1XVQA

Crystal structure of thiol peroxidase from mycobacterium tuberculosis
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
166
structure length
159
Chain Sequence
AQITLRGNAINTVGELPAVGSPAPAFTLTGGDLGVISSDQFRGKSVLLNIFPSVDTPVCATSVRTFDERAAASGATVLVSKDLPFAQKRFCNVMPASAFRDSFGEDYGVTIADGPMAGLLARAIVVIGADGNVAYTELVPEIAQEPNYEAALAALGATS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords thiol peroxidase
publication title Functional and Structural Characterization of a Thiol Peroxidase from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Oxidoreductase
total genus 45
structure length 159
sequence length 166
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2004-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1xvqA00
3EURA 3GSTA 4F03A 1U3AA 4PX1A 4WETA 2HRFA 2H6XA 5EPFA 3MAKA 1YZXA 1VF2A 2HYXA 4PXOA 4TRXA 1AQXA 2VL2A 1VRSD 5B7CA 2DJKA 3A5WA 1XFLA 2I4AA 2AB6A 1EV4A 4MMMA 4YQUA 4XCSA 3MWHA 2OE0A 1YKCA 1GSDA 1ILOA 1R5PA 3I6AA 4K9ZA 1K3LA 5G2ZA 2DLXA 3I69A 4GWRA 4TVEA 3A2WA 2FHEA 2WULA 4QL9A 5G1KA 2C0FA 3M3MA 3TCOA 1JZOA 13GSA 4TR0A 2YWOA 2KOKA 5IO2A 3N5OA 2FGXA 3QAWA 3KH7A 4ZB9A 2H70A 5ECHB 2FD3A 1IYHA 5ECLB 5JWOB 1GSFA 2YNXA 4LL1B 4IS0A 1U6TA 1XVQA 3F63A 2C0EA 1TK5B 4MF7A 5AGYA 4TR1A 3FR6A 4EKZA 3CRTA 20GSA 3L0HA 3LJRA 1H4OA 4IBPA 5A4WA 4HU7A 2V6KA 1E6BA 1SD9A 3HVVA 3F4TA 3FYGA 3VPQA 4IN0A 2RUFA 4JRRA 1ML6A 3F3QA 5ENUA 4WF5A 5LNKe 5DQSA 4WBRD 4RQXA 2V2GA 2YJ7A 4HOJA 4KNDA 1GNEA 2P31A 5D9XA 1WJKA 1A0RP 4JE1A 2R2JA 1BAYA 1OYJA 4LL4B 3GFKA 2H72A 2OBIA 4I8BA 5J9CA 5ECKB 3IDVA 3BJ5A 2RM5A 4HI7A 1MEKA 2DMLA 4I97A 2XBQA 1DE2A 1NW2A 5H5SA 1AW9A 2H1BA 2CVDA 3HJMA 1XWBA 3TRXA 3ZFLA 1AAZA 5F05A 3TDGA 2CA8A 4BVYA 1HNCA 5KN1A 4HQSA 4KSOA 2LSTA 5A5KA 4TW5A 5IIZA 1SL2B 4XRAA 5FWGA 5AN1A 2E2MA 1LJRA 2GSSA 3BBYA 3FY7A 4XIHA 4MJEA 1F3AA 1PA3A 6GSVA 3EU3A 3KP8A 4ML6A 1O8WA 5J3RA 2YN1A 4HS1A 4XS4A 2VO4A 2PMTA 1GSQA 3Q18A 1RQMA 5CRHA 3FR9A 1IYIA 1QK8A 3G9BA 1WWJA 3QAVA 4KDUA 3KGKA 3HKRA 1W4VA 3IA1A 3TKSA 2L6DA 2LRTA 2FY6A 3IK7A 1HYUA 4O92A 4G9HA 1PX6A 2AJQB 2B5YA 1I9DA 4V1Ag 1TI1A 3H4KA 1WPIA 2CVBA 2R6KA 3LORA 1V58A 4NAXA 4JEDA 2H0IA 8GSSA 4LMWA 4DSSA 3VLNA 3WGEA 2KP1A 1FHEA 2YANA 3F3RA 4OCEA 1MDKA 3DIEA 2O8VB 5KN0A 3F9UA 3TRQA 4ECBA 1UN2A 5GAPD 1SL1B 1ERUA 2PU9C 1R7HA 5CRDA 3VWWA 1GUHA 3IAM2 2E2GA 1MD4A 1TRUA 2LKUA 2I1UA 1TU7A 4KGIA 4F9ZA 5F0GA 1EZKA 3J7Yk 2QC7A 3GIXA 4EC0A 3V1WA 5ECNB 2I81A 4CDOA 3Q74A 2YJHA 5HQPA 2MBSA 2H0HA 5INYA 3QD9A 4PNFA 3WGDA 2OA7A 3ISOA 2B5XA 4IHUA 3G7IA 3C71A 3C8EA 5ECMB 2N5BA 1V2AA 4I6XA 1XVWA 4OCFA 2FA8A 5GSTA 2MMNA 3ERGA 2VCZA 3APSA 3IV4A 4E8HA 4MH2A 3WD6A 3BCIA 5ECSA 2X99A 1VF4A 3GKMA 4ZB8A 3KH9A 3UMAA 2VM2A 2IPAA 3GUSA 1GULA 5HFGA 3KP9A 1T8EB 2BJXA 5CAXA 2I9HA 2ZCTA 3H8QA 2F8FA 2IIYA 1A24A 3DXBA 4L8EA 2CX4A 1EGOA 2EIOA 3SBCA 2C80A 3RPNA 2VUPA 2HSYA 5ABRA 3S9FA 2ALBA 3ED3A 3VWVA 3KTLA 4MABA 1GTAA 5HR2A 9GSSA 1TTZA 4EVMA 2HZEA 1ZOFA 4V2NA 3GH6A 4D73A 3GSSA 3DEXA 2VIMA 3I43A 2MMZA 1FAAA 3DYRA 4TXOB 1FB0A 1Z7PA 4HJMA 4OFTA 4OFNA 4POMA 3KXOA 4MF6A 3KIJA 2BTOT 1UA5A 3ZYWA 2GTUA 3UVHA 3P2AA 1V9WA 2FLSA 3HDCA 2L57A 3HYPA 4RI6A 2N5FA 4I5QA 1CQHA 4K7IA 4PQIA 5AIVA 2WCIA 1XIYA 2PPTA 1OC8A 4GSTA 3ERWA 4OMVA 2TRCP 1BYEA 5IQYA 3HZ8A 5IMZA 3FKFA 1EWXA 4V2MA 3ME7A 4YAPA 3TJJA 1SYXA 1SU9A 4GXZA 3DKSA 3IE3A 3LYPA 5HFKA 3MNGA 2G0FA 1BG5A 4MZCA 2P5QA 3FZ5A 3OR5A 2R5GA 5CRGA 1ZZYA 3IAS2 1G7OA 4TR4A 3CSIA 1T00A 2H01A 3DVWA 2DJJA 6GSTA 2LJKA 2C0DA 3RPPA 4K7NA 2O89A 4ECIA 1QXHA 2P5RA 3HD5A 4Z7XA 1GWCA 1XXUA 4NHWA 3LEFA 4NMUA 5DALB 4KCEA 3LGCA 3IPZA 1GSEA 2GSQA 2WS2A 4TN8A 1TXXA 1TK0B 3GMFA 3P90A 1GLPA 5D73A 4POLA 1SKWB 2F3MA 2KP2A 4BWSA 1ZYQB 1ZYEA 3IC4A 5EY6A 5DJMA 4K0GA 2DJ3A 4P3YB 1GTIA 2YZHA 3PINA 3GKXA 3A2VA 2H1DA 4PUFC 3FK8A 2B7JA 4G2EA 3TJKA 5IPHA 2OKAA 3UL3A 1OC9B 1T3BA 4ZIJA 1HQOA 4GTUA 1TDIA 3F4SA 2IFQB 3ZIVA 4ZBAA 3ZITA 1X9SB 4FYBA 3GURA 1HNBA 4WXTA 1GUKA 2A2SA 3CMIA 3HHVA 4K6XA 3UBLA 3GX8A 6GSWA 5D93A 3TGZA 2AYTA 2AUVA 1YEPA 2GVPA 4NPBA 1M9AA 1O81A 1RK4A 2VLUA 5CRWA 3PH9A 1BJXA 3TB2A 2IMKA 2VL2C 2ON7A 4CW9A 1XW9A 3W8SA 3CTFA 2K6VA 1SJZA 4JZQA 12GSA 4KSMA 3TUEA 4RI7A 4IGJA 3D6IA 2VCXA 4TXVA 4ZILA 4KH7A 1OC3A 4G19A 3WT2A 1USBA 5FHIA 1QGVA 2L59A 2H76A 3I9V2 4MJBA 1UVZA 3APQA 5B8BA 3GYKA 1EEJA 1PQNA 1SK1A 3QMXA 4AF2A 2PGTA 3GKKA 1YQ1A 2GLRA 4XTSA 3UBKA 1NM3A 1A2JA 2M80A 1URMA 5G31A 2GZYA 1YKAA 2B5EA 3GV1A 2JU5A 4N10A 1T1VA 2VCQA 3EE2A 5J41A 3LYKA 2VD0A 3F6FA 1J0FA 2K9FA 4YH2A 1A8YA 2RLIA 4MZBA 2DJ0A 4G10A 4XS6A 5LD0A 4NV5A 5CREA 2JZTA 1EOHA 1SKSB 1F2EA 2LNTA 3H79A 3TRPA 3R2QA 3HCZA 1WE0A 3NZNA 2FWHA 4MK3A 4N11A 5D9WA 2ON5A 3ZVJA 4L0WA 3KTBA 2RUEA 4WEYA 3KZQA 4YAVA 1M9BA 5J4UA 3A2XA 3CTGA 5D96A 2L4CA 4J2FA 3CRUA 3FRCA 1M2BA 5JCUA 3H93A 1UC7A 2LTKA 2MMOA 3VK9A 4KA0A 2EIQA 3L9VA 5A4VA 1PMTA 2FNOA 3DWVA 4V2LA 3DD3A 4PQ1A 4IJIA 2C3QA 3KD0A 1KBNA 3N9JA 1A0FA 4TKYA 4EL1A 1AC1A 16GSA 5HR1A 3M9KA 2PN8A 2YV9A 1XW5A 3RBTA 2GQLA 3BCKA 1QUWA 2DJ2A 3FW2A 2H30A 2YCDA 1BX9A 4NV2A 3FZAA 4FO5A 2CQ9A 4K0NA 2HT9A 1JLVA 2KLXA 3ZMLA 1E2YA 2VD1A 5A4UA 1EP7A 5H5QA 2WZ9A 2L4QA 1F3BA 1N8JA 1X0RA 4TR1B 3LXZA 4X1UA 4DSRA 2G2QA 1OKDA 2MZCA 4IELA 3U5RE 1G0TA 1XZOA 3E0UA 1PL1A 4NHZA 1Q4JA 2VOCA 1KTEA 1LU4A 3IXRA 4XS1A 2CX3A 3G7JA 5DQYA 1M2DA 3KMNA 3LXTA 2H75A 3W8JA 4KDYA 1J9BA 2H0GA 4N30A 3TKRA 2OBKA 1R26A 2PBJA 3TKSC 4O5RA 2F8AA 1XOAA 3HVSA 4QQ7A 4KAEA 3O3TA 2R3XA 2M46A 3IK9A 1MDJA 3ZL5A 1I5GA 2H74A 1HD2A 1S3CA 5G5FA 3GX0A 2MMAA 4HEA2 4HJ2A 1T7PB 1JZWA 1KEBA 4IQAA 2HZFA 3IBHA 4ZL7A 3LWAA 1ZL9A 1SJ6A 5KEJA 1TU8A 5JCGA 3UOMA 5DVBA 5IOWA 4GRFA 2GZZA 3L78A 1U3IA 2R4VA 4FH8A 4V1Ap 3HZ4A 3VFIA 3E3EA 2LQQA 5IO0A 3M0FA 1A23A 2P0GA 3EMPA 2FUG2 2F9SA 1OE7A 4O32A 3UARA 4MF5A 1SD8A 3CSJA 5LCZA 1SYRA 1Z5YE 2L5OA 3D22A 4FYUA 4XS4B 2WGRA 4HZ4A 2VM1A 1B8XA 2YP6A 1S3AA 3F6DA 1QMVA 3KMOA 5CYYA 1TRVA 4IP6A 1G7EA 2XBIA 3GL3A 2X8HA 5CO3A 5GZZB 4HQZA 1R4WA 4ZBDA 2C8UA 2GS3A 4IJ3A 1T4YA 2F51A 4JR6A 3CSHA 2DMMA 1FOVA 2VCTA 1NHOA 3C7MA 3UVTA 7GSSA 4DSSB 1OKTA 3ZIJA 5D8IA 4ZBBA 2DJ1A 3TKSE 5E59A 1V98A 4Q5QA 5ELGA 4MJAA 4RUVA 2B1KA 3F8UA 1TW9A 3GTUB 2VCWA 3KM6A 2IMEA 5J5NA 2E0QA 4ECJA 1ZCPA 2FWEA 1GH2A 5GSSA 4OD7A 4POBA 1K3OA 1K0OA 1Z6MA 4L0UA 1YF1A 2PVQA 2WDUA 1G6WA 1XPVA 2LJRA 4FYCA 3QPMA 3WYWA 3GNJA 4OO5A 3DGQA 4IKHA 6GSXA 4I2UA 1GTBA 4KE3A 2J9HA 3ZVJD 1B48A 1GSUA 2GDRA 1MD3A 5DJLA 2JZSA 1A8LA 1XOBA 4RQRA 4MPFA 2PWJA 3RHBA 2V6OA 2ZNMA 3WT1A 5ID2A 1Z3EA 2VCVA 4XRDA 1THXA 5KN3A 3LSZA 2H8LA 2B3SA 3KCMA 18GSA 2FA4A 4I2TA 1DBYA 2KHPA 3UEMA 1GTUA 2MBTA 2GGTA 5ECRB 2HSHA 3IHQA 2H73A 3VPTA 2B7KA 3TKPA 3FHKA 3TOUA 4WBJA 2REMA 1OC9A 4N0VA 2RIIA 1TK8B 2X8GA 2XPDA 3GHAA 2WRTA 1TJDA 1PD21 2X64A 1B9YC 1ST9A 2N5AA 1PSQA 2MYGA 4ZL9A 3J7Yb 4JR4A 3HJPA 3VWUA 1EGRA 1XWAA 1V40A 2OJLA 1EP8A 4PGTA 3L9UA 1YF0A 4GSSA 5AIXA 5C00A 1N2AA 5COHA 5ECPB 4AGSA 5IMAA 1TP9A 2ZUPA 4KB3A 5G5EA 4XHMA 5E4WA 2LRCA 3LQ7A 5IMVA 5HR0A 2C1YA 3RDWA 2HZEB 3QOUA 2PUKC 1JZDA 1ERVA 1Y25A 2V41A 2WFCA 4MA9A 1PKWA 2AV4A 4IVFA 1VGLA 4MDCA 4TR3A 1O8XA 1O73A 1OAZA 1J08A 2AHEA 5DAKB 2Z9SA 4EUYA 5EVOA 3TJGA 1PGTA 1FW1A 3TOTA 3IR4A 2HXKA 1OE8A 1AXDA 5ELAA 5HFIA 1Z9HA 1XWCA 2CAQA 3C1SA 2H1AA 2YOIA 2E7PA 3IOSA 4POKA 3VI7A 3O76A 5IMFA 1O6JA 2OADA 6GSYA 3KEBA 2WJUA 1U87A 5C04A 3UJ1A 4K1FA 4Q5FA 4MJCA 2J23A 1QFNA 1V57A 1TOFA 2JZRA 1PX7A 5ECOB 5B8AA 2A2RA 5IMCA 1X9MB 1AIUA 14GSA 2GT5A 2FWGA 4DEJA 3QFAC 22GSA 4YQMA 2PERA 4BA7A 3KJYA 4L5OA 2LUSA 3H1NA 4N0ZA 4F82A 2C0GA 4EO3A 1WOUA 1XWGA 2TIRA 3G7YA 3GH9A 4L5LA 2V1MA 2VAFA 3FZ9A 2K8VA 3D4TA 1ERTA 3US3A 1X5CA 4MH3A 5IPGA 1S3DA 3FEUA 3RAZA 3MDKA 2JADA 4LA1A 3D4MA 1FB6A 4OWYA 1SKRB 2YWMA 5DCHA 2CAIA 2GT6A 4FIWA 2CZ3A 2XC2A 2XHFA 4EE0A 2C4JA 3HJOA 3QDNA 3EVIA 2GSTA 1M7TA 2VLTA 2YZUA 4KX4A 3RHCA 3GKNA 1TRSA 2HFDA 5B6NA 3SWLA 2EC4A 1TI3A 1YY7A 5DDLA 3ZRDA 4AJ6A 2DIZA 1JZRA 3A3TA 4WR5A 5F07A 3FZ4A 1DUGA 2QSIA 4KW6A 1ABAA 1X9WB 2LQOA 2O85A 1FO5A 4DVCA 1XWKA 5EL8A 3D0ZA 1HNAA 4JU5A 4K7OA 3WGXA 17GSA 2H1GA 3LG6A 4MZWA 4IP1A 5H5RA 4JBBA 3C73A 1Q98A 1K3YA 1Z6NA 4GCIA 3L9SA 3BD2A 2VL3A 4GQFA 2HRNA 3DRNA 4ILFA 5G30A 1DSBA 3GA4A 1M2AA 3EMXA 5J9BA 5AISA 2K18A 2YWIA 2A4VA 1EOGA 5F8BA 1LBKA 2LJAA 2FCHA 3L4NA 4BL7A 1G6YA 4X0XA 5KN2A 4MCUA 2JACA 1SK2A 1PL2A 3Q19A 1SL0B 3DMLA 2LNSA 3CBUA 3GN3A 4HZ2A 5ECIB 4OFMA 1VF1A 1C72A 1K0AA 3AY8A 1WRYA 1XW6A 3GRXA 1M99A 3EINA 4EDZA 1O85A 2NBSA 4HU9A 1JLWA 2VL9A 4KCAA 3Q6OA 2OACA 4AJ8A 2DC5A 3QAGA 3EC3A 4EDYA 2OE1A 3TKQA 2GZPA 2NDOA 3APOA 5B6MA 1PKZA 2DSAA 4ULXA 3M9JA 1AQWA 4EXJA 2HI7A 1NHYA 1FVJA 3UAPA 5DBQA 1Y6EA 4NWYA 2L6CA 2DIYA 1K0NA 1F6MC 4PUAA 1WMJA 4IW9A 1GLQA 3FR3A 4NXIA 4F2IA 3ERFA 2GSRA 2L5LA 4F0BA 4MLYA 4ACSA 2WB9A 1K0DA 3ZTLA 3GTUA 2I3YA 4ZXGA 1EEMA 1YJ6A 1ACVA 2O7KA 5IOXA 4E8EA 1M0UA 2C3TA 2V32A 2KUCA 1K0CA 3PGTA 1TRWA 2HNLA 4K8MA 5FT3A 3CXGA 5IM9A 2CT6A 3LFLA 4TXOA 3K8NA 2NTOA 4PURA 3P7XA 1YEXA 1KNGA 1EV9A 1XBSA 3C1RA 2NPBA 1VF3A 2DBCA 2YV7A 3QCPA 1SJIA 3HA9A 2VLVA 4F0CA 4K2DA 2H6ZA 2D2ZA 2H6YA 2R37A 2LEGA 2OE3A 2RM6A 2LS5A 2TRXA 3CYNA 5GAND 2B1LA 1B4QA 2GQKA 2YPMA 1H75A 1F37A 2AAWA 2YWNA 4J57E 2ES7A 2C3NA 1GSYA 3TJBA 1GL8A 2IJYA 1K0MA 3O6TA 4IQ1A 4HUAA 2FWFA 2IMIA 4ISDA 1Z7RA 3ZMKA 4GSNA 2IWTA 4AJ7A 4ZB6A 3EWLA 1X5EA 2CVKA 4GLTA 1A2MA 4KUNA 3QR6A 1MTCA 2NVLA 4BVXA 1GP1A 1AQVA 1ZMAA 3ME8A 1GUMA 4LLRA 1ZGNA 4PQHA 3U6VA 2HLSA 4WKWA 3PR8A 1SK0A 4TOPA 4HDEA 1GSSA 2XPEA 5CP1A 4OO4A 3F4RA 2IMFA 1JFUA 2PVOC 3EYTA 1TKDB 2H71A 1JHBA 2O87A 3MSZA 1B9XC 3ZLPA 1WIKA 4WF4A 3VWXA 3D5JA 2IL3A 1GNWA 5DALA 1R5AA 3ZREA 4WR4A 4GQCA 4Q5NA 10GSA 1THOA 5JWQB 2BMXA 4QL7A 5L71A 2M72A 3EU4A 3IRAA 3DVXA 1B4PA 1XCCA 4BWQA 1F9MA 3M1GA 2IN3A 1RW1A 2EIRA 1NSWA 2JL4A 4YQVA 3F0IA 1QQ2A 3ZZXA 11GSA 2LV3A 2H66A 4MP4A 2CZ2A 5DAKA 3ZFBA 3HXSA 5HR3A 1FG4A 4GF0A 5CNWA 19GSA 3TJFA 3GL5A 3M8NA 2B6MA 4CHSA 6GSUA 2LRNA 1K0BA 3UIWA 1MDIA 6GSSA 4ECCA 2IFQA 1YDKA 3JCML 4PNGA 5D9VA 4ML1A 1BEDA 2X8CA 5JWRB 4EF0A 1WP0A 4ZL8A 5D9TA 1W89A 3HVXA 4MPGA 4X43A 3VI5A 4Q5RA 2CV4A 4J56E 1BQ7A 1X5DA 3NIVA 2JSZA 2JSYA 2H19A 2QGVA 5G1LA 2K8SA 4LMVA 5JCWA 3VURA 3D21A 4DSQA 4D73B 2IMDA 4H86A 3BOAA 1GRXA 4KDXA 1CQGA 5F06A 1SENA 1ERWA 1U88A 1PN9A 3E9JB 1T4ZA 3W6GA 3QFBC 4O7HA 4BPYA 1FVKA 1PRXA 1OVNA 2QKEA 5DCGA 1O7UA 3HY2A 5ID2B 3NOFA 1ON4A 1A2LA 1AUCA 4ID0A 2GQMA 5IMDA 3P8WA 2HE3A 1DE1A 5ECQB
