1XVSA

Crystal structure of apag protein from vibrio cholerae
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
124
structure length
124
Chain Sequence
b'MDVSLPCIKIQVQTRYIEEQSNPEYQRFVFAYLITIKNLSSQTVQLMSRRWLITDADGKQTVVEGDGVVGEQPRIKANDEYTYSSGTALDTPVGVMQGQYLMIDEQGESFTVEIEPFRLAVPHV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein apaG
publication title Crystal structure of apaG from Vibrio cholerae
rcsb
source organism Vibrio cholerae
molecule tags Structural genomics, unknown function
total genus 22
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04379 DUF525 ApaG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1470 Mainly Beta Sandwich Immunoglobulin-like ApaG domain 1xvsA00
1TZAA 5HDWA 2F1EA 1XQ4A 1XVSA
chains in the Genus database with same CATH superfamily
4KO7A 2E86A 3WXWH 3DURB 5CGTA 2AK4D 1NCBH 3C2SA 3E0GA 3U9PH 1QHQA 3CBRA 1MW0A 1YEJH 1GTFA 2ZUUA 2BSSB 1KV7A 5FYLL 2DWSA 3SDDB 3O2VL 1J5CA 1NCIA 3O8XA 3NTCL 2VLME 1B0WA 4OJFH 1MCWW 3L13A 4G6KH 4F7TB 4OSUL 2XTJB 4KWUA 2JB6A 4KKLC 4EJ1C 4KTEH 5F7EH 3ISRA 4N90D 4FI6A 3GMLA 1FIEA 4JPVL 5B3JF 4NJ9H 4LPWA 3SPIA 1LJMA 2G75B 2H2SC 5ID0B 5T1KD 1JWSA 4XPGL 3W2DH 3DGCR 5HVGB 3GMLB 5EZPA 1BW8A 3PAYA 3MGAA 4ODUB 2WHVA 1JVKA 3OX8A 3QEUB 1MJUL 1I1YB 3BAKA 3B34A 1FVDB 3BP6A 1A1OA 1G6RA 1MAKA 1U91A 4K73A 3OX8B 2P5EB 4OZHF 3VACA 3CSBA 3L3KA 1KTRL 3ZQ9A 1RZ8B 1OGAA 3TO4A 3VW3L 2FO4A 1HHGB 4RRPG 4AT6B 3L3KB 3ZTJG 2KPWA 3BXNA 4H0IA 4IK6A 3PIQA 1OGAB 1Z5HA 2G4GA 2IFFL 4PBWD 4F8TA 5HYFA 5CZVL 4PJCF 5ESAA 3IRPX 3PABB 2ZX6A 1T0MB 4KJQC 4N22A 1YN6A 1T1XA 1NOLA 3LEYL 4Z7UE 5FECA 4PBXA 2FX7L 2NY2B 4ZAKB 5ESAB 3KGTA 1JNNH 4G6AC 4PVBA 1T1XB 3BN9C 3FONB 3MGOB 4M1CC 2JKLA 1A6ZB 4PS4H 3D39A 5I30L 5I6KA 4E9QA 5DMGC 5LGJB 1KEML 3AAZA 3PAZA 1BYOA 5HDBB 4GI6A 4M5TA 2RD0A 2V17L 3BKJH 4OF6A 4PJEE 5F9WC 1CBVL 2VT0A 3T0DA 2R23B 3ETTA 2WLKA 5BW7A 3E9TA 1EZVY 4CMMA 5C0AD 3F7RA 3DRQA 3WKYA 5IMKA 2GC7C 3NH7L 4FNUA 2VOTA 3TTYA 1LEIA 5JORA 3VD9A 2PYED 1L9RA 1XCTA 1LP9E 2VN7A 