 1FNIA 5FBEA 2C4FH 1FIZA 1P09A 4CR5A 4KTSA 1SQOA 3TNSA 1BMLA 1P04A 1BBRK 1CGHA 2RFKC 3RMNH 1TOMH 2A7HA 2W3KA 2ULLA 3RMOH 4XRNA 3W94A 1AY6H 2HLCA 1EPTA 2PKSC 3OEED 3K6ZA 5ABWA 4TPIZ 5HXFA 1C2EA 2TGTA 1KTSB 3BTHE 3BTDE 1A46H 4B73A 3LC3A 2EY4C 2A0QB 3BTQE 1K22H 5E0JA 4B76A 1GBTA 2FOBA 2BHGA 1IQGA 3EAJA 1PPGE 2ZFPH 1UTPA 3LGIA 4DT7B 4FUGA 1MU6B 1L4DA 1V3XA 8ESTE 5EODA 4JZIA 2QIQA 3RLYH 1ELCA 1BTUA 4MPXA 2J98B 2FOGA 4R8TB 4Y8YA 4GPGA 3TJVA 8GCHG 2P8OB 1O31A 2V3MA 1C5XB 1EPTB 1S5SA 2ALPA 2BVSH 4KTUA 1TGNA 1G9IE 3VXFH 3TVJB 2AYWA 1AE8H 2BVXH 1LVOA 2ZTZA 1QJ1B 2PHBA 1TAWA 2ANWA 4D7GA 4HGCA 4B75A 1ZTKA 4BTTB 1TALA 3ATWA 1ZYOA 3RXGA 1BITA 2FTMA 3TPIZ 2BD4A 2PGQB 3ODFA 1NRPH 4RT0A 1V2KT 3DFJA 1HFDA 4KKDA 1O3HA 1P9SA 1YF4A 3G01A 1QBOA 1J9CH 2C3SA 3GY4A 2AMDA 4INKA 1SFIA 1Q2WA 1NRRH 2D26C 5LH8A 3VB3A 3RMMH 1TNKA 3KHVA 3UQVA 1QZ8A 1W0YH 1UVSH 1YYY1 1OOKB 2V35A 3GY2A 3T25A 3KN2A 4PROA 2L6OA 1GJ7B 2RDLA 2QC2A 2B9LA 2EI7A 5FPSA 1C5YB 3QGNB 1S81A 4CRCA 2VWNA 3BSQA 3RM0H 1GI9B 1BMAA 1UVPA 1YKTA 1LKAA 4JCNA 1H4WA 1TOCB 1LCYA 1HCGA 1DT2A 3ITIA 2QF5A 2OINA 2XCFA 4BAHB 1OP2A 1JRSA 4X6NA 5JPMH 1HAVB 3E91A 1O35A 3S7HB 1WCZA 3E0NB 1SSXA 2UUJB 3MH4A 1C2DA 2HPQH 3L3TA 3M7TA 4DT4A 4AB8A 2KZ4A 5DP7A 1YPMH 1IHTH 1C4Y2 3FZDA 1GHBG 1VCQA 1NRSH 3BTGE 1MD8A 2BY9X 2BM2A 4GHTA 6CHAB 1DY9A 2ZCKP 3FFGA 2KFWA 1E38B 2ZFSA 2L74A 3TK9A 1A0LA 2O9QA 5CHAB 3T5FH 2C8WB 2PV9B 1IQEA 1SKYE 3O8CA 3ELAH 5B6LA 1S84A 4LK4A 4P00A 1K9OE 1BIOA 3RC4A 4IMZA 1J17T 3MTYA 5CDFE 2BY6X 1AI8H 1O2LA 5J4QA 2RCEA 1G36A 1XMNB 4CH8B 1P10A 1SQTA 3MU1A 2F9OA 1UCYE 3FOAA 1GDNA 2XYAA 3SORA 1A0JA 1NPMA 2Z9JA 9ESTA 1CBWB 1XX9A 2QCYA 1BCUH 1SLVB 3UNRA 1TGBA 1EOJA 3E16B 1GMCF 1O2WA 1V2RT 5L30H 4BOHA 1C1RA 1GMHF 2VGCC 2ZI2H 4RKOB 