chains in the Genus database with same CATH superfamily
3EURA 3GSTA 4F03A 1U3AA 4PX1A 4WETA 2HRFA 2H6XA 5EPFA 3MAKA 1YZXA 1VF2A 3R3EA 2HYXA 4PXOA 2R0PA 4TRXA 1AQXA 2VL2A 1VRSD 5B7CA 2DJKA 3A5WA 1XFLA 2I4AA 2AB6A 1EV4A 4K5SA 4MMMA 4YQUA 4XCSA 3MWHA 2OE0A 1YKCA 1GSDA 1ILOA 1R5PA 3I6AA 4K9ZA 1K3LA 5G2ZA 2DLXA 3I69A 4GWRA 4TVEA 3A2WA 2FHEA 2WULA 4QL9A 5G1KA 4X4JA 2C0FA 3M3MA 3TCOA 1JZOA 13GSA 4TR0A 2YWOA 4Z2TA 2KOKA 5IO2A 3N5OA 2FGXA 3QAWA 3KH7A 4ZB9A 2H70A 5ECHB 2FD3A 1IYHA 5ECLB 5JWOB 1GSFA 2YNXA 4LL1B 4IS0A 1U6TA 1XVQA 3F63A 2C0EA 4G0KA 1TK5B 4MF7A 5AGYA 4TR1A 3FR6A 4EKZA 3CRTA 20GSA 3L0HA 3LJRA 1H4OA 4IBPA 5A4WA 4HU7A 2V6KA 1E6BA 1SD9A 3HVVA 3F4TA 3FYGA 3VPQA 4IN0A 2RUFA 4JRRA 1ML6A 3F3QA 5ENUA 4WF5A 5LNKe 2X4AA 4EIQA 5DQSA 4WBRD 4RQXA 2V2GA 2YJ7A 4HOJA 4KNDA 1GNEA 2P31A 5D9XA 1WJKA 1A0RP 4JE1A 2R2JA 1BAYA 1OYJA 4LL4B 3GFKA 2H72A 2OBIA 4I8BA 5J9CA 5ECKB 3IDVA 3BJ5A 2RM5A 4HI7A 1MEKA 2DMLA 4I97A 2XBQA 1DE2A 1NW2A 5H5SA 1AW9A 2H1BA 2CVDA 3HJMA 1XWBA 3TRXA 3ZFLA 1AAZA 5F05A 3HVNA 3TDGA 2CA8A 4BVYA 1ZYNA 1HNCA 5KN1A 4KSOA 4HQSA 2LSTA 5A5KA 4TW5A 2HRKA 5IIZA 1SL2B 4XRAA 5FWGA 5AN1A 2E2MA 1LJRA 2GSSA 3BBYA 3FY7A 4XIHA 4MJEA 1F3AA 1PA3A 6GSVA 3EU3A 3KP8A 4ML6A 1O8WA 5J3RA 2YN1A 4HS1A 4XS4A 2VO4A 2PMTA 1GSQA 3Q18A 1RQMA 5CRHA 3FR9A 1IYIA 1QK8A 3G9BA 1WWJA 3QAVA 4KDUA 3KGKA 3HKRA 3EPTA 1W4VA 3IA1A 3TKSA 2L6DA 4EIPA 2LRTA 2FY6A 3IK7A 1HYUA 4O92A 4G9HA 1PX6A 2AJQB 2B5YA 5KOXA 1I9DA 4V1Ag 1TI1A 3H4KA 1WPIA 2CVBA 2R6KA 3LORA 1V58A 4NAXA 4JEDA 2H0IA 8GSSA 4LMWA 4DSSA 3VLNA 3WGEA 2KP1A 1FHEA 2YANA 3F3RA 4OCEA 1MDKA 3DIEA 2O8VB 5KN0A 3F9UA 3TRQA 4ECBA 1UN2A 5GAPD 1SL1B 1ERUA 2PU9C 1R7HA 5CRDA 3VWWA 1GUHA 3IAM2 2E2GA 1MD4A 1TRUA 2LKUA 2I1UA 1TU7A 4KGIA 4F9ZA 5F0GA 1EZKA 3J7Yk 2QC7A 3GIXA 4EC0A 3V1WA 5ECNB 2I81A 4CDOA 3Q74A 2YJHA 5HQPA 2MBSA 2H0HA 5INYA 3QD9A 4PNFA 3WGDA 2DKIA 2OA7A 3ISOA 2B5XA 4IHUA 3G7IA 3C71A 3C8EA 5ECMB 2N5BA 1V2AA 4I6XA 1XVWA 4OCFA 2FA8A 5GSTA 3IC8A 2MMNA 3ERGA 2VCZA 3APSA 3IV4A 4E8HA 4MH2A 3WD6A 3BCIA 5ECSA 2X99A 1VF4A 4YKFA 3GKMA 4ZB8A 3KH9A 3UMAA 4ICYA 2VM2A 2IPAA 5BRTA 3GUSA 1GULA 5HFGA 3KP9A 1T8EB 2BJXA 5CAXA 2I9HA 2ZCTA 3H8QA 2F8FA 2IIYA 1A24A 3A5IA 3DXBA 4L8EA 2CX4A 1EGOA 2EIOA 3SBCA 2C80A 3RPNA 2VUPA 2HSYA 5ABRA 3S9FA 2ALBA 3ED3A 3VWVA 3KTLA 4MABA 1GTAA 5HR2A 9GSSA 1TTZA 4EVMA 2HZEA 1ZOFA 4V2NA 3GH6A 4D73A 3GSSA 3DEXA 2VIMA 3I43A 2MMZA 1FAAA 3DYRA 4TXOB 1FB0A 1Z7PA 4HJMA 4OFTA 4OFNA 4POMA 3KXOA 4MF6A 3KIJA 2BTOT 1UA5A 3ZYWA 2GTUA 3UVHA 3P2AA 1V9WA 2FLSA 3HDCA 2L57A 3HYPA 4RI6A 2N5FA 4I5QA 1CQHA 4K7IA 4PQIA 5AIVA 2WCIA 1XIYA 2PPTA 1OC8A 4GSTA 3ERWA 4OMVA 2TRCP 1BYEA 5IQYA 3HZ8A 5IMZA 3FKFA 1EWXA 4V2MA 3ME7A 4YAPA 3TJJA 1SYXA 1SU9A 4GXZA 3DKSA 2QA2A 3IE3A 3LYPA 5HFKA 3MNGA 2G0FA 1BG5A 4MZCA 2P5QA 3FZ5A 3OR5A 2R5GA 5CRGA 1M3JA 1ZZYA 4BVXB 3IAS2 1G7OA 4TR4A 3CSIA 1T00A 2H01A 3DVWA 2DJJA 6GSTA 2LJKA 2C0DA 3RPPA 4K7NA 2O89A 4ECIA 1QXHA 2P5RA 3HD5A 4Z7XA 1GWCA 1XXUA 4NHWA 3LEFA 4NMUA 5DALB 4KCEA 3LGCA 3IPZA 1GSEA 2GSQA 2WS2A 4TN8A 1TXXA 1TK0B 3GMFA 3P90A 1GLPA 5D73A 4POLA 1SKWB 2F3MA 2KP2A 4BWSA 1ZYQB 1ZYEA 3IC4A 5EY6A 5DJMA 4K5RA 4K0GA 2DJ3A 4P3YB 1GTIA 2YZHA 3PINA 3GKXA 3A2VA 2H1DA 4PUFC 3FK8A 2B7JA 4G2EA 3TJKA 5IPHA 2OKAA 3UL3A 1OC9B 1T3BA 4ZIJA 1HQOA 4GTUA 1TDIA 4K2XA 3F4SA 2IFQB 3ZIVA 3PPUA 4ZBAA 3ZITA 1X9SB 4FYBA 3GURA 1HNBA 4WXTA 1GUKA 2A2SA 3CMIA 3HHVA 4BIKA 4K6XA 3UBLA 3GX8A 6GSWA 5D93A 3TGZA 2AYTA 2AUVA 1YEPA 2GVPA 4NPBA 1M9AA 1O81A 1RK4A 2VLUA 5CRWA 3PH9A 1BJXA 3TB2A 2IMKA 2VL2C 2ON7A 4CW9A 1XW9A 2A2PA 3W8SA 3CTFA 2K6VA 1SJZA 4JZQA 12GSA 4KSMA 3TUEA 4RI7A 4IGJA 3D6IA 2VCXA 4TXVA 4ZILA 4KH7A 1OC3A 4G19A 3WT2A 1USBA 5FHIA 1QGVA 2L59A 2H76A 3I9V2 4MJBA 1UVZA 4YKGA 3APQA 5B8BA 3GYKA 1EEJA 1PQNA 1SK1A 3QMXA 2R0CA 4AF2A 2PGTA 3GKKA 1YQ1A 2GLRA 2HSMA 4XTSA 3UBKA 1NM3A 1A2JA 2M80A 1URMA 5G31A 2GZYA 1YKAA 2B5EA 3GV1A 2JU5A 4N10A 1T1VA 2VCQA 3EE2A 5J41A 3LYKA 2VD0A 3F6FA 1J0FA 4MNNA 2K9FA 4YH2A 1A8YA 2RLIA 4MZBA 2DJ0A 4G10A 4XS6A 5LD0A 4NV5A 5CREA 2JZTA 1EOHA 1SKSB 1F2EA 2LNTA 3H79A 3TRPA 3R2QA 3HCZA 1WE0A 3NZNA 2FWHA 4MK3A 4N11A 5D9WA 2ON5A 3ZVJA 4L0WA 3KTBA 2RUEA 4WEYA 3KZQA 4YAVA 1M9BA 5J4UA 3A2XA 3CTGA 5D96A 2L4CA 4J2FA 3CRUA 3FRCA 1M2BA 5JCUA 3H93A 1UC7A 2LTKA 2MMOA 3VK9A 4KA0A 2EIQA 3L9VA 5A4VA 1PMTA 2FNOA 3DWVA 4V2LA 3DD3A 2HRAA 4PQ1A 4IJIA 2C3QA 3KD0A 1KBNA 3N9JA 1A0FA 4TKYA 4EL1A 1AC1A 16GSA 5HR1A 3M9KA 2PN8A 2YV9A 1XW5A 3RBTA 2GQLA 3BCKA 1QUWA 2DJ2A 3FW2A 2H30A 2YCDA 1BX9A 4NV2A 3FZAA 4FO5A 2CQ9A 4K0NA 2HT9A 1XG8A 1JLVA 2KLXA 3ZMLA 1E2YA 2VD1A 5A4UA 1EP7A 5H5QA 2WZ9A 2L4QA 1F3BA 1N8JA 1X0RA 4TR1B 3LXZA 4X1UA 4DSRA 2G2QA 1OKDA 2MZCA 4IELA 3U5RE 1G0TA 1XZOA 3E0UA 1PL1A 4NHZA 1Q4JA 2VOCA 1KTEA 1LU4A 3IXRA 4XS1A 2CX3A 3G7JA 5DQYA 1M2DA 3KMNA 3LXTA 2H75A 3W8JA 4KDYA 1J9BA 2H0GA 4N30A 3TKRA 2OBKA 1R26A 2PBJA 2R0GA 3TKSC 4O5RA 2F8AA 4A5PA 1XOAA 3HVSA 4QQ7A 4KAEA 3LW9A 3O3TA 2R3XA 2M46A 3IK9A 1MDJA 3ZL5A 1M3IA 1I5GA 2H74A 1HD2A 1S3CA 5G5FA 3GX0A 5KOWA 2MMAA 4HEA2 4HJ2A 1T7PB 1JZWA 1KEBA 4IQAA 2HZFA 3IBHA 4ZL7A 3LWAA 1ZL9A 4BL7B 1SJ6A 5KEJA 1TU8A 5JCGA 3UOMA 5DVBA 5IOWA 4GRFA 2GZZA 3L78A 1U3IA 2R4VA 4FH8A 4V1Ap 3HZ4A 3VFIA 3E3EA 2LQQA 5IO0A 3M0FA 1A23A 4Z2RA 2P0GA 3EMPA 2FUG2 2F9SA 1OE7A 4O32A 3UARA 4MF5A 1SD8A 3CSJA 5LCZA 1SYRA 1Z5YE 2L5OA 3D22A 4FYUA 4XS4B 2WGRA 4HZ4A 2VM1A 1B8XA 2YP6A 1S3AA 2A4HA 3F6DA 1QMVA 3KMOA 5CYYA 1TRVA 4IP6A 1G7EA 2XBIA 3GL3A 2X8HA 5CO3A 5GZZB 3MYDA 4HQZA 1R4WA 4ZBDA 2C8UA 2GS3A 1S3RA 4IJ3A 1T4YA 2F51A 4JR6A 3CSHA 2DMMA 1FOVA 2VCTA 1NHOA 3C7MA 3UVTA 7GSSA 4DSSB 1OKTA 3ZIJA 5D8IA 4ZBBA 2DJ1A 3TKSE 5E59A 3CQFA 1V98A 4Q5QA 5ELGA 4MJAA 4RUVA 2B1KA 3F8UA 1TW9A 3GTUB 2VCWA 3KM6A 2IMEA 5J5NA 2E0QA 4ECJA 1ZCPA 2FWEA 1GH2A 5GSSA 4OD7A 4POBA 1K3OA 1K0OA 1Z6MA 4L0UA 1YF1A 2PVQA 2WDUA 1G6WA 1XPVA 2LJRA 4FYCA 3QPMA 3WYWA 1PFOA 3GNJA 4OO5A 3DGQA 4IKHA 6GSXA 4I2UA 1GTBA 4KE3A 2J9HA 3ZVJD 1B48A 1GSUA 2GDRA 1MD3A 5DJLA 2JZSA 1A8LA 1XOBA 4RQRA 4MPFA 2PWJA 3RHBA 2V6OA 2ZNMA 3WT1A 5ID2A 1Z3EA 2VCVA 4XRDA 1THXA 5KN3A 3LSZA 2H8LA 2B3SA 3KCMA 18GSA 2FA4A 4I2TA 1DBYA 2KHPA 3UEMA 1GTUA 2MBTA 2GGTA 5ECRB 2HSHA 3IHQA 3MIXA 2H73A 3VPTA 2B7KA 3TKPA 3FHKA 3TOUA 4WBJA 2REMA 1OC9A 4N0VA 2RIIA 1TK8B 2X8GA 2XPDA 3GHAA 2WRTA 1TJDA 1PD21 2X64A 1B9YC 1ST9A 2N5AA 1PSQA 2MYGA 4ZL9A 3J7Yb 4JR4A 3HJPA 3VWUA 1EGRA 1XWAA 1V40A 2OJLA 1EP8A 4PGTA 3L9UA 1YF0A 4GSSA 5AIXA 5C00A 1N2AA 5COHA 5ECPB 4AGSA 5IMAA 1TP9A 2ZUPA 4KB3A 5G5EA 4XHMA 5E4WA 2QA1A 2LRCA 3LQ7A 5IMVA 5HR0A 2C1YA 3RDWA 2HZEB 4Z2UA 3QOUA 2PUKC 1JZDA 1ERVA 1Y25A 2V41A 2WFCA 4MA9A 1PKWA 2AV4A 4IVFA 1VGLA 4MDCA 4TR3A 1O8XA 1O73A 1OAZA 1J08A 2AHEA 5DAKB 2Z9SA 4EUYA 5EVOA 3TJGA 1PGTA 1FW1A 3TOTA 3IR4A 2HXKA 1OE8A 1AXDA 5ELAA 5HFIA 1Z9HA 1XWCA 2CAQA 3C1SA 2H1AA 2YOIA 2E7PA 3IOSA 4POKA 3VI7A 3O76A 5IMFA 1O6JA 1ZYPA 2OADA 6GSYA 3KEBA 2WJUA 1U87A 5C04A 3UJ1A 4K1FA 4Q5FA 4MJCA 2J23A 1QFNA 1V57A 1TOFA 2JZRA 1PX7A 5ECOB 5B8AA 2A2RA 5IMCA 1X9MB 1AIUA 14GSA 2GT5A 2FWGA 4DEJA 3QFAC 22GSA 4YQMA 2PERA 4BA7A 3KJYA 4L5OA 2LUSA 3H1NA 4N0ZA 4F82A 2C0GA 4EO3A 1WOUA 1XWGA 2TIRA 3G7YA 3GH9A 4L5LA 2V1MA 2VAFA 3FZ9A 2K8VA 3D4TA 1ERTA 3US3A 1X5CA 4MH3A 5IPGA 2UZ8A 1S3DA 3FEUA 3RAZA 3MDKA 2JADA 4LA1A 3D4MA 1FB6A 4OWYA 1SKRB 2YWMA 5DCHA 2CAIA 2GT6A 4FIWA 2CZ3A 2XC2A 2XHFA 4G0LA 4KF9A 4EE0A 2C4JA 4CY6A 3HJOA 3QDNA 3EVIA 2GSTA 1M7TA 2VLTA 2YZUA 4KX4A 3RHCA 3GKNA 1TRSA 2HFDA 5B6NA 3SWLA 2EC4A 1TI3A 1YY7A 5DDLA 3ZRDA 4AJ6A 2DIZA 4CY8A 1JZRA 3A3TA 4WR5A 5F07A 3FZ4A 1DUGA 2QSIA 4KW6A 1ABAA 1X9WB 2LQOA 2O85A 1FO5A 4DVCA 1XWKA 5EL8A 3D0ZA 1HNAA 4JU5A 4K7OA 3WGXA 17GSA 2H1GA 3LG6A 4MZWA 4IP1A 5H5RA 4JBBA 3C73A 1Q98A 1K3YA 1Z6NA 4GCIA 3L9SA 3BD2A 2VL3A 4GQFA 2HRNA 3DRNA 4ILFA 5G30A 1DSBA 3GA4A 1M2AA 3EMXA 5J9BA 5AISA 2K18A 2YWIA 2A4VA 1EOGA 5F8BA 1LBKA 2LJAA 4PTSA 2FCHA 3L4NA 4BL7A 4G0IA 1G6YA 4X0XA 5KN2A 4MCUA 2JACA 1SK2A 1PL2A 3Q19A 1SL0B 3DMLA 2LNSA 3CBUA 3GN3A 4HZ2A 5ECIB 4OFMA 1VF1A 1C72A 1K0AA 3AY8A 1WRYA 1XW6A 3GRXA 1M99A 3EINA 4EDZA 1O85A 2NBSA 4HU9A 1JLWA 2VL9A 4KCAA 3Q6OA 2OACA 4AJ8A 2DC5A 3QAGA 3EC3A 4O5QA 2OE1A 4USSA 3TKQA 4EDYA 2GZPA 2NDOA 3APOA 5B6MA 1PKZA 2DSAA 4ULXA 3M9JA 1AQWA 4EXJA 2HI7A 1NHYA 1FVJA 3UAPA 5DBQA 1Y6EA 4NWYA 2L6CA 2DIYA 1K0NA 1F6MC 4PUAA 1WMJA 4IW9A 1GLQA 3FR3A 4NXIA 4F2IA 3ERFA 4BVYB 2GSRA 2L5LA 4F0BA 4MLYA 4ACSA 2WB9A 1K0DA 3ZTLA 3GTUA 