3KPMB 4NC0B 2X4UA 1OTTC 1BQLH 1JPFA 3DRQB 4JFQB 3P3TA 3X1BA 5IMKB 2QADC 5C97A 1EERB 1U3HD 4OGAD 5FUZH 1G7MA 3HS8A 4N0CC 1QFWL 4OVUA 1C1EL 2QVIA 1NWPA 3RZWA 3ARGA 3FCBA 1JN6A 3LPOA 4U7MA 1S9KC 1I9RL 2CJSA 3NDYE 4KFMA 3R7QA 3DX3A 4BFFA 2QPDB 4JHVA 4LK4A 3ARGB 4G7QB 1JN6B 2GY5A 4XAKD 1G7LA 5JPNB 5JLZB 1WHOA 3VD7A 2ESVD 2VABA 1E9QA 4O2CB 1BQKA 2LAAA 2Q76A 4KXZI 1UWEL 5I74B 1UA3A 5CMAB 2F7PA 2WXGA 5BUPA 3CVCA 1LO0L 1NJ9B 5JR1L 1E9QB 1TYJA 2UZIH 5EH1A 1FSKC 3BKYH 1Q90A 3AREB 3FOMA 2COQA 1IM3D 2Q76B 4DTGH 1OP3H 3FRPG 2BOLA 1B3IA 5HYJE 1FL6A 3JVFC 1YEFH 2J2ZB 4YWGH 1R19A 3F7LA 3GINA 4YC2B 5T3XL 2P8PB 4ZSOA 1PLAA 4R5XA 2HTLC 4JDEA 1T66C 3THMH 3VQLA 3UZQB 5AB0A 3SDYH 4RAVA 5EEXA 4GO9A 1FL6B 2X88A 3UJJH 4ZS7L 3T2NH 2DICA 4ZSOB 3IMTA 3APNA 1RPQA 2WVVA 4XVUD 2OMTA 1KYFA 1A3QA 1MLCB 4GAJH 4KI5D 4U1IB 3GXFA 3MBXH 1INQA 3DTXB 4MTMA 1FZKB 3EDEA 2Y5TB 2EE2A 2WIIB 1LXMA 3BVWA 4JFYA 4PRHE 4XNQB 1N0LB 1OP3K 3D3VB 3GPEA 4GFXA 4ZFZB 2ETWA 1TT6A 4P2OA 4W9JC 3EJYD 4PHXA 4F2MA 4WW1B 1X9UA 4N2IA 5C0GA 2GUYA 3H42H 3QR0A 2VR3A 5FO7A 4HIEA 4L4TE 5JW4M 1X5ZA 5IR1B 5JNYB 4F2MB 3MRIA 4MNQA 4QAMB 1NUGA 4Z3HA 2WZPD 1WGOA 4HIEB 4DO6A 3HI6L 1XGRA 4W9CC 4LMQI 4JG1L 3MRIB 2NR6D 1U8HB 4MNQB 5CZKA 4QXUL 3FU3A 5DSCB 1J10A 1L7TL 3VXRD 1PZ5B 3PGDB 4QWWD 4NNXA 1AS8A 3WEXB 3OZ9L 3FAWA 2XV6B 2EXWD 1L5GB 1C16A 1MWAH 4HJGA 5C09A 2F1EA 2WWOA 4NNXB 1O7DE 3X13A 4Q2ZA 4DIXA 5I1HH 3QUMA 4MD5B 3U25A 3JZ7A 3OMAB 4KKNA 4P3CH 4FQIL 3H9SD 2X4QA 3M8OL 2AKRB 2MPVA 2EE3A 3X13B 1H19A 4Q2ZB 3W5MA 1HL8A 4IRZL 3L8QA 2H45A 4J4PD 5D5ME 4EVNB 2XV2A 3DX7B 3U46A 2ARJQ 4WI2A 4DGUA 3FSAA 5IP4A 4TQEL 5E5UB 3MJ8B 5L2KE 5CINL 2HX8A 4ONOA 1RU9L 3O3EB 3VQ2C 1J1OH 1B4RA 4Y88A 2ZXDA 1UZ6F 2H7WA 2HPTA 2XN0A 1AH1A 1J0JA 4LQFH 4ZUVA 2ICWB 3FHAA 4W6YB 2EIDA 5CWSA 2XPGA 5TF1L 4PGZA 1AO7B 1AZUA 4HBCH 4F91B 4EZMA 1UUSA 2KLSA 1BMZA 2YMXH 4ZUVB 3AGWA 4Z3GA 1F58H 2K9FB 5CWSB 1UH3A 1W91A 1UYWL 4N0FA 5JDJA 4PLKD 2A4EA 3KWWA 2A6IB 3ILQD 4NP4H 1X5XA 4N0FB 4NPKA 3ZYJA 1O7DC 1H9VA 1WWBX 3WJMA 