2SGQE 2QXIA 1H8IH 1HUTH 1DITH 2PSXA 1AUTC 4TT3D 3TGIE 2V3HH 1P2MA 2FYRA 1A4WH 2ZU3A 5FCKA 1EKBB 2XTTB 2Y5FA 4CHAB 2OP9A 4WJG2 1MTNB 1JRTA 2FLRH 4NWLA 3STIA 1AU8A 2ANYA 1IQJA 1GJ9B 3HGPA 1ANDA 2KCOA 3PO1C 2J5UA 2LNCA 4U32A 3KL6A 1BMMH 2ZPRA 2FX6A 5J4SA 1TPAE 3KCGH 1HAPH 2G51A 2QYIA 4NIWA 2G4TA 2A5IA 1NO9H 1NROH 2CF9H 4FXGH 4AYYB 1LPZB 5IK2D 1PYTC 1K1IA 4ZKRU 1TIOA 3BTEE 1B5GH 2KCPA 2CXVA 2I6SA 2FOMB 3KEEA 1MTWA 1QQ4A 3TJUA 1ANBA 3IG6B 1GGDB 4ABDA 4AYVB 1WQVH 1G3CA 2BD5A 5ESTE 4ZKSU 2Z94A 2UUFB 3MU5A 1ZGVA 1T8NA 2H2ZA 1EFRD 5GPIB 1FPHH 1ZJDA 4KELA 3ZYDA 2NU3E 3MU0A 1O2JA 1TNHA 1TA6A 2AFQB 1O2UA 4UEHH 4OS7A 2FOCA 4TPYA 3PWCA 1N1LA 2BDCA 2C90B 5ETXA 2WUCA 1VITH 4JYUH 3K2UA 2XC4A 1O3KA 5DP8A 1SLXB 3VXEH 2EQNA 2YNBA 3SUFA 1W10U 3S69A 5A8XA 2R2WU 2STBE 2WPKS 2JJ2D 2FP7B 4YESB 3MWIU 3E3TA 3EA8A 2BD3A 1GHAG 4CRDA 3ZYEA 1GI5A 3GCNA 4KGAA 1TMTH 4X2XA 1D3TB 1ZHMA 3UUZA 4B6EA 2WV9A 4OS2A 2GZ8A 1HAIH 1O0DH 1C5QA 1O3AA 1VKYA 1ZRBA 3O8DA 1ELBA 1RIWC 1UHBA 3KQDA 4ASHA 2BZAA 1UK2A 3BG8A 1KXEA 3MNCA 4BAMB 3TJOA 1G37A 5EU8A 2VIOA 4BXWA 1C5LH 3ZIAD 3UY9A 1V2QT 1C5PA 3MU8A 4YOIA 3UNQA 3L6PA 3QO6A 3OTJE 5GCHG 3K65B 3WY8A 4B71A 3GICB 1MAXA 5E0HA 4I7YH 1GHWH 1SGQE 2B5TB 1HIAB 1MUEB 1SFQB 1ZTJA 4GCHG 1DXWA 1BHXF 2UUYA 2QA9E 1O3BA 2C8ZB 5IDKA 1W13U 5TCAA 2QF4A 4ZH8A 1EJMA 1UHBB 3ZZ6A 4Y71A 3H7TA 2KCAA 2J97A 4F49A 2GCHF 2BLVA 2HOBA 1A61H 3JZ1B 4K2YA 2KM0A 5HM9A 2ASUB 1BZXE 4O97A 3RXAA 4NA7A 1GCTB 3KGPA 4WF8A 1O2IA 4Y7AA 1NS3A 3RC6A 4GHQA 4AZ2B 1O2KA 1K1NA 1SC8U 2BDGA 3FANA 1QY6A 1XUKA 4ASUD 1XM1A 5JB8S 1PYTD 5TCCA 2BDAA 3FKSD 1ZOMA 5KEDA 5CMXH 1AGJA 3F6UH 3M3TA 3VB4A 1PQAA 3A87A 4SGBE 3RU4T 5FBIA 2WSSD 1G3DA 5EJ1A 3SQHE 2XC5A 2K0QA 3QTOH 4ZKNU 2G52A 1VITG 1OWIA 1HGTH 2CF8H 2VIVA 