2I3YA 4ZXGA 1EEMA 1YJ6A 4FQUA 1ACVA 2O7KA 5IOXA 4E8EA 1M0UA 2C3TA 2V32A 2KUCA 1K0CA 3PGTA 1TRWA 2HNLA 4K8MA 5FT3A 3CXGA 5IM9A 2CT6A 3LFLA 4TXOA 3K8NA 4HSCX 5BMUA 2NTOA 4PURA 3P7XA 1YEXA 1KNGA 1EV9A 1XBSA 3C1RA 2NPBA 1VF3A 2DBCA 2YV7A 3QCPA 1SJIA 3HA9A 2VLVA 4F0CA 4K2DA 2H6ZA 2D2ZA 2H6YA 2R37A 2LEGA 2OE3A 2RM6A 2LS5A 2TRXA 3CYNA 5GAND 2B1LA 2DKHA 1B4QA 2GQKA 2YPMA 1H75A 1F37A 2AAWA 2YWNA 4J57E 2ES7A 2C3NA 1GSYA 3FMWA 3TJBA 1GL8A 2IJYA 1K0MA 3O6TA 4IQ1A 4HUAA 2FWFA 2IMIA 4ISDA 1Z7RA 3ZMKA 4GSNA 2IWTA 4AJ7A 4ZB6A 3EWLA 1X5EA 2CVKA 4GLTA 1A2MA 4KUNA 3QR6A 1MTCA 2NVLA 4BVXA 1GP1A 1AQVA 1ZMAA 3ME8A 1GUMA 4LLRA 1ZGNA 4PQHA 3U6VA 3IHGA 2X49A 2HLSA 4WKWA 3PR8A 1SK0A 4TOPA 4HDEA 1GSSA 2XPEA 5CP1A 4OO4A 3F4RA 2IMFA 1JFUA 2PVOC 3EYTA 1TKDB 2H71A 1JHBA 2O87A 3MSZA 1B9XC 3ZLPA 1WIKA 4WF4A 3VWXA 3D5JA 2IL3A 1GNWA 5DALA 1R5AA 3ZREA 4WR4A 4GQCA 4Q5NA 10GSA 1THOA 5JWQB 2BMXA 4QL7A 5L71A 2M72A 3EU4A 3IRAA 3DVXA 1B4PA 1XCCA 4BWQA 1F9MA 3M1GA 2IN3A 1RW1A 2EIRA 1NSWA 2JL4A 4YQVA 3F0IA 1QQ2A 3ZZXA 11GSA 2LV3A 1FOHA 2H66A 4MP4A 2CZ2A 5DAKA 3ZFBA 3HXSA 5HR3A 1FG4A 4GF0A 4O5UA 5CNWA 19GSA 3TJFA 3GL5A 3M8NA 2B6MA 4CHSA 6GSUA 2LRNA 1K0BA 3UIWA 1MDIA 6GSSA 4ECCA 2IFQA 1YDKA 3JCML 4PNGA 5D9VA 4ML1A 1BEDA 2X8CA 5JWRB 4EF0A 1WP0A 4ZL8A 5D9TA 1W89A 3HVXA 4MPGA 4X43A 3VI5A 4Q5RA 2CV4A 4J56E 1BQ7A 1X5DA 3NIVA 2JSZA 2JSYA 2H19A 2QGVA 5G1LA 2K8SA 4LMVA 5JCWA 3VURA 3D21A 4DSQA 4D73B 2IMDA 4H86A 3BOAA 1GRXA 4KDXA 1CQGA 5F06A 1SENA 1ERWA 1U88A 1PN9A 3E9JB 1T4ZA 3W6GA 3QFBC 4O7HA 4BPYA 1FVKA 1PRXA 1OVNA 2QKEA 5DCGA 1O7UA 3HY2A 5ID2B 3NOFA 1PN0A 1ON4A 1A2LA 1AUCA 4ID0A 2GQMA 5IMDA 3P8WA 2HE3A 1DE1A 5ECQB
chains in the Genus database with same CATH topology
3EURA 3GSTA 4F03A 1U3AA 4PX1A 4WETA 2HRFA 2H6XA 5EPFA 3MAKA 1YZXA 1VF2A 3R3EA 2HYXA 4PXOA 2R0PA 4TRXA 1AQXA 2VL2A 1VRSD 5B7CA 2DJKA 3A5WA 1XFLA 2I4AA 2AB6A 1EV4A 4K5SA 4MMMA 4YQUA 4XCSA 3MWHA 2OE0A 1YKCA 1GSDA 1ILOA 1R5PA 3I6AA 4K9ZA 1K3LA 5G2ZA 2DLXA 3I69A 4GWRA 4TVEA 3A2WA 2FHEA 2WULA 4QL9A 5G1KA 4X4JA 2C0FA 3M3MA 3TCOA 1JZOA 13GSA 4TR0A 2YWOA 4Z2TA 2KOKA 5IO2A 3N5OA 2FGXA 3QAWA 3KH7A 4ZB9A 2H70A 5ECHB 2FD3A 1IYHA 5ECLB 5JWOB 1GSFA 2YNXA 4LL1B 4IS0A 1U6TA 1XVQA 3F63A 2C0EA 4G0KA 1TK5B 4MF7A 5AGYA 4TR1A 3FR6A 4EKZA 3CRTA 20GSA 3L0HA 3LJRA 1H4OA 4IBPA 5A4WA 4HU7A 2V6KA 1E6BA 1SD9A 3HVVA 3F4TA 3FYGA 3VPQA 4IN0A 2RUFA 4JRRA 1ML6A 3F3QA 5ENUA 4WF5A 5LNKe 2X4AA 4EIQA 5DQSA 4WBRD 4RQXA 2V2GA 2YJ7A 4HOJA 4KNDA 1GNEA 2P31A 5D9XA 1WJKA 1A0RP 4JE1A 2R2JA 1BAYA 1OYJA 4LL4B 3GFKA 2H72A 2OBIA 4I8BA 5J9CA 5ECKB 3IDVA 3BJ5A 2RM5A 4HI7A 1MEKA 2DMLA 4I97A 2XBQA 1DE2A 1NW2A 5H5SA 1AW9A 2H1BA 2CVDA 3HJMA 1XWBA 3TRXA 3ZFLA 1AAZA 5F05A 3TDGA 2CA8A 4BVYA 1ZYNA 1HNCA 5KN1A 4KSOA 4HQSA 2LSTA 5A5KA 4TW5A 2HRKA 5IIZA 1SL2B 4XRAA 5FWGA 5AN1A 2E2MA 1LJRA 2GSSA 3BBYA 3FY7A 4XIHA 4MJEA 1F3AA 1PA3A 6GSVA 3EU3A 3KP8A 4ML6A 1O8WA 5J3RA 2YN1A 4HS1A 4XS4A 2VO4A 2PMTA 1GSQA 3Q18A 1RQMA 5CRHA 3FR9A 1IYIA 1QK8A 3G9BA 1WWJA 3QAVA 4KDUA 3KGKA 3HKRA 3EPTA 1W4VA 3IA1A 3TKSA 2L6DA 4EIPA 2LRTA 2FY6A 3IK7A 1HYUA 4O92A 4G9HA 1PX6A 2AJQB 2B5YA 5KOXA 1I9DA 4V1Ag 1TI1A 3H4KA 1WPIA 2CVBA 2R6KA 3LORA 1V58A 4NAXA 4JEDA 2H0IA 8GSSA 4LMWA 4DSSA 3VLNA 3WGEA 2KP1A 1FHEA 2YANA 3F3RA 4OCEA 1MDKA 3DIEA 2O8VB 5KN0A 3F9UA 3TRQA 4ECBA 1UN2A 5GAPD 1SL1B 1ERUA 2PU9C 1R7HA 5CRDA 3VWWA 1GUHA 3IAM2 2E2GA 1MD4A 1TRUA 2LKUA 2I1UA 1TU7A 4KGIA 4F9ZA 5F0GA 1EZKA 3J7Yk 2QC7A 3GIXA 4EC0A 3V1WA 5ECNB 2I81A 4CDOA 3Q74A 2YJHA 5HQPA 2MBSA 2H0HA 5INYA 3QD9A 4PNFA 3WGDA 2DKIA 2OA7A 3ISOA 2B5XA 4IHUA 3G7IA 3C71A 3C8EA 5ECMB 2N5BA 1V2AA 4I6XA 1XVWA 4OCFA 2FA8A 5GSTA 3IC8A 2MMNA 3ERGA 2VCZA 3APSA 3IV4A 4E8HA 4MH2A 3WD6A 3BCIA 5ECSA 2X99A 1VF4A 4YKFA 3GKMA 4ZB8A 3KH9A 3UMAA 4ICYA 2VM2A 2IPAA 5BRTA 3GUSA 1GULA 5HFGA 3KP9A 1T8EB 2BJXA 5CAXA 2I9HA 2ZCTA 3H8QA 2F8FA 2IIYA 1A24A 3A5IA 3DXBA 4L8EA 2CX4A 1EGOA 2EIOA 3SBCA 2C80A 3RPNA 2VUPA 2HSYA 5ABRA 3S9FA 2ALBA 3ED3A 3VWVA 3KTLA 4MABA 1GTAA 5HR2A 9GSSA 1TTZA 4EVMA 2HZEA 1ZOFA 4V2NA 3GH6A 4D73A 3GSSA 3DEXA 2VIMA 3I43A 2MMZA 1FAAA 3DYRA 4TXOB 1FB0A 1Z7PA 4HJMA 4OFTA 4OFNA 4POMA 3KXOA 4MF6A 3KIJA 2BTOT 1UA5A 3ZYWA 2GTUA 3UVHA 3P2AA 1V9WA 2FLSA 3HDCA 2L57A 3HYPA 4RI6A 2N5FA 4I5QA 1CQHA 4K7IA 4PQIA 5AIVA 2WCIA 1XIYA 2PPTA 1OC8A 4GSTA 3ERWA 4OMVA 2TRCP 1BYEA 5IQYA 3HZ8A 5IMZA 3FKFA 1EWXA 4V2MA 3ME7A 4YAPA 3TJJA 1SYXA 1SU9A 4GXZA 3DKSA 2QA2A 3IE3A 3LYPA 5HFKA 3MNGA 2G0FA 1BG5A 4MZCA 2P5QA 3FZ5A 3OR5A 2R5GA 5CRGA 1ZZYA 4BVXB 3IAS2 1G7OA 4TR4A 3CSIA 1T00A 2H01A 3DVWA 2DJJA 6GSTA 2LJKA 2C0DA 3RPPA 4K7NA 2O89A 4ECIA 1QXHA 2P5RA 3HD5A 4Z7XA 1GWCA 1XXUA 4NHWA 3LEFA 4NMUA 5DALB 4KCEA 3LGCA 3IPZA 1GSEA 2GSQA 2WS2A 4TN8A 1TXXA 1TK0B 3GMFA 3P90A 1GLPA 5D73A 4POLA 1SKWB 2F3MA 2KP2A 4BWSA 1ZYQB 1ZYEA 3IC4A 5EY6A 5DJMA 4K5RA 4K0GA 2DJ3A 4P3YB 1GTIA 2YZHA 3PINA 3GKXA 3A2VA 2H1DA 4PUFC 3FK8A 2B7JA 4G2EA 3TJKA 5IPHA 2OKAA 3UL3A 1OC9B 1T3BA 4ZIJA 1HQOA 4GTUA 1TDIA 4K2XA 3F4SA 2IFQB 3ZIVA 3PPUA 4ZBAA 3ZITA 1X9SB 4FYBA 3GURA 1HNBA 4WXTA 1GUKA 2A2SA 3CMIA 3HHVA 4K6XA 3UBLA 3GX8A 6GSWA 5D93A 3TGZA 2AYTA 2AUVA 1YEPA 2GVPA 4NPBA 1M9AA 1O81A 1RK4A 2VLUA 5CRWA 3PH9A 1BJXA 3TB2A 2IMKA 2VL2C 2ON7A 4CW9A 1XW9A 2A2PA 3W8SA 3CTFA 2K6VA 1SJZA 4JZQA 12GSA 4KSMA 3TUEA 4RI7A 4IGJA 3D6IA 2VCXA 4TXVA 4ZILA 4KH7A 1OC3A 4G19A 3WT2A 1USBA 5FHIA 1QGVA 2L59A 2H76A 3I9V2 4MJBA 1UVZA 4YKGA 3APQA 5B8BA 3GYKA 1EEJA 1PQNA 1SK1A 3QMXA 2R0CA 4AF2A 2PGTA 3GKKA 1YQ1A 2GLRA 2HSMA 4XTSA 3UBKA 1NM3A 1A2JA 2M80A 1URMA 5G31A 2GZYA 1YKAA 2B5EA 3GV1A 2JU5A 4N10A 1T1VA 2VCQA 3EE2A 5J41A 3LYKA 2VD0A 3F6FA 1J0FA 4MNNA 2K9FA 4YH2A 1A8YA 2RLIA 4MZBA 2DJ0A 4G10A 4XS6A 5LD0A 4NV5A 5CREA 2JZTA 1EOHA 1SKSB 1F2EA 2LNTA 3H79A 3TRPA 3R2QA 3HCZA 1WE0A 3NZNA 2FWHA 4MK3A 4N11A 5D9WA 2ON5A 3ZVJA 4L0WA 3KTBA 2RUEA 4WEYA 3KZQA 4YAVA 1M9BA 5J4UA 3A2XA 3CTGA 5D96A 2L4CA 4J2FA 3CRUA 3FRCA 1M2BA 5JCUA 3H93A 1UC7A 2LTKA 2MMOA 3VK9A 4KA0A 2EIQA 3L9VA 5A4VA 1PMTA 2FNOA 3DWVA 4V2LA 3DD3A 2HRAA 4PQ1A 4IJIA 2C3QA 3KD0A 1KBNA 3N9JA 1A0FA 4TKYA 4EL1A 1AC1A 16GSA 5HR1A 3M9KA 2PN8A 2YV9A 1XW5A 3RBTA 2GQLA 3BCKA 1QUWA 2DJ2A 3FW2A 2H30A 2YCDA 1BX9A 4NV2A 3FZAA 4FO5A 2CQ9A 4K0NA 2HT9A 1JLVA 2KLXA 3ZMLA 1E2YA 2VD1A 5A4UA 1EP7A 5H5QA 2WZ9A 2L4QA 1F3BA 1N8JA 1X0RA 4TR1B 3LXZA 4X1UA 4DSRA 2G2QA 1OKDA 2MZCA 4IELA 3U5RE 1G0TA 1XZOA 3E0UA 1PL1A 4NHZA 1Q4JA 2VOCA 1KTEA 1LU4A 3IXRA 4XS1A 2CX3A 3G7JA 5DQYA 1M2DA 3KMNA 3LXTA 2H75A 3W8JA 4KDYA 1J9BA 2H0GA 4N30A 3TKRA 2OBKA 1R26A 2PBJA 2R0GA 3TKSC 4O5RA 2F8AA 4A5PA 1XOAA 3HVSA 4QQ7A 4KAEA 3LW9A 3O3TA 2R3XA 2M46A 3IK9A 1MDJA 3ZL5A 1I5GA 2H74A 1HD2A 1S3CA 5G5FA 3GX0A 5KOWA 2MMAA 4HEA2 4HJ2A 1T7PB 1JZWA 1KEBA 4IQAA 2HZFA 3IBHA 4ZL7A 3LWAA 1ZL9A 4BL7B 1SJ6A 5KEJA 1TU8A 5JCGA 3UOMA 5DVBA 5IOWA 4GRFA 2GZZA 3L78A 1U3IA 2R4VA 4FH8A 4V1Ap 3HZ4A 3VFIA 3E3EA 2LQQA 5IO0A 3M0FA 1A23A 4Z2RA 2P0GA 3EMPA 2FUG2 2F9SA 1OE7A 4O32A 3UARA 4MF5A 1SD8A 3CSJA 5LCZA 1SYRA 1Z5YE 2L5OA 3D22A 4FYUA 4XS4B 2WGRA 4HZ4A 2VM1A 1B8XA 2YP6A 1S3AA 2A4HA 3F6DA 1QMVA 3KMOA 5CYYA 1TRVA 4IP6A 1G7EA 2XBIA 3GL3A 2X8HA 5CO3A 5GZZB 3MYDA 4HQZA 1R4WA 4ZBDA 2C8UA 2GS3A 4IJ3A 1T4YA 2F51A 4JR6A 3CSHA 2DMMA 1FOVA 2VCTA 1NHOA 3C7MA 3UVTA 7GSSA 4DSSB 1OKTA 3ZIJA 5D8IA 4ZBBA 2DJ1A 3TKSE 5E59A 1V98A 4Q5QA 5ELGA 4MJAA 4RUVA 2B1KA 3F8UA 1TW9A 3GTUB 2VCWA 3KM6A 2IMEA 5J5NA 2E0QA 4ECJA 1ZCPA 2FWEA 1GH2A 5GSSA 4OD7A 4POBA 1K3OA 1K0OA 1Z6MA 4L0UA 1YF1A 2PVQA 2WDUA 1G6WA 1XPVA 2LJRA 4FYCA 3QPMA 3WYWA 3GNJA 4OO5A 3DGQA 4IKHA 6GSXA 4I2UA 1GTBA 4KE3A 2J9HA 3ZVJD 1B48A 1GSUA 2GDRA 1MD3A 5DJLA 2JZSA 1A8LA 1XOBA 4RQRA 4MPFA 2PWJA 3RHBA 2V6OA 2ZNMA 3WT1A 5ID2A 1Z3EA 2VCVA 4XRDA 1THXA 5KN3A 3LSZA 2H8LA 2B3SA 3KCMA 18GSA 2FA4A 4I2TA 1DBYA 2KHPA 3UEMA 1GTUA 2MBTA 2GGTA 5ECRB 2HSHA 3IHQA 3MIXA 2H73A 3VPTA 2B7KA 3TKPA 3FHKA 3TOUA 4WBJA 2REMA 1OC9A 4N0VA 2RIIA 1TK8B 2X8GA 2XPDA 3GHAA 2WRTA 1TJDA 1PD21 2X64A 1B9YC 1ST9A 2N5AA 1PSQA 2MYGA 4ZL9A 3J7Yb 4JR4A 3HJPA 3VWUA 1EGRA 1XWAA 1V40A 2OJLA 1EP8A 4PGTA 3L9UA 1YF0A 4GSSA 5AIXA 5C00A 1N2AA 5COHA 5ECPB 4AGSA 5IMAA 1TP9A 2ZUPA 4KB3A 5G5EA 4XHMA 5E4WA 2QA1A 2LRCA 3LQ7A 5IMVA 5HR0A 2C1YA 3RDWA 2HZEB 4Z2UA 3QOUA 2PUKC 1JZDA 1ERVA 1Y25A 2V41A 2WFCA 4MA9A 1PKWA 2AV4A 4IVFA 1VGLA 4MDCA 4TR3A 1O8XA 1O73A 1OAZA 1J08A 2AHEA 5DAKB 2Z9SA 4EUYA 5EVOA 3TJGA 1PGTA 1FW1A 3TOTA 3IR4A 2HXKA 1OE8A 1AXDA 5ELAA 5HFIA 1Z9HA 1XWCA 2CAQA 3C1SA 2H1AA 2YOIA 2E7PA 3IOSA 4POKA 3VI7A 3O76A 5IMFA 1O6JA 1ZYPA 2OADA 6GSYA 3KEBA 2WJUA 1U87A 5C04A 3UJ1A 4K1FA 4Q5FA 4MJCA 2J23A 1QFNA 1V57A 1TOFA 2JZRA 1PX7A 5ECOB 5B8AA 2A2RA 5IMCA 1X9MB 1AIUA 14GSA 2GT5A 2FWGA 4DEJA 3QFAC 22GSA 4YQMA 2PERA 4BA7A 3KJYA 4L5OA 2LUSA 3H1NA 4N0ZA 4F82A 2C0GA 4EO3A 1WOUA 1XWGA 2TIRA 3G7YA 3GH9A 4L5LA 2V1MA 2VAFA 3FZ9A 2K8VA 3D4TA 1ERTA 3US3A 1X5CA 4MH3A 5IPGA 2UZ8A 1S3DA 3FEUA 3RAZA 3MDKA 2JADA 4LA1A 3D4MA 1FB6A 4OWYA 1SKRB 2YWMA 5DCHA 2CAIA 2GT6A 4FIWA 2CZ3A 2XC2A 2XHFA 4G0LA 4KF9A 4EE0A 2C4JA 4CY6A 3HJOA 3QDNA 3EVIA 2GSTA 1M7TA 2VLTA 2YZUA 4KX4A 3RHCA 3GKNA 1TRSA 2HFDA 5B6NA 3SWLA 2EC4A 1TI3A 1YY7A 5DDLA 3ZRDA 4AJ6A 2DIZA 4CY8A 1JZRA 3A3TA 4WR5A 5F07A 3FZ4A 1DUGA 2QSIA 4KW6A 1ABAA 1X9WB 2LQOA 2O85A 1FO5A 4DVCA 1XWKA 5EL8A 3D0ZA 1HNAA 4JU5A 4K7OA 3WGXA 17GSA 2H1GA 3LG6A 4MZWA 4IP1A 5H5RA 4JBBA 3C73A 1Q98A 1K3YA 1Z6NA 4GCIA 3L9SA 3BD2A 2VL3A 4GQFA 2HRNA 3DRNA 