1BHXB 4MG3A 1AZZA 1EXFA 2P16A 1C1SA 3OFND 2GZ7A 1MZAA 5EXMA 2OC7A 1HB0B 2ZA5A 3SI4H 3S0NA 3UQOA 4AORA 2Q1JA 1G30B 3TIUA 1AVGH 1C2IA 1G3BA 1T8MA 4WMDA 4TSFD 1AFQC 4K1SA 3AVZA 5FCRA 2BYAX 2B7DH 1YM0A 2JJ1D 1O2MA 1O2OA 4K1TA 1AN1E 2OUAA 1TX6A 1EP5A 3MI4A 5FL7D 1YC0A 5E0GA 1QRZA 4X2VA 3A7VA 4MNVA 1A2CH 3LPRA 1CHOF 3MO6A 2GCTB 1UTQA 2GT8A 1YY3A 3BN9A 1P01A 3BTTE 1WDIA 1H9LB 3KQCA 3EA7A 1TNJA 3ZVFA 1O3IA 1GBBA 1UJ1A 2JH6D 1A7SA 1K1PA 2R3UA 3U8TH 3RXVA 3TJNA 2P94A 1HRTH 1CT0E 2FOAA 3OEHD 3R0FA 3SGQE 2B0FA 1EAWA 4WH6A 2YNAA 1J14A 2XC0A 3UOPA 4OGYA 4NZLA 5AFZH 2QXJA 4JZ1A 2IPQX 2ZCHP 2ZPSA 2YMSC 4B2CA 1D4PB 1BRAA 2XXLA 1D6WA 3SV8A 1DLEA 1KYNA 4ZKOU 3PRDA 1NBME 5C1XA 1Y5AT 2ZU1A 3DSPA 1ARBA 1UTLM 3SN8A 2W6JD 4BANB 4NSVA 1JBUH 1S6HA 6LPRA 2XRCA 2CJIA 4NA9H 4Z6AH 2ZU4A 4AFSA 3LGWA 1CSOE 3D23A 4A5TS 3E0PB 2H9HA 1O32A 3AAUA 2F9UA 3NK8A 3RXOA 1GBCA 1GPZA 1IQIA 2A4RA 2PTNA 2BDYA 4INLA 3RXUA 8KME2 1N6XA 2ODPA 2ZNKH 4WXIA 1CHGA 1THPB 3QK1A 5C17A 2JDID 3ZZ4A 3GCOA 5A0CA 1HAZB 3ZVBA 5DK1A 4TWYA 4YOJA 4IGDA 4OS5A 1QBVH 4RI0A 4DURA 2ZFFH 5SGAE 1E36B 1C1UH 1QCPA 4AG1A 2F83A 3SOSA 2ZHFH 2BQ6B 1F5RA 1Y59T 1DUAA 1GI8B 2GJGA 3SNCA 2BVRH 5T6DA 2GP9B 1AVWA 3GYLB 1LQEA 4LZ1H 2DE8A 1SMFE 2GTBA 1N6YA 2DE9A 2ZGJA 1SLWB 1TRYA 2FMJA 1ESBA 2FPZA 4K3JA 1Z1JA 3LT3A 2K1QA 1DSTA 1V2VT 1O34A 1HAXB 2GKVE 2FIRH 1O2SA 1L1JA 4RKJB 1MD7A 2CMYA 4IN1A 1ELEE 1VR1H 1ESAA 3A84A 3O8BA 1QGFA 1S0QA 2F9PA 1P3EA 2P3FH 2RDEA 2J4IA 3JZ2B 1K21H 1TBQH 3SJIA 3MQKC 3H09A 2V3OH 3V7TA 1GVZA 4OS1A 3S9AA 1NBMD 2FX4A 1ZSJA 1INCA 2PWXA 4FUJA 4O03A 1NZQH 5KECA 4FUEA 3TK6A 4I8KA 4LXBH 1FAXA 5I46H 2BX3A 5G4BA 3SU2A 3VB5A 1P9UA 1UW7A 1BA8B 2ZDKA 4FUFA 2OLGA 2TGDA 1C5TA 3ATMA 3UB0A 5C5NA 1GL1A 2OD3B 1QRWA 1SBWA 2JH5D 2AH4X 4Y8ZA 3BIVH 5IYTA 1HPGA 1OWHA 4XFQA 2G5VA 1CQQA 3M5LA 2WV5A 4MNXA 2AEIH 2BX4A 4ABBA 1BBRH 1QB6A 1K0HA 1BJVA 3C27B 2O8WA 2ZWLH 1WV7H 1E37B 3CNRA 4NGAH 3EQ0H 4D7FA 3AW1A 2VNTA 1GJDB 1WUNH 5LGOA 3HK6B 3P92A 2JETC 1NFWA 2G8TA 1VGCB 3SNAA 4TY7A 1V2JT 3S9BA 1MABB 2PKAA 2Z9IA 1YLCA 2YMSD 3NCLA 1H8HD 1UVUH 1P3CA 4UFGH 1AD8H 3UIRA 2PSYA 1DDJA 1EZUC 2A7CA 3LJJA 1Z7KA 1ELGA 5A0BA 3GY8A 4FUHA 1S82A 1O5GH 2KAIB 2R0LA 3UNSA 5FPTA 3MH5A 3M36A 1RGQA 1DFPA 1K1LA 2J9NA 2HALA 3SU3A 1CGJE 4FUDA 1TONA 3C1KA 1TX8A 2PKAB 1WBGB 1GG6C 3RXBA 4UFEH 3SJKA 1ELFA 4IMQA 4ZHMU 2ZIQH 4YZUA 3PWBA 2HVYB 4ZUHA 2ZPQA 3RXQA 2GZ9A 3QZQA 2ZQ2A 5AVDA 3CENA 4P02A 3RMLH 3S7KB 1PPHE 1KXDA 4O3UA 3AASA 3S9CA 1UCYK 1ELTA 2FS9A 1NFUA 2BLQA 2HNTC 2Y5HA 1AB9C 1CE5A 2H9TH 2BD7A 4H6TA 1HBTH 3BIUH 4IBLH 1FAKH 1WOFA 3E8LA 1XXDA 2O8UA 1XKBC 3RDZA 2JKHA 1SLUB 2VWLA 1ESTA 1GHXH 1MTSA 2XBVA
chains in the Genus database with same CATH topology
6ESTA 2W3IA 3PV4A 4DIIH 1O3OA 2PLXA 2NU1E 1Z8JB 3U8OH 2XWAA 5C5OA 3QDZB 3SV6A 1LKBA 4CRAA 3SGAE 1K1MA 3NUMA 5FXLA 5EG4A 5C67A 3IWMA 4WXVA 2BTCE 1XXFA 2A1DB 5FPYA 1L1NA 4HFPB 4X8TH 1G3EA 1YPJH 2IPHA 2Z7FE 3A7YA 3RXJA 1XUIA 3L33A 2I6QA 1DM4B 1A5GH 1C5ZB 1FN8A 2G81E 4QT8C 3E90B 1J16A 4XOJA 1VCWA 2QGRA 1SR5C 1O2VA 4H4FA 1N8OC 2AMQA 4YLUA 2HNTE 4ISLA 3PLKA 4Y0YE 3BG4B 4GLYA 2ZECA 2D8WA 1YCPM 2IOTA 1KDQA 2W5EA 3E1XB 4MPUA 1QA7A 4AB9A 5DP9A 1BBRE 3A7ZA 2CHAB 2XWBI 5DO4H 1JIRA 1L2EA 1NT1A 1MZDA 1TRNA 3RXHA 5GIBA 4U30A 2WPHS 1F5LA 1RTFB 2GDEH 1AE5A 2VIQA 2Z3CA 1ELDE 1GI6A 1MTVA 5GDSH 4AFUA 1OYTH 3LGYA 4AFQA 1V2LT 4CRGA 1QJ6B 3U8RH 2VIPA 2AGGX 4ABHA 2ANKH 4ZHAA 3RXKA 4UONA 1KDQB 1CA0B 5JBTA 1CT4E 5C1YA 2SGPE 4NIVA 1ARCA 1LDTT 1BTWA 1V6DA 1Y3YA 3GOVB 4VGCB 4X8VH 3TITA 1IQNA 1CA8B 1TABE 