4ILFA 5G30A 1DSBA 3GA4A 1M2AA 3EMXA 5J9BA 5AISA 2K18A 2YWIA 2A4VA 1EOGA 5F8BA 1LBKA 2LJAA 4PTSA 2FCHA 3L4NA 4BL7A 4G0IA 1G6YA 4X0XA 5KN2A 4MCUA 2JACA 1SK2A 1PL2A 3Q19A 1SL0B 3DMLA 2LNSA 3CBUA 3GN3A 4HZ2A 5ECIB 4OFMA 1VF1A 1C72A 1K0AA 3AY8A 1WRYA 1XW6A 3GRXA 1M99A 3EINA 4EDZA 1O85A 2NBSA 4HU9A 1JLWA 2VL9A 4KCAA 3Q6OA 2OACA 4AJ8A 2DC5A 3QAGA 3EC3A 4O5QA 2OE1A 4USSA 3TKQA 4EDYA 2GZPA 2NDOA 3APOA 5B6MA 1PKZA 2DSAA 4ULXA 3M9JA 1AQWA 4EXJA 2HI7A 1NHYA 1FVJA 3UAPA 5DBQA 1Y6EA 4NWYA 2L6CA 2DIYA 1K0NA 1F6MC 4PUAA 1WMJA 4IW9A 1GLQA 3FR3A 4NXIA 4F2IA 3ERFA 4BVYB 2GSRA 2L5LA 4F0BA 4MLYA 4ACSA 2WB9A 1K0DA 3ZTLA 3GTUA 2I3YA 4ZXGA 1EEMA 1YJ6A 4FQUA 1ACVA 2O7KA 5IOXA 4E8EA 1M0UA 2C3TA 2V32A 2KUCA 1K0CA 3PGTA 1TRWA 2HNLA 4K8MA 5FT3A 3CXGA 5IM9A 2CT6A 3LFLA 4TXOA 3K8NA 5BMUA 2NTOA 4PURA 3P7XA 1YEXA 1KNGA 1EV9A 1XBSA 3C1RA 2NPBA 1VF3A 2DBCA 2YV7A 3QCPA 1SJIA 3HA9A 2VLVA 4F0CA 4K2DA 2H6ZA 2D2ZA 2H6YA 2R37A 2LEGA 2OE3A 2RM6A 2LS5A 2TRXA 3CYNA 5GAND 2B1LA 2DKHA 1B4QA 2GQKA 2YPMA 1H75A 1F37A 2AAWA 2YWNA 4J57E 2ES7A 2C3NA 1GSYA 3FMWA 3TJBA 1GL8A 2IJYA 1K0MA 3O6TA 4IQ1A 4HUAA 2FWFA 2IMIA 4ISDA 1Z7RA 3ZMKA 4GSNA 2IWTA 4AJ7A 4ZB6A 3EWLA 1X5EA 2CVKA 4GLTA 1A2MA 4KUNA 3QR6A 1MTCA 2NVLA 4BVXA 1GP1A 1AQVA 1ZMAA 3ME8A 1GUMA 4LLRA 1ZGNA 4PQHA 3U6VA 3IHGA 2X49A 2HLSA 4WKWA 3PR8A 1SK0A 4TOPA 4HDEA 1GSSA 2XPEA 5CP1A 4OO4A 3F4RA 2IMFA 1JFUA 2PVOC 3EYTA 1TKDB 2H71A 1JHBA 2O87A 3MSZA 1B9XC 3ZLPA 1WIKA 4WF4A 3VWXA 3D5JA 2IL3A 1GNWA 5DALA 1R5AA 3ZREA 4WR4A 4GQCA 4Q5NA 10GSA 1THOA 5JWQB 2BMXA 4QL7A 5L71A 2M72A 3EU4A 3IRAA 3DVXA 1B4PA 1XCCA 4BWQA 1F9MA 3M1GA 2IN3A 1RW1A 2EIRA 1NSWA 2JL4A 4YQVA 3F0IA 1QQ2A 3ZZXA 11GSA 2LV3A 1FOHA 2H66A 4MP4A 2CZ2A 5DAKA 3ZFBA 3HXSA 5HR3A 1FG4A 4GF0A 4O5UA 5CNWA 19GSA 3TJFA 3GL5A 3M8NA 2B6MA 4CHSA 6GSUA 2LRNA 1K0BA 3UIWA 1MDIA 6GSSA 4ECCA 2IFQA 1YDKA 3JCML 4PNGA 5D9VA 4ML1A 1BEDA 2X8CA 5JWRB 4EF0A 1WP0A 4ZL8A 5D9TA 1W89A 3HVXA 4MPGA 4X43A 3VI5A 4Q5RA 2CV4A 4J56E 1BQ7A 1X5DA 3NIVA 2JSZA 2JSYA 2H19A 2QGVA 5G1LA 2K8SA 4LMVA 5JCWA 3VURA 3D21A 4DSQA 4D73B 2IMDA 4H86A 3BOAA 1GRXA 4KDXA 1CQGA 5F06A 1SENA 1ERWA 1U88A 1PN9A 3E9JB 1T4ZA 3W6GA 3QFBC 4O7HA 4BPYA 1FVKA 1PRXA 1OVNA 2QKEA 5DCGA 1O7UA 3HY2A 5ID2B 3NOFA 1PN0A 1ON4A 1A2LA 1AUCA 4ID0A 2GQMA 5IMDA 3P8WA 2HE3A 1DE1A 5ECQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EUR A;  3GST A;  4F03 A;  1U3A A;  4PX1 A;  4WET A;  2HRF A;  2H6X A;  5EPF A;  3MAK A;  1YZX A;  1VF2 A;  2HYX A;  4PXO A;  4TRX A;  1AQX A;  2VL2 A;  1VRS D;  5B7C A;  2DJK A;  3A5W A;  1XFL A;  2I4A A;  2AB6 A;  1EV4 A;  4MMM A;  4YQU A;  4XCS A;  3MWH A;  2OE0 A;  1YKC A;  1GSD A;  1ILO A;  1R5P A;  3I6A A;  4K9Z A;  1K3L A;  5G2Z A;  2DLX A;  3I69 A;  4GWR A;  4TVE A;  3A2W A;  2FHE A;  2WUL A;  4QL9 A;  5G1K A;  2C0F A;  3M3M A;  3TCO A;  1JZO A;  13GS A;  4TR0 A;  2YWO A;  2KOK A;  5IO2 A;  3N5O A;  2FGX A;  3QAW A;  3KH7 A;  4ZB9 A;  2H70 A;  5ECH B;  2FD3 A;  1IYH A;  5ECL B;  5JWO B;  1GSF A;  2YNX A;  4LL1 B;  4IS0 A;  1U6T A;  1XVQ A;  3F63 A;  2C0E A;  1TK5 B;  4MF7 A;  5AGY A;  4TR1 A;  3FR6 A;  4EKZ A;  3CRT A;  20GS A;  3L0H A;  3LJR A;  1H4O A;  4IBP A;  5A4W A;  4HU7 A;  2V6K A;  1E6B A;  1SD9 A;  3HVV A;  3F4T A;  3FYG A;  3VPQ A;  4IN0 A;  2RUF A;  4JRR A;  1ML6 A;  3F3Q A;  5ENU A;  4WF5 A;  5LNK e;  5DQS A;  4WBR D;  4RQX A;  2V2G A;  2YJ7 A;  4HOJ A;  4KND A;  1GNE A;  2P31 A;  5D9X A;  1WJK A;  1A0R P;  4JE1 A;  2R2J A;  1BAY A;  1OYJ A;  4LL4 B;  3GFK A;  2H72 A;  2OBI A;  4I8B A;  5J9C A;  5ECK B;  3IDV A;  3BJ5 A;  2RM5 A;  4HI7 A;  1MEK A;  2DML A;  4I97 A;  2XBQ A;  1DE2 A;  1NW2 A;  5H5S A;  1AW9 A;  2H1B A;  2CVD A;  3HJM A;  1XWB A;  3TRX A;  3ZFL A;  1AAZ A;  5F05 A;  3TDG A;  2CA8 A;  4BVY A;  1HNC A;  5KN1 A;  4HQS A;  4KSO A;  2LST A;  5A5K A;  4TW5 A;  5IIZ A;  1SL2 B;  4XRA A;  5FWG A;  5AN1 A;  2E2M A;  1LJR A;  2GSS A;  3BBY A;  3FY7 A;  4XIH A;  4MJE A;  1F3A A;  1PA3 A;  6GSV A;  3EU3 A;  3KP8 A;  4ML6 A;  1O8W A;  5J3R A;  2YN1 A;  4HS1 A;  4XS4 A;  2VO4 A;  2PMT A;  1GSQ A;  3Q18 A;  1RQM A;  5CRH A;  3FR9 A;  1IYI A;  1QK8 A;  3G9B A;  1WWJ A;  3QAV A;  4KDU A;  3KGK A;  3HKR A;  1W4V A;  3IA1 A;  3TKS A;  2L6D A;  2LRT A;  2FY6 A;  3IK7 A;  1HYU A;  4O92 A;  4G9H A;  1PX6 A;  2AJQ B;  2B5Y A;  1I9D A;  4V1A g;  1TI1 A;  3H4K A;  1WPI A;  2CVB A;  2R6K A;  3LOR A;  1V58 A;  4NAX A;  4JED A;  2H0I A;  8GSS A;  4LMW A;  4DSS A;  3VLN A;  3WGE A;  2KP1 A;  1FHE A;  2YAN A;  3F3R A;  4OCE A;  1MDK A;  3DIE A;  2O8V B;  5KN0 A;  3F9U A;  3TRQ A;  4ECB A;  1UN2 A;  5GAP D;  1SL1 B;  1ERU A;  2PU9 C;  1R7H A;  5CRD A;  3VWW A;  1GUH A;  3IAM 2;  2E2G A;  1MD4 A;  1TRU A;  2LKU A;  2I1U A;  1TU7 A;  4KGI A;  4F9Z A;  5F0G A;  1EZK A;  3J7Y k;  2QC7 A;  3GIX A;  4EC0 A;  3V1W A;  5ECN B;  2I81 A;  4CDO A;  3Q74 A;  2YJH A;  5HQP A;  2MBS A;  2H0H A;  5INY A;  3QD9 A;  4PNF A;  3WGD A;  2OA7 A;  3ISO A;  2B5X A;  4IHU A;  3G7I A;  3C71 A;  3C8E A;  5ECM B;  2N5B A;  1V2A A;  4I6X A;  1XVW A;  4OCF A;  2FA8 A;  5GST A;  2MMN A;  3ERG A;  2VCZ A;  3APS A;  3IV4 A;  4E8H A;  4MH2 A;  3WD6 A;  3BCI A;  5ECS A;  2X99 A;  1VF4 A;  3GKM A;  4ZB8 A;  3KH9 A;  3UMA A;  2VM2 A;  2IPA A;  3GUS A;  1GUL A;  5HFG A;  3KP9 A;  1T8E B;  2BJX A;  5CAX A;  2I9H A;  2ZCT A;  3H8Q A;  2F8F A;  2IIY A;  1A24 A;  3DXB A;  4L8E A;  2CX4 A;  1EGO A;  2EIO A;  3SBC A;  2C80 A;  3RPN A;  2VUP A;  2HSY A;  5ABR A;  3S9F A;  2ALB A;  3ED3 A;  3VWV A;  3KTL A;  4MAB A;  1GTA A;  5HR2 A;  9GSS A;  1TTZ A;  4EVM A;  2HZE A;  1ZOF A;  4V2N A;  3GH6 A;  4D73 A;  3GSS A;  3DEX A;  2VIM A;  3I43 A;  2MMZ A;  1FAA A;  3DYR A;  4TXO B;  1FB0 A;  1Z7P A;  4HJM A;  4OFT A;  4OFN A;  4POM A;  3KXO A;  4MF6 A;  3KIJ A;  2BTO T;  1UA5 A;  3ZYW A;  2GTU A;  3UVH A;  3P2A A;  1V9W A;  2FLS A;  3HDC A;  2L57 A;  3HYP A;  4RI6 A;  2N5F A;  4I5Q A;  1CQH A;  4K7I A;  4PQI A;  5AIV A;  2WCI A;  1XIY A;  2PPT A;  1OC8 A;  4GST A;  3ERW A;  4OMV A;  2TRC P;  1BYE A;  5IQY A;  3HZ8 A;  5IMZ A;  3FKF A;  1EWX A;  4V2M A;  3ME7 A;  4YAP A;  3TJJ A;  1SYX A;  1SU9 A;  4GXZ A;  3DKS A;  3IE3 A;  3LYP A;  5HFK A;  3MNG A;  2G0F A;  1BG5 A;  4MZC A;  2P5Q A;  3FZ5 A;  3OR5 A;  2R5G A;  5CRG A;  1ZZY A;  3IAS 2;  1G7O A;  4TR4 A;  3CSI A;  1T00 A;  2H01 A;  3DVW A;  2DJJ A;  6GST A;  2LJK A;  2C0D A;  3RPP A;  4K7N A;  2O89 A;  4ECI A;  1QXH A;  2P5R A;  3HD5 A;  4Z7X A;  1GWC A;  1XXU A;  4NHW A;  3LEF A;  4NMU A;  5DAL B;  4KCE A;  3LGC A;  3IPZ A;  1GSE A;  2GSQ A;  2WS2 A;  4TN8 A;  1TXX A;  1TK0 B;  3GMF A;  3P90 A;  1GLP A;  5D73 A;  4POL A;  1SKW B;  2F3M A;  2KP2 A;  4BWS A;  1ZYQ B;  1ZYE A;  3IC4 A;  5EY6 A;  5DJM A;  4K0G A;  2DJ3 A;  4P3Y B;  1GTI A;  2YZH A;  3PIN A;  3GKX A;  3A2V A;  2H1D A;  4PUF C;  3FK8 A;  2B7J A;  4G2E A;  3TJK A;  5IPH A;  2OKA A;  3UL3 A;  1OC9 B;  1T3B A;  4ZIJ A;  1HQO A;  4GTU A;  1TDI A;  3F4S A;  2IFQ B;  3ZIV A;  4ZBA A;  3ZIT A;  1X9S B;  4FYB A;  3GUR A;  1HNB A;  4WXT A;  1GUK A;  2A2S A;  3CMI A;  3HHV A;  4K6X A;  3UBL A;  3GX8 A;  6GSW A;  5D93 A;  3TGZ A;  2AYT A;  2AUV A;  1YEP A;  2GVP A;  4NPB A;  1M9A A;  1O81 A;  1RK4 A;  2VLU A;  5CRW A;  3PH9 A;  1BJX A;  3TB2 A;  2IMK A;  2VL2 C;  2ON7 A;  4CW9 A;  1XW9 A;  3W8S A;  3CTF A;  2K6V A;  1SJZ A;  4JZQ A;  12GS A;  4KSM A;  3TUE A;  4RI7 A;  4IGJ A;  3D6I A;  2VCX A;  4TXV A;  4ZIL A;  4KH7 A;  1OC3 A;  4G19 A;  3WT2 A;  1USB A;  5FHI A;  1QGV A;  2L59 A;  2H76 A;  3I9V 2;  4MJB A;  1UVZ A;  3APQ A;  5B8B A;  3GYK A;  1EEJ A;  1PQN A;  1SK1 A;  3QMX A;  4AF2 A;  2PGT A;  3GKK A;  1YQ1 A;  2GLR A;  4XTS A;  3UBK A;  1NM3 A;  1A2J A;  2M80 A;  1URM A;  5G31 A;  2GZY A;  1YKA A;  2B5E A;  3GV1 A;  2JU5 A;  4N10 A;  1T1V A;  2VCQ A;  3EE2 A;  5J41 A;  3LYK A;  2VD0 A;  3F6F A;  1J0F A;  2K9F A;  4YH2 A;  1A8Y A;  2RLI A;  4MZB A;  2DJ0 A;  4G10 A;  4XS6 A;  5LD0 A;  4NV5 A;  5CRE A;  2JZT A;  1EOH A;  1SKS B;  1F2E A;  2LNT A;  3H79 A;  3TRP A;  3R2Q A;  3HCZ A;  1WE0 A;  3NZN A;  2FWH A;  4MK3 A;  4N11 A;  5D9W A;  2ON5 A;  3ZVJ A;  4L0W A;  3KTB A;  2RUE A;  4WEY A;  3KZQ A;  4YAV A;  1M9B A;  5J4U A;  3A2X A;  3CTG A;  5D96 A;  2L4C A;  4J2F A;  3CRU A;  3FRC A;  1M2B A;  5JCU A;  3H93 A;  1UC7 A;  2LTK A;  2MMO A;  3VK9 A;  4KA0 A;  2EIQ A;  3L9V A;  5A4V A;  1PMT A;  2FNO A;  3DWV A;  4V2L A;  3DD3 A;  4PQ1 A;  4IJI A;  2C3Q A;  3KD0 A;  1KBN A;  3N9J A;  1A0F A;  4TKY A;  4EL1 A;  1AC1 A;  16GS A;  5HR1 A;  3M9K A;  2PN8 A;  2YV9 A;  1XW5 A;  3RBT A;  2GQL A;  3BCK A;  1QUW A;  2DJ2 A;  3FW2 A;  2H30 A;  2YCD A;  1BX9 A;  4NV2 A;  3FZA A;  4FO5 A;  2CQ9 A;  4K0N A;  2HT9 A;  1JLV A;  2KLX A;  3ZML A;  1E2Y A;  2VD1 A;  5A4U A;  1EP7 A;  5H5Q A;  2WZ9 A;  2L4Q A;  1F3B A;  1N8J A;  1X0R A;  4TR1 B;  3LXZ A;  4X1U A;  4DSR A;  2G2Q A;  1OKD A;  2MZC A;  4IEL A;  3U5R E;  1G0T A;  1XZO A;  3E0U A;  1PL1 A;  4NHZ A;  1Q4J A;  2VOC A;  1KTE A;  1LU4 A;  3IXR A;  4XS1 A;  2CX3 A;  3G7J A;  5DQY A;  1M2D A;  3KMN A;  3LXT A;  2H75 A;  3W8J A;  4KDY A;  1J9B A;  2H0G A;  4N30 A;  3TKR A;  2OBK A;  1R26 A;  2PBJ A;  3TKS C;  4O5R A;  2F8A A;  1XOA A;  3HVS A;  4QQ7 A;  4KAE A;  3O3T A;  2R3X A;  2M46 A;  3IK9 A;  