1GJ5H 5BRRE 1OP8A 1UTKA 4WWYA 1AFEH 4CBNA 3SHAH 3T29A 4MPVA 4E7NA 1MKWH 1PFXC 2F9NA 3LGTA 5EPYA 4B74A 2FI4E 4E06H 4ZROA 2A4OA 1MKWK 2ZHDA 2BOKA 4Y79A 3BF6H 3RC5A 4YTAA 4IW4E 2NU0E 1RXPA 1W14U 2F9BH 3PMJA 3QZRA 4ABIA 5DG6A 2BLWA 4D9QA 2AIQA 3SNEA 1TNIA 1NY22 4DCDA 4NCYA 1HXEH 3STJA 3SV9A 1P2QA 3K6YA 3ESTA 4NIYA 1Z1IA 1QIXB 4THNH 1Z8GA 5EGMA 2LPRA 1EJNA 1TPSA 4D76A 4U2WA 1GBLA 1ZSLA 1FDPA 2HGTH 5JDUB 2J34A 2FLBH 3F9GA 1ANEA 1GBDA 3GCTG 1SOTA 1O3DA 4BAQB 3B8JA 3RM2H 3VEQB 4FUIA 4X6MA 1PQ8A 3SV7A 3SJ9A 1PJPA 2PKSB 1HJAC 7GCHG 3R3GB 3CP7A 4K1EA 1SOZA 2A45B 1EJAA 3M37A 3SU5A 4Y7BA 3ZV8A 1SL3A 5EQRA 4O9VA 2H6MA 1BTHH 2VJ1A 2A32A 2F9VA 3M7UA 2ZKSA 1V2MT 4FUBA 2GMTC 3SNBA 4XSKU 1O2QA 2IJOB 4H42U 1C1WH 1SGNE 2ZDMA 3A83A 3IITA 1K28D 2FOHA 1SG8B 4BAOB 3P6ZB 2EI8A 2OBQA 6GCHG 2ZHWH 1QRXA 1TYNA 2TGAA 3A82A 5DPAA 3GY7A 3MNXA 3ZZ9A 3HKJB 1FZZA 1ORFA 2G00A 1ZPBA 4YM9A 5CE1A 3T2NA 2AMPA 1FJSA 3OYPA 4HI3A 2BOHB 1SVPA 2ZHQH 1O2TA 4ZMAH 1TPPA 1OS8A 1L0ZA 1HV7A 5DP5A 3LU9B 1CGIE 1ABIH 3U9AH 4DW2U 1MAYA 1A5IA 2QXGA 1O33A 3SU4A 2NU4E 2SGFE 2XCNA 1HXFH 3VGCC 1A3BH 1T4UH 3A7TA 2D2DA 1Y5BT 2P93A 3PLPA 4TYDA 1BRCE 4CRBA 3SBKA 1TPOA 4R0IA 3CS0A 4BAKB 2WYGA 1IOEA 3A88A 1OP0A 3VPKA 2BDIA 3EA9A 3ZZ7A 2Y7ZA 7LPRA 1IQKA 1O5CB 2VVUA 2ZCLP 5K0HA 1GBAA 2WPMS 3ENSB 1WTGH 1EAUA 1MH0A 2TGPZ 2Z6BD 3RUOA 1YPGH 2R2MB 1C4U2 1J15A 4ESTE 1XUFA 1TFXA 4AFZA 3PTNA 4MNWA 1GJCB 1BTPA 1ZMNA 3PMAB 2OBOA 1ZPZA 4Y6DA 1F0UA 2A4QA 4DIHH 2Z3EA 2EEKA 3MHWU 2BY8X 3A81A 3QX5H 1OKXA 3EGKH 1OXGA 3GDUA 1U6QA 1VJ9U 3HKIB 3I78A 1F0SA 1MMJN 1AWFH 4NG9H 1GHZA 2GV6A 1ZZZA 5EW1H 4NFEA 2FEQH 2VU8E 3N7OA 3DD2H 3K9XB 1NESE 2J95A 1C1QA 3F68H 5DKMA 2W7SA 1A5HA 3BTKE 2V6NA 3UTUH 3MNBA 2PUQH 3MMGA 2H1UA 2ESTE 1LO6A 1GBEA 2AIPA 