1MDJ A;  3ZL5 A;  1I5G A;  2H74 A;  1HD2 A;  1S3C A;  5G5F A;  3GX0 A;  2MMA A;  4HEA 2;  4HJ2 A;  1T7P B;  1JZW A;  1KEB A;  4IQA A;  2HZF A;  3IBH A;  4ZL7 A;  3LWA A;  1ZL9 A;  1SJ6 A;  5KEJ A;  1TU8 A;  5JCG A;  3UOM A;  5DVB A;  5IOW A;  4GRF A;  2GZZ A;  3L78 A;  1U3I A;  2R4V A;  4FH8 A;  4V1A p;  3HZ4 A;  3VFI A;  3E3E A;  2LQQ A;  5IO0 A;  3M0F A;  1A23 A;  2P0G A;  3EMP A;  2FUG 2;  2F9S A;  1OE7 A;  4O32 A;  3UAR A;  4MF5 A;  1SD8 A;  3CSJ A;  5LCZ A;  1SYR A;  1Z5Y E;  2L5O A;  3D22 A;  4FYU A;  4XS4 B;  2WGR A;  4HZ4 A;  2VM1 A;  1B8X A;  2YP6 A;  1S3A A;  3F6D A;  1QMV A;  3KMO A;  5CYY A;  1TRV A;  4IP6 A;  1G7E A;  2XBI A;  3GL3 A;  2X8H A;  5CO3 A;  5GZZ B;  4HQZ A;  1R4W A;  4ZBD A;  2C8U A;  2GS3 A;  4IJ3 A;  1T4Y A;  2F51 A;  4JR6 A;  3CSH A;  2DMM A;  1FOV A;  2VCT A;  1NHO A;  3C7M A;  3UVT A;  7GSS A;  4DSS B;  1OKT A;  3ZIJ A;  5D8I A;  4ZBB A;  2DJ1 A;  3TKS E;  5E59 A;  1V98 A;  4Q5Q A;  5ELG A;  4MJA A;  4RUV A;  2B1K A;  3F8U A;  1TW9 A;  3GTU B;  2VCW A;  3KM6 A;  2IME A;  5J5N A;  2E0Q A;  4ECJ A;  1ZCP A;  2FWE A;  1GH2 A;  5GSS A;  4OD7 A;  4POB A;  1K3O A;  1K0O A;  1Z6M A;  4L0U A;  1YF1 A;  2PVQ A;  2WDU A;  1G6W A;  1XPV A;  2LJR A;  4FYC A;  3QPM A;  3WYW A;  3GNJ A;  4OO5 A;  3DGQ A;  4IKH A;  6GSX A;  4I2U A;  1GTB A;  4KE3 A;  2J9H A;  3ZVJ D;  1B48 A;  1GSU A;  2GDR A;  1MD3 A;  5DJL A;  2JZS A;  1A8L A;  1XOB A;  4RQR A;  4MPF A;  2PWJ A;  3RHB A;  2V6O A;  2ZNM A;  3WT1 A;  5ID2 A;  1Z3E A;  2VCV A;  4XRD A;  1THX A;  5KN3 A;  3LSZ A;  2H8L A;  2B3S A;  3KCM A;  18GS A;  2FA4 A;  4I2T A;  1DBY A;  2KHP A;  3UEM A;  1GTU A;  2MBT A;  2GGT A;  5ECR B;  2HSH A;  3IHQ A;  2H73 A;  3VPT A;  2B7K A;  3TKP A;  3FHK A;  3TOU A;  4WBJ A;  2REM A;  1OC9 A;  4N0V A;  2RII A;  1TK8 B;  2X8G A;  2XPD A;  3GHA A;  2WRT A;  1TJD A;  1PD2 1;  2X64 A;  1B9Y C;  1ST9 A;  2N5A A;  1PSQ A;  2MYG A;  4ZL9 A;  3J7Y b;  4JR4 A;  3HJP A;  3VWU A;  1EGR A;  1XWA A;  1V40 A;  2OJL A;  1EP8 A;  4PGT A;  3L9U A;  1YF0 A;  4GSS A;  5AIX A;  5C00 A;  1N2A A;  5COH A;  5ECP B;  4AGS A;  5IMA A;  1TP9 A;  2ZUP A;  4KB3 A;  5G5E A;  4XHM A;  5E4W A;  2LRC A;  3LQ7 A;  5IMV A;  5HR0 A;  2C1Y A;  3RDW A;  2HZE B;  3QOU A;  2PUK C;  1JZD A;  1ERV A;  1Y25 A;  2V41 A;  2WFC A;  4MA9 A;  1PKW A;  2AV4 A;  4IVF A;  1VGL A;  4MDC A;  4TR3 A;  1O8X A;  1O73 A;  1OAZ A;  1J08 A;  2AHE A;  5DAK B;  2Z9S A;  4EUY A;  5EVO A;  3TJG A;  1PGT A;  1FW1 A;  3TOT A;  3IR4 A;  2HXK A;  1OE8 A;  1AXD A;  5ELA A;  5HFI A;  1Z9H A;  1XWC A;  2CAQ A;  3C1S A;  2H1A A;  2YOI A;  2E7P A;  3IOS A;  4POK A;  3VI7 A;  3O76 A;  5IMF A;  1O6J A;  2OAD A;  6GSY A;  3KEB A;  2WJU A;  1U87 A;  5C04 A;  3UJ1 A;  4K1F A;  4Q5F A;  4MJC A;  2J23 A;  1QFN A;  1V57 A;  1TOF A;  2JZR A;  1PX7 A;  5ECO B;  5B8A A;  2A2R A;  5IMC A;  1X9M B;  1AIU A;  14GS A;  2GT5 A;  2FWG A;  4DEJ A;  3QFA C;  22GS A;  4YQM A;  2PER A;  4BA7 A;  3KJY A;  4L5O A;  2LUS A;  3H1N A;  4N0Z A;  4F82 A;  2C0G A;  4EO3 A;  1WOU A;  1XWG A;  2TIR A;  3G7Y A;  3GH9 A;  4L5L A;  2V1M A;  2VAF A;  3FZ9 A;  2K8V A;  3D4T A;  1ERT A;  3US3 A;  1X5C A;  4MH3 A;  5IPG A;  1S3D A;  3FEU A;  3RAZ A;  3MDK A;  2JAD A;  4LA1 A;  3D4M A;  1FB6 A;  4OWY A;  1SKR B;  2YWM A;  5DCH A;  2CAI A;  2GT6 A;  4FIW A;  2CZ3 A;  2XC2 A;  2XHF A;  4EE0 A;  2C4J A;  3HJO A;  3QDN A;  3EVI A;  2GST A;  1M7T A;  2VLT A;  2YZU A;  4KX4 A;  3RHC A;  3GKN A;  1TRS A;  2HFD A;  5B6N A;  3SWL A;  2EC4 A;  1TI3 A;  1YY7 A;  5DDL A;  3ZRD A;  4AJ6 A;  2DIZ A;  1JZR A;  3A3T A;  4WR5 A;  5F07 A;  3FZ4 A;  1DUG A;  2QSI A;  4KW6 A;  1ABA A;  1X9W B;  2LQO A;  2O85 A;  1FO5 A;  4DVC A;  1XWK A;  5EL8 A;  3D0Z A;  1HNA A;  4JU5 A;  4K7O A;  3WGX A;  17GS A;  2H1G A;  3LG6 A;  4MZW A;  4IP1 A;  5H5R A;  4JBB A;  3C73 A;  1Q98 A;  1K3Y A;  1Z6N A;  4GCI A;  3L9S A;  3BD2 A;  2VL3 A;  4GQF A;  2HRN A;  3DRN A;  4ILF A;  5G30 A;  1DSB A;  3GA4 A;  1M2A A;  3EMX A;  5J9B A;  5AIS A;  2K18 A;  2YWI A;  2A4V A;  1EOG A;  5F8B A;  1LBK A;  2LJA A;  2FCH A;  3L4N A;  4BL7 A;  1G6Y A;  4X0X A;  5KN2 A;  4MCU A;  2JAC A;  1SK2 A;  1PL2 A;  3Q19 A;  1SL0 B;  3DML A;  2LNS A;  3CBU A;  3GN3 A;  4HZ2 A;  5ECI B;  4OFM A;  1VF1 A;  1C72 A;  1K0A A;  3AY8 A;  1WRY A;  1XW6 A;  3GRX A;  1M99 A;  3EIN A;  4EDZ A;  1O85 A;  2NBS A;  4HU9 A;  1JLW A;  2VL9 A;  4KCA A;  3Q6O A;  2OAC A;  4AJ8 A;  2DC5 A;  3QAG A;  3EC3 A;  4EDY A;  2OE1 A;  3TKQ A;  2GZP A;  2NDO A;  3APO A;  5B6M A;  1PKZ A;  2DSA A;  4ULX A;  3M9J A;  1AQW A;  4EXJ A;  2HI7 A;  1NHY A;  1FVJ A;  3UAP A;  5DBQ A;  1Y6E A;  4NWY A;  2L6C A;  2DIY A;  1K0N A;  1F6M C;  4PUA A;  1WMJ A;  4IW9 A;  1GLQ A;  3FR3 A;  4NXI A;  4F2I A;  3ERF A;  2GSR A;  2L5L A;  4F0B A;  4MLY A;  4ACS A;  2WB9 A;  1K0D A;  3ZTL A;  3GTU A;  2I3Y A;  4ZXG A;  1EEM A;  1YJ6 A;  1ACV A;  2O7K A;  5IOX A;  4E8E A;  1M0U A;  2C3T A;  2V32 A;  2KUC A;  1K0C A;  3PGT A;  1TRW A;  2HNL A;  4K8M A;  5FT3 A;  3CXG A;  5IM9 A;  2CT6 A;  3LFL A;  4TXO A;  3K8N A;  2NTO A;  4PUR A;  3P7X A;  1YEX A;  1KNG A;  1EV9 A;  1XBS A;  3C1R A;  2NPB A;  1VF3 A;  2DBC A;  2YV7 A;  3QCP A;  1SJI A;  3HA9 A;  2VLV A;  4F0C A;  4K2D A;  2H6Z A;  2D2Z A;  2H6Y A;  2R37 A;  2LEG A;  2OE3 A;  2RM6 A;  2LS5 A;  2TRX A;  3CYN A;  5GAN D;  2B1L A;  1B4Q A;  2GQK A;  2YPM A;  1H75 A;  1F37 A;  2AAW A;  2YWN A;  4J57 E;  2ES7 A;  2C3N A;  1GSY A;  3TJB A;  1GL8 A;  2IJY A;  1K0M A;  3O6T A;  4IQ1 A;  4HUA A;  2FWF A;  2IMI A;  4ISD A;  1Z7R A;  3ZMK A;  4GSN A;  2IWT A;  4AJ7 A;  4ZB6 A;  3EWL A;  1X5E A;  2CVK A;  4GLT A;  1A2M A;  4KUN A;  3QR6 A;  1MTC A;  2NVL A;  4BVX A;  1GP1 A;  1AQV A;  1ZMA A;  3ME8 A;  1GUM A;  4LLR A;  1ZGN A;  4PQH A;  3U6V A;  2HLS A;  4WKW A;  3PR8 A;  1SK0 A;  4TOP A;  4HDE A;  1GSS A;  2XPE A;  5CP1 A;  4OO4 A;  3F4R A;  2IMF A;  1JFU A;  2PVO C;  3EYT A;  1TKD B;  2H71 A;  1JHB A;  2O87 A;  3MSZ A;  1B9X C;  3ZLP A;  1WIK A;  4WF4 A;  3VWX A;  3D5J A;  2IL3 A;  1GNW A;  5DAL A;  1R5A A;  3ZRE A;  4WR4 A;  4GQC A;  4Q5N A;  10GS A;  1THO A;  5JWQ B;  2BMX A;  4QL7 A;  5L71 A;  2M72 A;  3EU4 A;  3IRA A;  3DVX A;  1B4P A;  1XCC A;  4BWQ A;  1F9M A;  3M1G A;  2IN3 A;  1RW1 A;  2EIR A;  1NSW A;  2JL4 A;  4YQV A;  3F0I A;  1QQ2 A;  3ZZX A;  11GS A;  2LV3 A;  2H66 A;  4MP4 A;  2CZ2 A;  5DAK A;  3ZFB A;  3HXS A;  5HR3 A;  1FG4 A;  4GF0 A;  5CNW A;  19GS A;  3TJF A;  3GL5 A;  3M8N A;  2B6M A;  4CHS A;  6GSU A;  2LRN A;  1K0B A;  3UIW A;  1MDI A;  6GSS A;  4ECC A;  2IFQ A;  1YDK A;  3JCM L;  4PNG A;  5D9V A;  4ML1 A;  1BED A;  2X8C A;  5JWR B;  4EF0 A;  1WP0 A;  4ZL8 A;  5D9T A;  1W89 A;  3HVX A;  4MPG A;  4X43 A;  3VI5 A;  4Q5R A;  2CV4 A;  4J56 E;  1BQ7 A;  1X5D A;  3NIV A;  2JSZ A;  2JSY A;  2H19 A;  2QGV A;  5G1L A;  2K8S A;  4LMV A;  5JCW A;  3VUR A;  3D21 A;  4DSQ A;  4D73 B;  2IMD A;  4H86 A;  3BOA A;  1GRX A;  4KDX A;  1CQG A;  5F06 A;  1SEN A;  1ERW A;  1U88 A;  1PN9 A;  3E9J B;  1T4Z A;  3W6G A;  3QFB C;  4O7H A;  4BPY A;  1FVK A;  1PRX A;  1OVN A;  2QKE A;  5DCG A;  1O7U A;  3HY2 A;  5ID2 B;  3NOF A;  1ON4 A;  1A2L A;  1AUC A;  4ID0 A;  2GQM A;  5IMD A;  3P8W A;  2HE3 A;  1DE1 A;  5ECQ B; 
#chains in the Genus database with same CATH topology
 3EUR A;  3GST A;  4F03 A;  1U3A A;  4PX1 A;  4WET A;  2HRF A;  2H6X A;  5EPF A;  3MAK A;  1YZX A;  1VF2 A;  3R3E A;  2HYX A;  4PXO A;  2R0P A;  4TRX A;  1AQX A;  2VL2 A;  1VRS D;  5B7C A;  2DJK A;  3A5W A;  1XFL A;  2I4A A;  2AB6 A;  1EV4 A;  4K5S A;  4MMM A;  4YQU A;  4XCS A;  3MWH A;  2OE0 A;  1YKC A;  1GSD A;  1ILO A;  1R5P A;  3I6A A;  4K9Z A;  1K3L A;  5G2Z A;  2DLX A;  3I69 A;  4GWR A;  4TVE A;  3A2W A;  2FHE A;  2WUL A;  4QL9 A;  5G1K A;  4X4J A;  2C0F A;  3M3M A;  3TCO A;  1JZO A;  13GS A;  4TR0 A;  2YWO A;  4Z2T A;  2KOK A;  5IO2 A;  3N5O A;  2FGX A;  3QAW A;  3KH7 A;  4ZB9 A;  2H70 A;  5ECH B;  2FD3 A;  1IYH A;  5ECL B;  5JWO B;  1GSF A;  2YNX A;  4LL1 B;  4IS0 A;  1U6T A;  1XVQ A;  3F63 A;  2C0E A;  4G0K A;  1TK5 B;  4MF7 A;  5AGY A;  4TR1 A;  3FR6 A;  4EKZ A;  3CRT A;  20GS A;  3L0H A;  3LJR A;  1H4O A;  4IBP A;  5A4W A;  4HU7 A;  2V6K A;  1E6B A;  1SD9 A;  3HVV A;  3F4T A;  3FYG A;  3VPQ A;  4IN0 A;  2RUF A;  4JRR A;  1ML6 A;  3F3Q A;  5ENU A;  4WF5 A;  5LNK e;  2X4A A;  4EIQ A;  5DQS A;  4WBR D;  4RQX A;  2V2G A;  2YJ7 A;  4HOJ A;  4KND A;  1GNE A;  2P31 A;  5D9X A;  1WJK A;  1A0R P;  4JE1 A;  2R2J A;  1BAY A;  1OYJ A;  4LL4 B;  3GFK A;  2H72 A;  2OBI A;  4I8B A;  5J9C A;  5ECK B;  3IDV A;  3BJ5 A;  2RM5 A;  4HI7 A;  1MEK A;  2DML A;  4I97 A;  2XBQ A;  1DE2 A;  1NW2 A;  5H5S A;  1AW9 A;  2H1B A;  2CVD A;  3HJM A;  1XWB A;  3TRX A;  3ZFL A;  1AAZ A;  5F05 A;  3HVN A;  3TDG A;  2CA8 A;  4BVY A;  1ZYN A;  1HNC A;  5KN1 A;  4KSO A;  4HQS A;  2LST A;  5A5K A;  4TW5 A;  2HRK A;  5IIZ A;  1SL2 B;  4XRA A;  5FWG A;  5AN1 A;  2E2M A;  1LJR A;  2GSS A;  3BBY A;  3FY7 A;  4XIH A;  4MJE A;  1F3A A;  1PA3 A;  6GSV A;  3EU3 A;  3KP8 A;  4ML6 A;  1O8W A;  5J3R A;  2YN1 A;  4HS1 A;  4XS4 A;  2VO4 A;  2PMT A;  1GSQ A;  3Q18 A;  1RQM A;  5CRH A;  3FR9 A;  1IYI A;  1QK8 A;  3G9B A;  1WWJ A;  3QAV A;  4KDU A;  3KGK A;  3HKR