2XBXA 3GCHC 1DICA 4X8SH 1LHFH 3Q3XA 4YT6H 1MQ6A 1E34B 4B2AA 1SGRE 1IQHA 1OPHB 3HGNA 3UPEA 2ZZUH 3DA9B 1TBRH 5JBCS 4JZEH 1C5VA 1NFYA 3RXTA 2GT7A 1O2ZA 1P06A 3NZIA 1GL0E 3ATIA 3FVFB 1YPLH 1FONA 1O5FH 1JXPA 1MKXK 2R0KA 4A1VA 2VGCB 2WYJA 1H8DH 1S85A 4X6OA 4GSOA 1C2GA 1H9HE 3TU7H 1AWHB 4OS6A 1P03A 3DFLA 4M7GA 5A2MH 3A8DA 1GMDG 1GHYH 1EAIA 5E2OA 1GHAF 1P02A 1KXAA 2YOLA 1O3CA 1ZJKA 4ABEA 1FQ3A 3SGBE 1MBMA 3TH3H 3SU6A 1DY8A 2ZDLA 3OY6U 3OSYA 1H9IE 4K8YA 1UTJA 3QLPH 1ETTH 2EI6A 3E6PH 5A8YA 4ISIH 4AGJA 1O37A 3Q76A 2A5AA 3PO1B 3B23B 1YPKH 1ZSKA 4I33A 3RXFA 4X8UH 5EQSA 1LPKB 4BTIB 1Y3WA 1TGSZ 3LC5A 1T7CA 1NU7B 2QAAA 2C93B 4D8NA 1K1JA 1SGYE 2FS8A 5I25A 1QJ7B 2ZDVH 1Z6EA 2WPJS 1P2KA 4IC5A 3SUEA 2P8OC 1C2JA 1KLIH 1ELVA 1KXFA 4ZXXH 1CU1A 3PLBA 1EPTC 3KQEA 3LIWA 4NZQA 1CVWH 1DX5M 2FYQA 4DJZB 2ZHEH 1AMHA 1C1PA 5GXPA 3GYMA 1C9PA 3U98H 2A2QH 1C2FA 2RG3A 5GWZA 2P3UB 4Y11E 1KXBA 3V3MA 1LPGB 1QTFA 1P8VC 1LHEH 4JK5A 3DHKH 3O8RA 1ZMLA 1GHVH 4DG4A 4HZHA 4UD9H 3RP2A 5C20A 1TBZH 1SB1H 3PMBB 1O3FA 2ZO3H 3P8OA 4Y10E 4UFDH 3UOUA 7ESTE 2Y80A 2Y82A 4ABAA 2GGVB 2P59A 3I77A 1W2KH 4DVAU 1KY9A 1P2JA 3MO9A 4TWWA 3ZZDA 2VIWA 1T32A 5EXNA 1IQFA 5C2ZA 1O5EH 4AGKA 3TK5A 4MVNA 1G2LA 2ZGXH 1FUJA 1DVAH 1TWXB 3HK3B 5AF9H 3V12A 4AG2A 1RIWB 4YT7H 5E8EH 1K1OA 2ZU5A 1FMGA 1ETRH 1WSSH 2CV3A 1ACBE 3CS7A 4XBDA 2NWNA 2WPIS 2OC0A 5EPNA 6CHAC 3GY6A 2SGAA 1YPHC 2XBYA 3LH1A 1KLTA 4I32A 3BTFE 2TRMA 1SHYA 4ZHLU 1HYLA 1IQMA 3ZZ3A 1C1MA 4ABJA 1Y8TA 3ZVGA 5CHAC 5C1UA 2C8YB 1DXPA 2BZ6H 5DP4A 2ZTYA 1FPCH 1GCDA 2ZG0H 4GAWA 5DJ7A 1C5SA 4Z0KA 2QV1A 3BV9B 2FESH 1Y3XA 1BQYA 1TGCA 4IS5A 3LKWA 3SU0A 2EA3A 5LPEA 2GX4A 1S6FA 3FP7E 1AVXA 1UVTH 3KQBA 3T28A 1W12U 4X1NU 4ISHH 1CBWC 4ISNA 2HWLB 1M9UA 2VVVA 1PPEE 1EAXA 2Z3DA 5DP3A 1ZMJA 3RXLA 1FY3A 3HATH 3MOCA 1Z8IB 1UK4A 3FZZA 3BEUA 1AUJA 4A6LA 1XUJA 3DUXH 4JYVH 2PFEA 1G2MA 4WH8A 4J2YB 3ZZ5A 2BXUH 2H9EH 4CHAC 1P11E 1RTLA 2J92A 2WUBA 3SW2B 1MTNC 3TH2H 1QB9A 2BXTH 5JBAS 1DE7H 2EC9H 1ZHPA 1DWBH 1O30A 1Z8RA 3SNDA 1O3PB 1O3GA 5AHGH 1A0HB 2A5KA 2W26A 1TMUH 5LPRA 2HRVA 1E0FD 1MCVA 1GBHA 5L6NH 2FI3E 3D49H 1AFQB 1BUIA 1DLKB 3A80A 1GBKA 2G55A 1NRNH 3W95A 2ZGBH 3MYWA 1W8BH 1IHSH 2V0BA 1MCTA 2OC1A 2SGEE 3SV2H 1GJ4H 1W0ZU 2FOEA 4BTUB 1RS0A 1BTYA 1UTNA 3A7WA 4GUXA 4CR9A 1D3DB 3ZVCA 1GGDC 4Q80A 3H7OA 1HAYB 1VCPA 1UCYH 3V0XA 3V13A 3QWCH 2JH0D 4Y0ZE 1O2GH 1F92A 1MU8B 3I29A 4JMYA 4ZAEA 1L4ZA 1O3JA 4E05H 1GBIA 5F8XA 1NTPA 4YO9A 1AHTH 1FY4A 3EE0B 3SU1A 3QN7A 2QF0A 1GI2A 4IC6A 2BMGB 4JZFH 1GI3A 2RA0A 1E35B 1HDTH 1O2PA 1ZLRA 1UTOA 1GMCG 2A4GA 3EYDA 3M3VA 2Q6GA 1O2RA 1GMHG 2FM2A 2VIDA 1NC6A 1ID5H 4OGXA 3SI3H 2R3YA 4O3TA 3OX7U 3TH4H 4CBOA 4KTCA 3T26A 4X2WA 3RU4E 2PR3A 2GV7A 1OWJA 2UWLA 1OWDA 2G5NA 1V2TT 3EDXB 4YLQH 4X0WU 1O5AB 1THRH 3LGVA 1WYKA 2OQUA 1SQAA 2H5CA 1HAVA 2O8LA 3NXPA 1C5RA 4DY7B 1EB2A 2F3CE 2A7JA 2THFB 2Y5GA 3QUMP 1HJ8A 1BJUA 2BDHA 1EP6A 2XW9A 3M5NA 1LMWB 1UTMA 1FY8E 2PUXB 3QGJA 2Z9KA 1F5KU 1P57B 3A86A 2VH0A 5FHTA 1KIGH 4Y8XA 4FVBA 1XVOA 2VINA 1D6RA 4FU8A 5ESBA 2WPLS 2ZFQH 1EZSC 1PQ5A 4AN7A 3BTME 4K5ZA 1DWCH 2PTCE 1SGFG 1D9IA 1EX3A 2VB0A 2TIOA 3VFEA 1KLJH 1RTKA 2UUKB 3ZV9A 4DGJA 2ZDNA 2QY0B 4FU9A 4UDWH 2A2XH 1D3QB 1QL7A 4X1SU 5BPEA 1S83A 3Q3KA 1GBMA 3ATLA 3GISB 3SUGA 3FP8E 2BDBA 1GDQA 2FZZA 1GCTC 1F7ZA 1F0TA 2ZU2A 8GCHF 1AIXH 1A1RA 3AAVA 2ZTXA 4I8HA 1P2NA 1O2YA 1J8AA 2SGDE 1TA2A 1V2ST 3P8FA 1JOUB 3AW0A 1LHCH 2SFAA 5B6OA 1C5MD 3RU4D 3SO3A 2FODA 2ZFRH 1KTTB 1BOQA 3Q77A 3A89A 4MQAA 3A8CA 1WAYB 4A1TA 3PMHB 1VJAU 3ZZ8A 3F1SB 2ZGCA 5F03A 2ALVA 