A;  3EPT A;  1W4V A;  3IA1 A;  3TKS A;  2L6D A;  4EIP A;  2LRT A;  2FY6 A;  3IK7 A;  1HYU A;  4O92 A;  4G9H A;  1PX6 A;  2AJQ B;  2B5Y A;  5KOX A;  1I9D A;  4V1A g;  1TI1 A;  3H4K A;  1WPI A;  2CVB A;  2R6K A;  3LOR A;  1V58 A;  4NAX A;  4JED A;  2H0I A;  8GSS A;  4LMW A;  4DSS A;  3VLN A;  3WGE A;  2KP1 A;  1FHE A;  2YAN A;  3F3R A;  4OCE A;  1MDK A;  3DIE A;  2O8V B;  5KN0 A;  3F9U A;  3TRQ A;  4ECB A;  1UN2 A;  5GAP D;  1SL1 B;  1ERU A;  2PU9 C;  1R7H A;  5CRD A;  3VWW A;  1GUH A;  3IAM 2;  2E2G A;  1MD4 A;  1TRU A;  2LKU A;  2I1U A;  1TU7 A;  4KGI A;  4F9Z A;  5F0G A;  1EZK A;  3J7Y k;  2QC7 A;  3GIX A;  4EC0 A;  3V1W A;  5ECN B;  2I81 A;  4CDO A;  3Q74 A;  2YJH A;  5HQP A;  2MBS A;  2H0H A;  5INY A;  3QD9 A;  4PNF A;  3WGD A;  2DKI A;  2OA7 A;  3ISO A;  2B5X A;  4IHU A;  3G7I A;  3C71 A;  3C8E A;  5ECM B;  2N5B A;  1V2A A;  4I6X A;  1XVW A;  4OCF A;  2FA8 A;  5GST A;  3IC8 A;  2MMN A;  3ERG A;  2VCZ A;  3APS A;  3IV4 A;  4E8H A;  4MH2 A;  3WD6 A;  3BCI A;  5ECS A;  2X99 A;  1VF4 A;  4YKF A;  3GKM A;  4ZB8 A;  3KH9 A;  3UMA A;  4ICY A;  2VM2 A;  2IPA A;  5BRT A;  3GUS A;  1GUL A;  5HFG A;  3KP9 A;  1T8E B;  2BJX A;  5CAX A;  2I9H A;  2ZCT A;  3H8Q A;  2F8F A;  2IIY A;  1A24 A;  3A5I A;  3DXB A;  4L8E A;  2CX4 A;  1EGO A;  2EIO A;  3SBC A;  2C80 A;  3RPN A;  2VUP A;  2HSY A;  5ABR A;  3S9F A;  2ALB A;  3ED3 A;  3VWV A;  3KTL A;  4MAB A;  1GTA A;  5HR2 A;  9GSS A;  1TTZ A;  4EVM A;  2HZE A;  1ZOF A;  4V2N A;  3GH6 A;  4D73 A;  3GSS A;  3DEX A;  2VIM A;  3I43 A;  2MMZ A;  1FAA A;  3DYR A;  4TXO B;  1FB0 A;  1Z7P A;  4HJM A;  4OFT A;  4OFN A;  4POM A;  3KXO A;  4MF6 A;  3KIJ A;  2BTO T;  1UA5 A;  3ZYW A;  2GTU A;  3UVH A;  3P2A A;  1V9W A;  2FLS A;  3HDC A;  2L57 A;  3HYP A;  4RI6 A;  2N5F A;  4I5Q A;  1CQH A;  4K7I A;  4PQI A;  5AIV A;  2WCI A;  1XIY A;  2PPT A;  1OC8 A;  4GST A;  3ERW A;  4OMV A;  2TRC P;  1BYE A;  5IQY A;  3HZ8 A;  5IMZ A;  3FKF A;  1EWX A;  4V2M A;  3ME7 A;  4YAP A;  3TJJ A;  1SYX A;  1SU9 A;  4GXZ A;  3DKS A;  2QA2 A;  3IE3 A;  3LYP A;  5HFK A;  3MNG A;  2G0F A;  1BG5 A;  4MZC A;  2P5Q A;  3FZ5 A;  3OR5 A;  2R5G A;  5CRG A;  1M3J A;  1ZZY A;  4BVX B;  3IAS 2;  1G7O A;  4TR4 A;  3CSI A;  1T00 A;  2H01 A;  3DVW A;  2DJJ A;  6GST A;  2LJK A;  2C0D A;  3RPP A;  4K7N A;  2O89 A;  4ECI A;  1QXH A;  2P5R A;  3HD5 A;  4Z7X A;  1GWC A;  1XXU A;  4NHW A;  3LEF A;  4NMU A;  5DAL B;  4KCE A;  3LGC A;  3IPZ A;  1GSE A;  2GSQ A;  2WS2 A;  4TN8 A;  1TXX A;  1TK0 B;  3GMF A;  3P90 A;  1GLP A;  5D73 A;  4POL A;  1SKW B;  2F3M A;  2KP2 A;  4BWS A;  1ZYQ B;  1ZYE A;  3IC4 A;  5EY6 A;  5DJM A;  4K5R A;  4K0G A;  2DJ3 A;  4P3Y B;  1GTI A;  2YZH A;  3PIN A;  3GKX A;  3A2V A;  2H1D A;  4PUF C;  3FK8 A;  2B7J A;  4G2E A;  3TJK A;  5IPH A;  2OKA A;  3UL3 A;  1OC9 B;  1T3B A;  4ZIJ A;  1HQO A;  4GTU A;  1TDI A;  4K2X A;  3F4S A;  2IFQ B;  3ZIV A;  3PPU A;  4ZBA A;  3ZIT A;  1X9S B;  4FYB A;  3GUR A;  1HNB A;  4WXT A;  1GUK A;  2A2S A;  3CMI A;  3HHV A;  4BIK A;  4K6X A;  3UBL A;  3GX8 A;  6GSW A;  5D93 A;  3TGZ A;  2AYT A;  2AUV A;  1YEP A;  2GVP A;  4NPB A;  1M9A A;  1O81 A;  1RK4 A;  2VLU A;  5CRW A;  3PH9 A;  1BJX A;  3TB2 A;  2IMK A;  2VL2 C;  2ON7 A;  4CW9 A;  1XW9 A;  2A2P A;  3W8S A;  3CTF A;  2K6V A;  1SJZ A;  4JZQ A;  12GS A;  4KSM A;  3TUE A;  4RI7 A;  4IGJ A;  3D6I A;  2VCX A;  4TXV A;  4ZIL A;  4KH7 A;  1OC3 A;  4G19 A;  3WT2 A;  1USB A;  5FHI A;  1QGV A;  2L59 A;  2H76 A;  3I9V 2;  4MJB A;  1UVZ A;  4YKG A;  3APQ A;  5B8B A;  3GYK A;  1EEJ A;  1PQN A;  1SK1 A;  3QMX A;  2R0C A;  4AF2 A;  2PGT A;  3GKK A;  1YQ1 A;  2GLR A;  2HSM A;  4XTS A;  3UBK A;  1NM3 A;  1A2J A;  2M80 A;  1URM A;  5G31 A;  2GZY A;  1YKA A;  2B5E A;  3GV1 A;  2JU5 A;  4N10 A;  1T1V A;  2VCQ A;  3EE2 A;  5J41 A;  3LYK A;  2VD0 A;  3F6F A;  1J0F A;  4MNN A;  2K9F A;  4YH2 A;  1A8Y A;  2RLI A;  4MZB A;  2DJ0 A;  4G10 A;  4XS6 A;  5LD0 A;  4NV5 A;  5CRE A;  2JZT A;  1EOH A;  1SKS B;  1F2E A;  2LNT A;  3H79 A;  3TRP A;  3R2Q A;  3HCZ A;  1WE0 A;  3NZN A;  2FWH A;  4MK3 A;  4N11 A;  5D9W A;  2ON5 A;  3ZVJ A;  4L0W A;  3KTB A;  2RUE A;  4WEY A;  3KZQ A;  4YAV A;  1M9B A;  5J4U A;  3A2X A;  3CTG A;  5D96 A;  2L4C A;  4J2F A;  3CRU A;  3FRC A;  1M2B A;  5JCU A;  3H93 A;  1UC7 A;  2LTK A;  2MMO A;  3VK9 A;  4KA0 A;  2EIQ A;  3L9V A;  5A4V A;  1PMT A;  2FNO A;  3DWV A;  4V2L A;  3DD3 A;  2HRA A;  4PQ1 A;  4IJI A;  2C3Q A;  3KD0 A;  1KBN A;  3N9J A;  1A0F A;  4TKY A;  4EL1 A;  1AC1 A;  16GS A;  5HR1 A;  3M9K A;  2PN8 A;  2YV9 A;  1XW5 A;  3RBT A;  2GQL A;  3BCK A;  1QUW A;  2DJ2 A;  3FW2 A;  2H30 A;  2YCD A;  1BX9 A;  4NV2 A;  3FZA A;  4FO5 A;  2CQ9 A;  4K0N A;  2HT9 A;  1XG8 A;  1JLV A;  2KLX A;  3ZML A;  1E2Y A;  2VD1 A;  5A4U A;  1EP7 A;  5H5Q A;  2WZ9 A;  2L4Q A;  1F3B A;  1N8J A;  1X0R A;  4TR1 B;  3LXZ A;  4X1U A;  4DSR A;  2G2Q A;  1OKD A;  2MZC A;  4IEL A;  3U5R E;  1G0T A;  1XZO A;  3E0U A;  1PL1 A;  4NHZ A;  1Q4J A;  2VOC A;  1KTE A;  1LU4 A;  3IXR A;  4XS1 A;  2CX3 A;  3G7J A;  5DQY A;  1M2D A;  3KMN A;  3LXT A;  2H75 A;  3W8J A;  4KDY A;  1J9B A;  2H0G A;  4N30 A;  3TKR A;  2OBK A;  1R26 A;  2PBJ A;  2R0G A;  3TKS C;  4O5R A;  2F8A A;  4A5P A;  1XOA A;  3HVS A;  4QQ7 A;  4KAE A;  3LW9 A;  3O3T A;  2R3X A;  2M46 A;  3IK9 A;  1MDJ A;  3ZL5 A;  1M3I A;  1I5G A;  2H74 A;  1HD2 A;  1S3C A;  5G5F A;  3GX0 A;  5KOW A;  2MMA A;  4HEA 2;  4HJ2 A;  1T7P B;  1JZW A;  1KEB A;  4IQA A;  2HZF A;  3IBH A;  4ZL7 A;  3LWA A;  1ZL9 A;  4BL7 B;  1SJ6 A;  5KEJ A;  1TU8 A;  5JCG A;  3UOM A;  5DVB A;  5IOW A;  4GRF A;  2GZZ A;  3L78 A;  1U3I A;  2R4V A;  4FH8 A;  4V1A p;  3HZ4 A;  3VFI A;  3E3E A;  2LQQ A;  5IO0 A;  3M0F A;  1A23 A;  4Z2R A;  2P0G A;  3EMP A;  2FUG 2;  2F9S A;  1OE7 A;  4O32 A;  3UAR A;  4MF5 A;  1SD8 A;  3CSJ A;  5LCZ A;  1SYR A;  1Z5Y E;  2L5O A;  3D22 A;  4FYU A;  4XS4 B;  2WGR A;  4HZ4 A;  2VM1 A;  1B8X A;  2YP6 A;  1S3A A;  2A4H A;  3F6D A;  1QMV A;  3KMO A;  5CYY A;  1TRV A;  4IP6 A;  1G7E A;  2XBI A;  3GL3 A;  2X8H A;  5CO3 A;  5GZZ B;  3MYD A;  4HQZ A;  1R4W A;  4ZBD A;  2C8U A;  2GS3 A;  1S3R A;  4IJ3 A;  1T4Y A;  2F51 A;  4JR6 A;  3CSH A;  2DMM A;  1FOV A;  2VCT A;  1NHO A;  3C7M A;  3UVT A;  7GSS A;  4DSS B;  1OKT A;  3ZIJ A;  5D8I A;  4ZBB A;  2DJ1 A;  3TKS E;  5E59 A;  3CQF A;  1V98 A;  4Q5Q A;  5ELG A;  4MJA A;  4RUV A;  2B1K A;  3F8U A;  1TW9 A;  3GTU B;  2VCW A;  3KM6 A;  2IME A;  5J5N A;  2E0Q A;  4ECJ A;  1ZCP A;  2FWE A;  1GH2 A;  5GSS A;  4OD7 A;  4POB A;  1K3O A;  1K0O A;  1Z6M A;  4L0U A;  1YF1 A;  2PVQ A;  2WDU A;  1G6W A;  1XPV A;  2LJR A;  4FYC A;  3QPM A;  3WYW A;  1PFO A;  3GNJ A;  4OO5 A;  3DGQ A;  4IKH A;  6GSX A;  4I2U A;  1GTB A;  4KE3 A;  2J9H A;  3ZVJ D;  1B48 A;  1GSU A;  2GDR A;  1MD3 A;  5DJL A;  2JZS A;  1A8L A;  1XOB A;  4RQR A;  4MPF A;  2PWJ A;  3RHB A;  2V6O A;  2ZNM A;  3WT1 A;  5ID2 A;  1Z3E A;  2VCV A;  4XRD A;  1THX A;  5KN3 A;  3LSZ A;  2H8L A;  2B3S A;  3KCM A;  18GS A;  2FA4 A;  4I2T A;  1DBY A;  2KHP A;  3UEM A;  1GTU A;  2MBT A;  2GGT A;  5ECR B;  2HSH A;  3IHQ A;  3MIX A;  2H73 A;  3VPT A;  2B7K A;  3TKP A;  3FHK A;  3TOU A;  4WBJ A;  2REM A;  1OC9 A;  4N0V A;  2RII A;  1TK8 B;  2X8G A;  2XPD A;  3GHA A;  2WRT A;  1TJD A;  1PD2 1;  2X64 A;  1B9Y C;  1ST9 A;  2N5A A;  1PSQ A;  2MYG A;  4ZL9 A;  3J7Y b;  4JR4 A;  3HJP A;  3VWU A;  1EGR A;  1XWA A;  1V40 A;  2OJL A;  1EP8 A;  4PGT A;  3L9U A;  1YF0 A;  4GSS A;  5AIX A;  5C00 A;  1N2A A;  5COH A;  5ECP B;  4AGS A;  5IMA A;  1TP9 A;  2ZUP A;  4KB3 A;  5G5E A;  4XHM A;  5E4W A;  2QA1 A;  2LRC A;  3LQ7 A;  5IMV A;  5HR0 A;  2C1Y A;  3RDW A;  2HZE B;  4Z2U A;  3QOU A;  2PUK C;  1JZD A;  1ERV A;  1Y25 A;  2V41 A;  2WFC A;  4MA9 A;  1PKW A;  2AV4 A;  4IVF A;  1VGL A;  4MDC A;  4TR3 A;  1O8X A;  1O73 A;  1OAZ A;  1J08 A;  2AHE A;  5DAK B;  2Z9S A;  4EUY A;  5EVO A;  3TJG A;  1PGT A;  1FW1 A;  3TOT A;  3IR4 A;  2HXK A;  1OE8 A;  1AXD A;  5ELA A;  5HFI A;  1Z9H A;  1XWC A;  2CAQ A;  3C1S A;  2H1A A;  2YOI A;  2E7P A;  3IOS A;  4POK A;  3VI7 A;  3O76 A;  5IMF A;  1O6J A;  1ZYP A;  2OAD A;  6GSY A;  3KEB A;  2WJU A;  1U87 A;  5C04 A;  3UJ1 A;  4K1F A;  4Q5F A;  4MJC A;  2J23 A;  1QFN A;  1V57 A;  1TOF A;  2JZR A;  1PX7 A;  5ECO B;  5B8A A;  2A2R A;  5IMC A;  1X9M B;  1AIU A;  14GS A;  2GT5 A;  2FWG A;  4DEJ A;  3QFA C;  22GS A;  4YQM A;  2PER A;  4BA7 A;  3KJY A;  4L5O A;  2LUS A;  3H1N A;  4N0Z A;  4F82 A;  2C0G A;  4EO3 A;  1WOU A;  1XWG A;  2TIR A;  3G7Y A;  3GH9 A;  4L5L A;  2V1M A;  2VAF A;  3FZ9 A;  2K8V A;  3D4T A;  1ERT A;  3US3 A;  1X5C A;  4MH3 A;  5IPG A;  2UZ8 A;  1S3D A;  3FEU A;  3RAZ A;  3MDK A;  2JAD A;  4LA1 A;  3D4M A;  1FB6 A;  4OWY A;  1SKR B;  2YWM A;  5DCH A;  2CAI A;  2GT6 A;  4FIW A;  2CZ3 A;  2XC2 A;  2XHF A;  4G0L A;  4KF9 A;  4EE0 A;  2C4J A;  4CY6 A;  3HJO A;  3QDN A;  3EVI A;  2GST A;  1M7T A;  2VLT A;  2YZU A;  4KX4 A;  3RHC A;  3GKN A;  1TRS A;  2HFD A;  5B6N A;  3SWL A;  2EC4 A;  1TI3 A;  1YY7 A;  5DDL A;  3ZRD A;  4AJ6 A;  2DIZ A;  4CY8 A;  1JZR A;  3A3T A;  4WR5 A;  5F07 A;  3FZ4 A;  1DUG A;  2QSI A;  4KW6 A;  1ABA A;  1X9W B;  2LQO A;  2O85 A;  1FO5 A;  4DVC A;  1XWK A;  5EL8 A;  3D0Z A;  1HNA A;  4JU5 A;  4K7O A;  3WGX A;  17GS A;  2H1G A;  3LG6 A;  4MZW A;  4IP1 A;  5H5R A;  4JBB A;  3C73 A;  1Q98 A;  1K3Y A;  1Z6N A;  4GCI A;  3L9S A;  3BD2 A;  2VL3 A;  4GQF A;  2HRN A;  3DRN A;  4ILF A;  5G30 A;  1DSB A;  3GA4 A;  1M2A A;  3EMX A;  5J9B A;  5AIS A;  2K18 A;  2YWI A;  2A4V A;  1EOG A;  5F8B A;  1LBK A;  2LJA A;  4PTS A;  2FCH A;  3L4N A;  4BL7 A;  4G0I A;  1G6Y A;  4X0X A;  5KN2 A;  4MCU A;  2JAC A;  1SK2 A;  1PL2 A;  3Q19 A;  1SL0 B;  3DML A;  2LNS A;  3CBU A;  3GN3 A;  4HZ2 A;  5ECI B;  4OFM A;  1VF1 A;  1C72 A;  1K0A A;  3AY8 A;  1WRY A;  1XW6 A;  3GRX A;  1M99 A;  3EIN A;  4EDZ A;  1O85 A;  2NBS A;  4HU9 A;  1JLW A;  2VL9 A;  4KCA A;  3Q6O A;  2OAC A;  4AJ8 A;  2DC5 A;  3QAG A;  3EC3 A;  4O5Q A;  2OE1 A;  4USS A;  3TKQ A;  4EDY A;  2GZP A;  2NDO A;  3APO A;  5B6M A;  1PKZ A;  2DSA A;  4ULX A;  3M9J A;  1AQW A;  4EXJ A;  2HI7 A;  1NHY A;  1FVJ A;  3UAP A;  5DBQ A;  1Y6E A;  4NWY A;  2L6C A;  2DIY A;  1K0N A;  1F6M C;  4PUA A;  1WMJ A;  4IW9 A;  1GLQ A;  3FR3 A;  4NXI A;  4F2I A;  3ERF A;  4BVY B;  2GSR A;  2L5L A;  4F0B A;  4MLY A;  4ACS A;  2WB9 A;  1K0D A;  3ZTL A;  3GTU A;  2I3Y A;  4ZXG A;  1EEM A;  1YJ6 A;  4FQU A;  1ACV A;  2O7K A;  5IOX A;  4E8E A;  1M0U A;  2C3T A;  2V32 A;  2KUC A;  1K0C A;  3PGT A;  1TRW A;  2HNL A;  4K8M A;  5FT3 A;  3CXG A;  5IM9 A;  2CT6 A;  3LFL A;  4TXO A;  3K8N A;  4HSC X;  5BMU A;  2NTO A;  4PUR A;  3P7X A;  1YEX A;  1KNG A;  1EV9 A;  1XBS A;  3C1R A;  2NPB A;  1VF3 A;  2DBC A;  2YV7 A;  3QCP A;  1SJI A;  3HA9 A;  2VLV A;  4F0C A;  4K2D A;  2H6Z A;  2D2Z A;  2H6Y A;  2R37 A;  2LEG A;  2OE3 A;  2RM6 A;  2LS5 A;  2TRX A;  3CYN A;  5GAN D;  2B1L A;  2DKH A;  1B4Q A;  2GQK A;  2YPM A;  1H75 A;  1F37 A;  2AAW A;  2YWN A;  4J57 E;  2ES7 A;  2C3N A;  1GSY A;  3FMW A;  3TJB A;  1GL8 A;  2IJY A;  1K0M A;  3O6T A;  4IQ1 A;  4HUA A;  2FWF A;  2IMI A;  4ISD A;  1Z7R A;  3ZMK A;  4GSN A;  2IWT A;  4AJ7 A;  4ZB6 A;  3EWL A;  1X5E A;  2CVK A;  4GLT A;  1A2M A;  4KUN A;  3QR6 A;  1MTC A;  2NVL A;  4BVX A;  1GP1 A;  1AQV A;  1ZMA A;  3ME8 A;  1GUM A;  4LLR A;  1ZGN A;  4PQH A;  3U6V A;  3IHG A;  2X49 A;  2HLS A;  4WKW A;  3PR8 A;  1SK0 A;  4TOP A;  4HDE A;  1GSS A;  2XPE A;  5CP1 A;  4OO4 A;  3F4R A;  2IMF A;  1JFU A;  2PVO C;  3EYT A;  1TKD B;  2H71 A;  1JHB A;  2O87 A;  3MSZ A;  1B9X C;  3ZLP A;  1WIK A;  4WF4 A;  3VWX A;  3D5J A;  2IL3 A;  1GNW A;  5DAL A;  1R5A A;  3ZRE A;  4WR4 A;  4GQC A;  4Q5N A;  10GS A;  1THO A;  5JWQ B;  2BMX A;  4QL7 A;  5L71 A;  2M72 A;  3EU4 A;  3IRA A;  3DVX A;  1B4P A;  1XCC A;  4BWQ A;  1F9M A;  3M1G A;  2IN3 A;  1RW1 A;  2EIR A;  1NSW A;  2JL4 A;  4YQV A;  3F0I A;  1QQ2 A;  3ZZX A;  11GS A;  2LV3 A;  1FOH A;  2H66 A;  4MP4 A;  2CZ2 A;  5DAK A;  3ZFB A;  3HXS A;  5HR3 A;  1FG4 A;  4GF0 A;  4O5U A;  5CNW A;  19GS A;  3TJF A;  3GL5 A;  3M8N A;  2B6M A;  4CHS A;  6GSU A;  2LRN A;  1K0B A;  3UIW A;  1MDI A;  6GSS A;  4ECC A;  2IFQ A;  1YDK A;  3JCM L;  4PNG A;  5D9V A;  4ML1 A;  1BED A;  2X8C A;  5JWR B;  4EF0 A;  1WP0 A;  4ZL8 A;  5D9T A;  1W89 A;  3HVX A;  4MPG A;  4X43 A;  3VI5 A;  4Q5R A;  2CV4 A;  4J56 E;  1BQ7 A;  1X5D A;  3NIV A;  2JSZ A;  2JSY A;  2H19 A;  2QGV A;  5G1L A;  2K8S A;  4LMV A;  5JCW A;  3VUR A;  3D21 A;  4DSQ A;  4D73 B;  2IMD A;  4H86 A;  3BOA A;  1GRX A;  4KDX A;  1CQG A;  5F06 A;  1SEN A;  1ERW A;  1U88 A;  1PN9 A;  3E9J B;  1T4Z A;  3W6G A;  3QFB C;  4O7H A;  4BPY A;  1FVK A;  1PRX A;  1OVN A;  2QKE A;  5DCG A;  1O7U A;  3HY2 A;  5ID2 B;  3NOF A;  1PN0 A;  1ON4 A;  1A2L A;  1AUC A;  4ID0 A;  2GQM A;  5IMD A;  3P8W A;  2HE3 A;  1DE1 A;  5ECQ B; 
#chains in the Genus database with same CATH homology
 3EUR A;  3GST A;  4F03 A;  1U3A A;  4PX1 A;  4WET A;  2HRF A;  2H6X A;  5EPF A;  3MAK A;  1YZX A;  1VF2 A;  3R3E A;  2HYX A;  4PXO A;  2R0P A;  4TRX A;  1AQX A;  2VL2 A;  1VRS D;  5B7C A;  2DJK A;  3A5W A;  1XFL A;  2I4A A;  2AB6 A;  1EV4 A;  4K5S A;  4MMM A;  4YQU A;  4XCS A;  3MWH A;  2OE0 A;  1YKC A;  1GSD A;  1ILO A;  1R5P A;  3I6A A;  4K9Z A;  1K3L A;  5G2Z A;  2DLX A;  3I69 A;  4GWR A;  4TVE A;  3A2W A;  2FHE A;  2WUL A;  4QL9 A;  5G1K A;  4X4J A;  2C0F A;  3M3M A;  3TCO A;  1JZO A;  13GS A;  4TR0 A;  2YWO A;  4Z2T A;  2KOK A;  5IO2 A;  3N5O A;  2FGX A;  3QAW A;  3KH7 A;  4ZB9 A;  2H70 A;  5ECH B;  2FD3 A;  1IYH A;  5ECL B;  5JWO B;  1GSF A;  2YNX A;  4LL1 B;  4IS0 A;  1U6T A;  1XVQ A;  3F63 A;  2C0E A;  4G0K A;  1TK5 B;  4MF7 A;  5AGY A;  4TR1 A;  3FR6 A;  4EKZ A;  3CRT A;  20GS A;  3L0H A;  3LJR A;  1H4O A;  4IBP A;  5A4W A;  4HU7 A;  2V6K A;  1E6B A;  1SD9 A;  3HVV A;  3F4T A;  3FYG A;  3VPQ A;  4IN0 A;  2RUF A;  4JRR A;  1ML6 A;  3F3Q A;  5ENU A;  4WF5 A;  5LNK e;  2X4A A;  4EIQ A;  5DQS A;  4WBR D;  4RQX A;  2V2G A;  2YJ7 A;  4HOJ A;  4KND A;  1GNE A;  2P31 A;  5D9X A;  1WJK A;  1A0R P;  4JE1 A;  2R2J A;  1BAY A;  1OYJ A;  4LL4 B;  3GFK A;  2H72 A;  2OBI A;  4I8B A;  5J9C A;  5ECK B;  3IDV A;  3BJ5 A;  2RM5 A;  4HI7 A;  1MEK A;  2DML A;  4I97 A;  2XBQ A;  1DE2 A;  1NW2 A;  5H5S A;  1AW9 A;  2H1B A;  2CVD A;  3HJM A;  1XWB A;  3TRX A;  3ZFL A;  1AAZ A;  5F05 A;  3TDG A;  2CA8 A;  4BVY A;  1ZYN A;  1HNC A;  5KN1 A;  4KSO A;  4HQS A;  2LST A;  5A5K A;  4TW5 A;  2HRK A;  5IIZ A;  1SL2 B;  4XRA A;  5FWG A;  5AN1 A;  2E2M A;  1LJR A;  2GSS A;  3BBY A;  3FY7 A;  4XIH A;  4MJE A;  1F3A A;  1PA3 A;  6GSV A;  3EU3 A;  3KP8 A;  4ML6 A;  1O8W A;  5J3R A;  2YN1 A;  4HS1 A;  4XS4 A;  2VO4 A;  2PMT A;  1GSQ A;  3Q18 A;  1RQM A;  5CRH A;  3FR9 A;  1IYI A;  1QK8 A;  3G9B A;  1WWJ A;  3QAV A;  4KDU A;  3KGK A;  3HKR A;  3EPT A;  1W4V A;  3IA1 A;  3TKS A;  2L6D A;  4EIP A;  2LRT A;  2FY6 A;  3IK7 A;  1HYU A;  4O92 A;  4G9H A;  1PX6 A;  2AJQ B;  2B5Y A;  5KOX A;  1I9D A;  4V1A g;  1TI1 A;  3H4K A;  1WPI A;  2CVB A;  2R6K A;  3LOR A;  1V58 A;  4NAX A;  4JED A;  2H0I A;  8GSS A;  4LMW A;  4DSS A;  3VLN A;  3WGE A;  2KP1 A;  1FHE A;  2YAN A;  3F3R A;  4OCE A;  1MDK A;  3DIE A;  2O8V B;  5KN0 A;  3F9U A;  3TRQ A;  4ECB A;  1UN2 A;  5GAP D;  1SL1 B;  1ERU A;  2PU9 C;  1R7H A;  5CRD A;  3VWW A;  1GUH A;  3IAM 2;  2E2G A;  1MD4 A;  1TRU A;  2LKU A;  2I1U A;  1TU7 A;  4KGI A;  4F9Z A;  5F0G A;  1EZK A;  3J7Y k;  2QC7 A;  3GIX A;  4EC0 A;  3V1W A;  5ECN B;  2I81 A;  4CDO A;  3Q74 A;  2YJH A;  5HQP A;  2MBS A;  2H0H A;  5INY A;  3QD9 A;  4PNF A;  3WGD A;  2DKI A;  2OA7 A;  3ISO A;  2B5X A;  4IHU A;  3G7I A;  3C71 A;  3C8E A;  5ECM B;  2N5B A;  1V2A A;  4I6X A;  1XVW A;  4OCF A;  2FA8 A;  5GST A;  3IC8 A;  2MMN A;  3ERG A;  2VCZ A;  3APS A;  3IV4 A;  4E8H A;  4MH2 A;  3WD6 A;  3BCI A;  5ECS A;  2X99 A;  1VF4 A;  4YKF A;  3GKM A;  4ZB8 A;  3KH9 A;  3UMA A;  4ICY A;  2VM2 A;  2IPA A;  5BRT A;  3GUS A;  1GUL A;  5HFG A;  3KP9 A;  1T8E B;  2BJX A;  5CAX A;  2I9H A;  2ZCT A;  3H8Q A;  2F8F A;  2IIY A;  1A24 A;  3A5I A;  3DXB A;  4L8E A;  2CX4 A;  1EGO A;  2EIO A;  3SBC A;  2C80 A;  3RPN A;  2VUP A;  2HSY A;  5ABR A;  3S9F A;  2ALB A;  3ED3 A;  3VWV A;  3KTL A;  4MAB A;  1GTA A;  5HR2 A;  9GSS A;  1TTZ A;  4EVM A;  2HZE A;  1ZOF A;  4V2N A;  3GH6 A;  4D73 A;  3GSS A;  3DEX A;  2VIM A;  3I43 A;  2MMZ A;  1FAA A;  3DYR A;  4TXO B;  1FB0 A;  1Z7P A;  4HJM A;  4OFT A;  4OFN A;  4POM A;  3KXO A;  4MF6 A;  3KIJ A;  2BTO T;  1UA5 A;  3ZYW A;  2GTU A;  3UVH A;  3P2A A;  1V9W A;  2FLS A;  3HDC A;  2L57 A;  3HYP A;  4RI6 A;  2N5F A;  4I5Q A;  1CQH A;  4K7I A;  4PQI A;  5AIV A;  2WCI A;  1XIY A;  2PPT A;  1OC8 A;  4GST A;  3ERW A;  4OMV A;  2TRC P;  1BYE A;  5IQY A;  3HZ8 A;  5IMZ A;  3FKF A;  1EWX A;  4V2M A;  3ME7 A;  4YAP A;  3TJJ A;  1SYX A;  1SU9 A;  4GXZ A;  3DKS A;  2QA2 A;  3IE3 A;  3LYP A;  5HFK A;  3MNG A;  2G0F A;  1BG5 A;  4MZC A;  2P5Q A;  3FZ5 A;  3OR5 A;  2R5G A;  5CRG A;  1ZZY A;  4BVX B;  3IAS 2;  1G7O A;  4TR4 A;  3CSI A;  1T00 A;  2H01 A;  3DVW A;  2DJJ A;  6GST A;  2LJK A;  2C0D A;  3RPP A;  4K7N A;  2O89 A;  4ECI A;  1QXH A;  2P5R A;  3HD5 A;  4Z7X A;  1GWC A;  1XXU A;  4NHW A;  3LEF A;  4NMU A;  5DAL B;  4KCE A;  3LGC A;  3IPZ A;  1GSE A;  2GSQ A;  2WS2 A;  4TN8 A;  1TXX A;  1TK0 B;  3GMF A;  3P90 A;  1GLP A;  5D73 A;  4POL A;  1SKW B;  2F3M A;  2KP2 A;  4BWS A;  1ZYQ B;  1ZYE A;  3IC4 A;  5EY6 A;  5DJM A;  4K5R A;  4K0G A;  2DJ3 A;  4P3Y B;  1GTI A;  2YZH A;  3PIN A;  3GKX A;  3A2V A;  2H1D A;  4PUF C;  3FK8 A;  2B7J A;  4G2E A;  3TJK A;  5IPH A;  2OKA A;  3UL3 A;  1OC9 B;  1T3B A;  4ZIJ A;  1HQO A;  4GTU A;  1TDI A;  4K2X A;  3F4S A;  2IFQ B;  3ZIV A;  3PPU A;  4ZBA A;  3ZIT A;  1X9S B;  4FYB A;  3GUR A;  1HNB A;  4WXT A;  1GUK A;  2A2S A;  3CMI A;  3HHV A;  4K6X A;  3UBL A;  3GX8 A;  6GSW A;  5D93 A;  3TGZ A;  2AYT A;  2AUV A;  1YEP A;  2GVP A;  4NPB A;  1M9A A;  1O81 A;  1RK4 A;  2VLU A;  5CRW A;  3PH9 A;  1BJX A;  3TB2 A;  2IMK A;  2VL2 C;  2ON7 A;  4CW9 A;  1XW9 A;  2A2P A;  3W8S A;  3CTF A;  2K6V A;  1SJZ A;  4JZQ A;  12GS A;  4KSM A;  3TUE A;  4RI7 A;  4IGJ A;  3D6I A;  2VCX A;  4TXV A;  4ZIL A;  4KH7 A;  1OC3 A;  4G19 A;  3WT2 A;  1USB A;  5FHI A;  1QGV A;  2L59 A;  2H76 A;  3I9V 2;  4MJB A;  1UVZ A;  4YKG A;  3APQ A;  5B8B A;  3GYK A;  1EEJ A;  1PQN A;  1SK1 A;  3QMX A;  2R0C A;  4AF2 A;  2PGT A;  3GKK A;  1YQ1 A;  