4WMFA 1FV9A 2BQ7B 2AS9A 1Y5UT 1FIWA 2STAE 1JMOH 2OTVA 1RJXB 4MLFB 3HPTB 2J94A 2GVFA 1C2HA 5F6MA 2VH6A 2XNIA 3KF2A 5H4IB 1W7XH 1V2OT 1EB1H 1BMNH 1T8OA 2JETB 1C5WB 1BTZA 1GJ6A 2RA3A 3ZZCA 1Y3UA 3M35A 1F0RA 2HNTF 2WV4A 1LHGH 3P8NA 3RXEA 1X7AC 3RLWH 1YPEH 5A8ZA 1PQ7A 1BRBE 4SGAE 3NPSA 1GJAB 4CREA 4K69A 1DOJA 2GCTC 2BD8A 1B0FA 1FN6A 1TGTA 1ZR0A 1K2I1 2FO9A 4A7IB 1QB1A 1FXYA 2UWOA 2SNVA 1BDAA 4JYTA 1EQ9A 3MH6A 3SZNA 1IQLA 1EZXC 4B1TA 2QXHA 5F8TA 1NM6A 1GHBF 1TLDA 2GCHG 1XUGA 1DSUA 3BEFB 4XE4A 4ZXYH 1MBQA 4IN2A 4CRFA 1GG6B 5HM2A 1S0RA 3M5MA 5T3HA 3P70B 1QR3E 1C5NH 3T27A 1T31A 1T4VH 1OWKA 4Q7YA 5PTPA 3BTWE 5HMAA 2GD4B 1P05A 1GJBB 1VZQH 4OS4A 3H5CB 1FY5A 4Q7ZA 3FAOA 2PGBB 1UO6A 1AB9B 2ILNA 5DP6A 7KMEH 2FXRA 1SGFA 2O8TA 3NKKA 2ZEBA 1DS2E 1LVYA 1FLEE 1BTXA 2P95A 1O5DH 4MNYA 5TJXA 3RXCA 4Q2KA 1HAHH 3UWIA 2XBWA 4BNRA 3MNSA 1DUEA 2O8MA 2Q6DA 3GDVA 5EQQA 3P95A 4RN6A 1QNJA 3ZZAA 1SGDE 4KP0A 4RSPA 1B0EA 1C5UA 1ELAA 4XBCA 2M5TA 1SGTA 1THSH 1AZ8A 1QURH 3QTVH 1NU9A 1P2IA 1V2PT 2UWPA 1PPBH 2OCVB 4BXSA 5DGJA 1HIAA 5E2PA 3D65E 3Q00A 1WTHD 4MDSA 4I31A 2Z9GA 3A85A 1TMBH 3ZVAA 5FAHA 1GI4A 1SHHB 1EASA 1CHOG 1EZQA 1GWAA 1N8OB 5C3NA 3PYHA 1DANH 3TGKE 5FX5A 1FY1A 1O39A 1PPZA 3RXRA 5JYIA 3GCTF 5EW2H 4Y76A 2TPIZ 3SQEE 3BEIB 1QFKH 1LVMA 4ABFA 1KXCA 2ZC9H 8LPRA 3GDSA 2P3TB 4YOGA 1O3MA 7GCHF 1TRMA 3SHCH 1C5OH 1HLTH 4DOQA 5T6FA 1ZRKA 1ANCA 4X6PA 1TNGA 4NA8A 2VVCA 3U69H 1AKSA 4WVPE 1O3EA 1GI1A 1TX7A 1GI7B 1F2SE 1Y3VA 1AQ7A 3UFAA 3LOXA 3RXMA 2ZF0H 1DPOA 3DT0H 2OXSA 1O5BB 3F9EA 2W7UA 4H6SB 2D1JA 3KNXA 4NWKA 4LZ4B 1CT2E 6GCHF 1O3LA 1LQDB 2IN2A 2FDAA 2G4UA 1AO5A 3TLOA 3F9HA 1MKXH 1P2OA 3M7QA 3UR9A 3A8BA 1EUFA 3UWJH 2GDDA 1C1NA 4K8BA 4GVUA 5JBBS 1FI8A 3VB7A 1AKSB 1GI0A 3ODDA 1UMAH 3P8GA 2Y81A 1SGI