2GLR A;  2HSM A;  4XTS A;  3UBK A;  1NM3 A;  1A2J A;  2M80 A;  1URM A;  5G31 A;  2GZY A;  1YKA A;  2B5E A;  3GV1 A;  2JU5 A;  4N10 A;  1T1V A;  2VCQ A;  3EE2 A;  5J41 A;  3LYK A;  2VD0 A;  3F6F A;  1J0F A;  4MNN A;  2K9F A;  4YH2 A;  1A8Y A;  2RLI A;  4MZB A;  2DJ0 A;  4G10 A;  4XS6 A;  5LD0 A;  4NV5 A;  5CRE A;  2JZT A;  1EOH A;  1SKS B;  1F2E A;  2LNT A;  3H79 A;  3TRP A;  3R2Q A;  3HCZ A;  1WE0 A;  3NZN A;  2FWH A;  4MK3 A;  4N11 A;  5D9W A;  2ON5 A;  3ZVJ A;  4L0W A;  3KTB A;  2RUE A;  4WEY A;  3KZQ A;  4YAV A;  1M9B A;  5J4U A;  3A2X A;  3CTG A;  5D96 A;  2L4C A;  4J2F A;  3CRU A;  3FRC A;  1M2B A;  5JCU A;  3H93 A;  1UC7 A;  2LTK A;  2MMO A;  3VK9 A;  4KA0 A;  2EIQ A;  3L9V A;  5A4V A;  1PMT A;  2FNO A;  3DWV A;  4V2L A;  3DD3 A;  2HRA A;  4PQ1 A;  4IJI A;  2C3Q A;  3KD0 A;  1KBN A;  3N9J A;  1A0F A;  4TKY A;  4EL1 A;  1AC1 A;  16GS A;  5HR1 A;  3M9K A;  2PN8 A;  2YV9 A;  1XW5 A;  3RBT A;  2GQL A;  3BCK A;  1QUW A;  2DJ2 A;  3FW2 A;  2H30 A;  2YCD A;  1BX9 A;  4NV2 A;  3FZA A;  4FO5 A;  2CQ9 A;  4K0N A;  2HT9 A;  1JLV A;  2KLX A;  3ZML A;  1E2Y A;  2VD1 A;  5A4U A;  1EP7 A;  5H5Q A;  2WZ9 A;  2L4Q A;  1F3B A;  1N8J A;  1X0R A;  4TR1 B;  3LXZ A;  4X1U A;  4DSR A;  2G2Q A;  1OKD A;  2MZC A;  4IEL A;  3U5R E;  1G0T A;  1XZO A;  3E0U A;  1PL1 A;  4NHZ A;  1Q4J A;  2VOC A;  1KTE A;  1LU4 A;  3IXR A;  4XS1 A;  2CX3 A;  3G7J A;  5DQY A;  1M2D A;  3KMN A;  3LXT A;  2H75 A;  3W8J A;  4KDY A;  1J9B A;  2H0G A;  4N30 A;  3TKR A;  2OBK A;  1R26 A;  2PBJ A;  2R0G A;  3TKS C;  4O5R A;  2F8A A;  4A5P A;  1XOA A;  3HVS A;  4QQ7 A;  4KAE A;  3LW9 A;  3O3T A;  2R3X A;  2M46 A;  3IK9 A;  1MDJ A;  3ZL5 A;  1I5G A;  2H74 A;  1HD2 A;  1S3C A;  5G5F A;  3GX0 A;  5KOW A;  2MMA A;  4HEA 2;  4HJ2 A;  1T7P B;  1JZW A;  1KEB A;  4IQA A;  2HZF A;  3IBH A;  4ZL7 A;  3LWA A;  1ZL9 A;  4BL7 B;  1SJ6 A;  5KEJ A;  1TU8 A;  5JCG A;  3UOM A;  5DVB A;  5IOW A;  4GRF A;  2GZZ A;  3L78 A;  1U3I A;  2R4V A;  4FH8 A;  4V1A p;  3HZ4 A;  3VFI A;  3E3E A;  2LQQ A;  5IO0 A;  3M0F A;  1A23 A;  4Z2R A;  2P0G A;  3EMP A;  2FUG 2;  2F9S A;  1OE7 A;  4O32 A;  3UAR A;  4MF5 A;  1SD8 A;  3CSJ A;  5LCZ A;  1SYR A;  1Z5Y E;  2L5O A;  3D22 A;  4FYU A;  4XS4 B;  2WGR A;  4HZ4 A;  2VM1 A;  1B8X A;  2YP6 A;  1S3A A;  2A4H A;  3F6D A;  1QMV A;  3KMO A;  5CYY A;  1TRV A;  4IP6 A;  1G7E A;  2XBI A;  3GL3 A;  2X8H A;  5CO3 A;  5GZZ B;  3MYD A;  4HQZ A;  1R4W A;  4ZBD A;  2C8U A;  2GS3 A;  4IJ3 A;  1T4Y A;  2F51 A;  4JR6 A;  3CSH A;  2DMM A;  1FOV A;  2VCT A;  1NHO A;  3C7M A;  3UVT A;  7GSS A;  4DSS B;  1OKT A;  3ZIJ A;  5D8I A;  4ZBB A;  2DJ1 A;  3TKS E;  5E59 A;  1V98 A;  4Q5Q A;  5ELG A;  4MJA A;  4RUV A;  2B1K A;  3F8U A;  1TW9 A;  3GTU B;  2VCW A;  3KM6 A;  2IME A;  5J5N A;  2E0Q A;  4ECJ A;  1ZCP A;  2FWE A;  1GH2 A;  5GSS A;  4OD7 A;  4POB A;  1K3O A;  1K0O A;  1Z6M A;  4L0U A;  1YF1 A;  2PVQ A;  2WDU A;  1G6W A;  1XPV A;  2LJR A;  4FYC A;  3QPM A;  3WYW A;  3GNJ A;  4OO5 A;  3DGQ A;  4IKH A;  6GSX A;  4I2U A;  1GTB A;  4KE3 A;  2J9H A;  3ZVJ D;  1B48 A;  1GSU A;  2GDR A;  1MD3 A;  5DJL A;  2JZS A;  1A8L A;  1XOB A;  4RQR A;  4MPF A;  2PWJ A;  3RHB A;  2V6O A;  2ZNM A;  3WT1 A;  5ID2 A;  1Z3E A;  2VCV A;  4XRD A;  1THX A;  5KN3 A;  3LSZ A;  2H8L A;  2B3S A;  3KCM A;  18GS A;  2FA4 A;  4I2T A;  1DBY A;  2KHP A;  3UEM A;  1GTU A;  2MBT A;  2GGT A;  5ECR B;  2HSH A;  3IHQ A;  3MIX A;  2H73 A;  3VPT A;  2B7K A;  3TKP A;  3FHK A;  3TOU A;  4WBJ A;  2REM A;  1OC9 A;  4N0V A;  2RII A;  1TK8 B;  2X8G A;  2XPD A;  3GHA A;  2WRT A;  1TJD A;  1PD2 1;  2X64 A;  1B9Y C;  1ST9 A;  2N5A A;  1PSQ A;  2MYG A;  4ZL9 A;  3J7Y b;  4JR4 A;  3HJP A;  3VWU A;  1EGR A;  1XWA A;  1V40 A;  2OJL A;  1EP8 A;  4PGT A;  3L9U A;  1YF0 A;  4GSS A;  5AIX A;  5C00 A;  1N2A A;  5COH A;  5ECP B;  4AGS A;  5IMA A;  1TP9 A;  2ZUP A;  4KB3 A;  5G5E A;  4XHM A;  5E4W A;  2QA1 A;  2LRC A;  3LQ7 A;  5IMV A;  5HR0 A;  2C1Y A;  3RDW A;  2HZE B;  4Z2U A;  3QOU A;  2PUK C;  1JZD A;  1ERV A;  1Y25 A;  2V41 A;  2WFC A;  4MA9 A;  1PKW A;  2AV4 A;  4IVF A;  1VGL A;  4MDC A;  4TR3 A;  1O8X A;  1O73 A;  1OAZ A;  1J08 A;  2AHE A;  5DAK B;  2Z9S A;  4EUY A;  5EVO A;  3TJG A;  1PGT A;  1FW1 A;  3TOT A;  3IR4 A;  2HXK A;  1OE8 A;  1AXD A;  5ELA A;  5HFI A;  1Z9H A;  1XWC A;  2CAQ A;  3C1S A;  2H1A A;  2YOI A;  2E7P A;  3IOS A;  4POK A;  3VI7 A;  3O76 A;  5IMF A;  1O6J A;  1ZYP A;  2OAD A;  6GSY A;  3KEB A;  2WJU A;  1U87 A;  5C04 A;  3UJ1 A;  4K1F A;  4Q5F A;  4MJC A;  2J23 A;  1QFN A;  1V57 A;  1TOF A;  2JZR A;  1PX7 A;  5ECO B;  5B8A A;  2A2R A;  5IMC A;  1X9M B;  1AIU A;  14GS A;  2GT5 A;  2FWG A;  4DEJ A;  3QFA C;  22GS A;  4YQM A;  2PER A;  4BA7 A;  3KJY A;  4L5O A;  2LUS A;  3H1N A;  4N0Z A;  4F82 A;  2C0G A;  4EO3 A;  1WOU A;  1XWG A;  2TIR A;  3G7Y A;  3GH9 A;  4L5L A;  2V1M A;  2VAF A;  3FZ9 A;  2K8V A;  3D4T A;  1ERT A;  3US3 A;  1X5C A;  4MH3 A;  5IPG A;  2UZ8 A;  1S3D A;  3FEU A;  3RAZ A;  3MDK A;  2JAD A;  4LA1 A;  3D4M A;  1FB6 A;  4OWY A;  1SKR B;  2YWM A;  5DCH A;  2CAI A;  2GT6 A;  4FIW A;  2CZ3 A;  2XC2 A;  2XHF A;  4G0L A;  4KF9 A;  4EE0 A;  2C4J A;  4CY6 A;  3HJO A;  3QDN A;  3EVI A;  2GST A;  1M7T A;  2VLT A;  2YZU A;  4KX4 A;  3RHC A;  3GKN A;  1TRS A;  2HFD A;  5B6N A;  3SWL A;  2EC4 A;  1TI3 A;  1YY7 A;  5DDL A;  3ZRD A;  4AJ6 A;  2DIZ A;  4CY8 A;  1JZR A;  3A3T A;  4WR5 A;  5F07 A;  3FZ4 A;  1DUG A;  2QSI A;  4KW6 A;  1ABA A;  1X9W B;  2LQO A;  2O85 A;  1FO5 A;  4DVC A;  1XWK A;  5EL8 A;  3D0Z A;  1HNA A;  4JU5 A;  4K7O A;  3WGX A;  17GS A;  2H1G A;  3LG6 A;  4MZW A;  4IP1 A;  5H5R A;  4JBB A;  3C73 A;  1Q98 A;  1K3Y A;  1Z6N A;  4GCI A;  3L9S A;  3BD2 A;  2VL3 A;  4GQF A;  2HRN A;  3DRN A;  4ILF A;  5G30 A;  1DSB A;  3GA4 A;  1M2A A;  3EMX A;  5J9B A;  5AIS A;  2K18 A;  2YWI A;  2A4V A;  1EOG A;  5F8B A;  1LBK A;  2LJA A;  4PTS A;  2FCH A;  3L4N A;  4BL7 A;  4G0I A;  1G6Y A;  4X0X A;  5KN2 A;  4MCU A;  2JAC A;  1SK2 A;  1PL2 A;  3Q19 A;  1SL0 B;  3DML A;  2LNS A;  3CBU A;  3GN3 A;  4HZ2 A;  5ECI B;  4OFM A;  1VF1 A;  1C72 A;  1K0A A;  3AY8 A;  1WRY A;  1XW6 A;  3GRX A;  1M99 A;  3EIN A;  4EDZ A;  1O85 A;  2NBS A;  4HU9 A;  1JLW A;  2VL9 A;  4KCA A;  3Q6O A;  2OAC A;  4AJ8 A;  2DC5 A;  3QAG A;  3EC3 A;  4O5Q A;  2OE1 A;  4USS A;  3TKQ A;  4EDY A;  2GZP A;  2NDO A;  3APO A;  5B6M A;  1PKZ A;  2DSA A;  4ULX A;  3M9J A;  1AQW A;  4EXJ A;  2HI7 A;  1NHY A;  1FVJ A;  3UAP A;  5DBQ A;  1Y6E A;  4NWY A;  2L6C A;  2DIY A;  1K0N A;  1F6M C;  4PUA A;  1WMJ A;  4IW9 A;  1GLQ A;  3FR3 A;  4NXI A;  4F2I A;  3ERF A;  4BVY B;  2GSR A;  2L5L A;  4F0B A;  4MLY A;  4ACS A;  2WB9 A;  1K0D A;  3ZTL A;  3GTU A;  2I3Y A;  4ZXG A;  1EEM A;  1YJ6 A;  4FQU A;  1ACV A;  2O7K A;  5IOX A;  4E8E A;  1M0U A;  2C3T A;  2V32 A;  2KUC A;  1K0C A;  3PGT A;  1TRW A;  2HNL A;  4K8M A;  5FT3 A;  3CXG A;  5IM9 A;  2CT6 A;  3LFL A;  4TXO A;  3K8N A;  5BMU A;  2NTO A;  4PUR A;  3P7X A;  1YEX A;  1KNG A;  1EV9 A;  1XBS A;  3C1R A;  2NPB A;  1VF3 A;  2DBC A;  2YV7 A;  3QCP A;  1SJI A;  3HA9 A;  2VLV A;  4F0C A;  4K2D A;  2H6Z A;  2D2Z A;  2H6Y A;  2R37 A;  2LEG A;  2OE3 A;  2RM6 A;  2LS5 A;  2TRX A;  3CYN A;  5GAN D;  2B1L A;  2DKH A;  1B4Q A;  2GQK A;  2YPM A;  1H75 A;  1F37 A;  2AAW A;  2YWN A;  4J57 E;  2ES7 A;  2C3N A;  1GSY A;  3FMW A;  3TJB A;  1GL8 A;  2IJY A;  1K0M A;  3O6T A;  4IQ1 A;  4HUA A;  2FWF A;  2IMI A;  4ISD A;  1Z7R A;  3ZMK A;  4GSN A;  2IWT A;  4AJ7 A;  4ZB6 A;  3EWL A;  1X5E A;  2CVK A;  4GLT A;  1A2M A;  4KUN A;  3QR6 A;  1MTC A;  2NVL A;  4BVX A;  1GP1 A;  1AQV A;  1ZMA A;  3ME8 A;  1GUM A;  4LLR A;  1ZGN A;  4PQH A;  3U6V A;  3IHG A;  2X49 A;  2HLS A;  4WKW A;  3PR8 A;  1SK0 A;  4TOP A;  4HDE A;  1GSS A;  2XPE A;  5CP1 A;  4OO4 A;  3F4R A;  2IMF A;  1JFU A;  2PVO C;  3EYT A;  1TKD B;  2H71 A;  1JHB A;  2O87 A;  3MSZ A;  1B9X C;  3ZLP A;  1WIK A;  4WF4 A;  3VWX A;  3D5J A;  2IL3 A;  1GNW A;  5DAL A;  1R5A A;  3ZRE A;  4WR4 A;  4GQC A;  4Q5N A;  10GS A;  1THO A;  5JWQ B;  2BMX A;  4QL7 A;  5L71 A;  2M72 A;  3EU4 A;  3IRA A;  3DVX A;  1B4P A;  1XCC A;  4BWQ A;  1F9M A;  3M1G A;  2IN3 A;  1RW1 A;  2EIR A;  1NSW A;  2JL4 A;  4YQV A;  3F0I A;  1QQ2 A;  3ZZX A;  11GS A;  2LV3 A;  1FOH A;  2H66 A;  4MP4 A;  2CZ2 A;  5DAK A;  3ZFB A;  3HXS A;  5HR3 A;  1FG4 A;  4GF0 A;  4O5U A;  5CNW A;  19GS A;  3TJF A;  3GL5 A;  3M8N A;  2B6M A;  4CHS A;  6GSU A;  2LRN A;  1K0B A;  3UIW A;  1MDI A;  6GSS A;  4ECC A;  2IFQ A;  1YDK A;  3JCM L;  4PNG A;  5D9V A;  4ML1 A;  1BED A;  2X8C A;  5JWR B;  4EF0 A;  1WP0 A;  4ZL8 A;  5D9T A;  1W89 A;  3HVX A;  4MPG A;  4X43 A;  3VI5 A;  4Q5R A;  2CV4 A;  4J56 E;  1BQ7 A;  1X5D A;  3NIV A;  2JSZ A;  2JSY A;  2H19 A;  2QGV A;  5G1L A;  2K8S A;  4LMV A;  5JCW A;  3VUR A;  3D21 A;  4DSQ A;  4D73 B;  2IMD A;  4H86 A;  3BOA A;  1GRX A;  4KDX A;  1CQG A;  5F06 A;  1SEN A;  1ERW A;  1U88 A;  1PN9 A;  3E9J B;  1T4Z A;  3W6G A;  3QFB C;  4O7H A;  4BPY A;  1FVK A;  1PRX A;  1OVN A;  2QKE A;  5DCG A;  1O7U A;  3HY2 A;  5ID2 B;  3NOF A;  1PN0 A;  1ON4 A;  1A2L A;  1AUC A;  4ID0 A;  2GQM A;  5IMD A;  3P8W A;  2HE3 A;  1DE1 A;  5ECQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...