5D7LE 2YUZA 3B9KC 4K3JL 1MHEA 3DV4B 3SDDD 4O4YH 1XF5B 4KI1A 3HNSL 3HE7A 4Y2OA 3NJGA 4JBSA 3NFSL 3QJFB 3J07A 3BN3B 1TPXB 2EO1A 3BSGA 5ESQB 5AW9B 2J8UE 5E8NA 4GT7A 3KW8A 4LLAA 4XAWL 1ZSHA 3HE7B 3WGUB 4W9KC 4CSPA 5FWRA 1OQXA 3HFFA 4E9SA 4RVBA 4LVNB 4UNVA 5GGRB 1XIWA 5LUMA 3ZL2A 1H8SA 1ZS8B 2Y7OA 2CK2A 3BVUA 3HE6B 4Q8BA 4I0PA 3FQNA 3JV4A 3R1GL 3QYCA 3QDJB 4O00A 3HC3L 3F65A 5LCVA 1J9QA 1FC1A 4I0PB 3OB8A 4LCWE 4IKJA 1SNRA 3GSNH 3LN9A 1EPFA 1BLNA 3Q13A 1G7HB 5BMFL 3QORD 4K55A 4LLWB 3S3DB 2ZXQA 3NABL 2P5ED 3VRIA 3LHAA 4N0UA 4YSSA 4NC2B 1C5BH 1UHVA 3SYOA 4I89A 3S96A 4JE4B 4F8PA 2HKFH 5JW5B 4J3OF 3JYBA 1N2RA 1G84A 2FGWH 1G9MH 3CZGA 1AJ7H 4NQDE 5K9OA 1N59A 5AAWC 1G94A 4Z7QB 1WPCA 5FYLE 3H0TA 5LWYL 2PWEA 4P5TC 3RUGA 2TAAA 5K9OB 1N59B 5I1AB 4X7SL 5ECJE 3SDAA 1JHKH 4WU7B 1RHFA 3RY6A 3E2HB 4A6YL 1DUYB 3RUGB 4AYEC 1NKGA 3ATEA 2H3NA 1YMME 1ODUA 4W6XB 3CPUA 2MQCA 4RRPM 1D9KD 5IQLA 3U1QA 1JWUA 3VRLE 1DYZA 1YRKA 3VQMA 2TSBA 3IMVA 2GT9A 3RGVA 1W9XA 1H8NA 2H3NB 4E5XA 2ZJSL 4HKZA 3OKEB 3ME0A 3QDHA 4L2LA 2FL5B 4RFNC 4WI0A 5I19L 2GT9B 3VXMA 4P4KC 4NYLA 2X70A 4B41A 4YX2H 4HKZB 4TUOB 5KBPA 5E99L 4NZFA 4XXDA 4LEOA 5F89A 1R4XA 5IW3A 3VXMB 5T33L 2HFTA 1H3VA 5GZOC 2BIQA 2VMDA 2WNXA 3MR9A 4YS4A 5EF0A 4MMZC 4KK6D 4XXDB 5EZLA 4NNYB 5D2LE 1JS4A 1SN5A 2JKJA 5GGVL 2WVUA 3RWDA 1DFBH 2IV9A 5CBEB 3TJEH 1DBJL 3VH8B 1UB6A 3TZVA 5JQIB 1AR1B 3PWNA 3L9RB 3VRJB 1MI5B 3HVNA 1II4E 2HH0H 5A2IH 3NUKA 1BPVA 2DQCL 2X4TB 4HFUH 4YDVA 1PZBA 3T3PE 2NNAA 2PTVA 2W8CA 1H3UA 1CTNA 1YJDH 4A55A 3E8VA 4GUOA 1BZ7B 4Y2DC 2IH8A 1OF2A 1SJVA 2YK1L 3HG1E 4WVRA 4XN5A 4YDVB 4Y4HD 2PP7A 3ZLQC 3N0AA 5A3ID 1JERA 1G6RL 3W0WD 3I85A 1HXKA 4F20A 4AEHL 3ARED 3MRHB 5I18H 1OKEA 2FNBA 4DGIH 1LO3H 2R0LH 4HKXB 4H0HB 2P24A 5EDXA 1GYUA 4AJ0A 3QBTB 4WI5A 3RWCB 2ADIA 4N2AA 3QRGH 2BRRH 5C8JB 1RZ7H 3QNXB 2PTTB 4RGMB 3LPWA 3ZSSA 1JGLL 3ZO9A 2VKXA 3SDXF 4MAUH 2ADIB 4WHDA 4EZKA 15C8L 1E4XI 1SLWA 3G6DL 3K1DA 4NKMA 3IAQA 1T22A 4G6JH 2O5YL 2DWDB 4TQ8A 3BUBA 2X2JA 1V05A 4OZHB 5BO1H 1EA9C 5FW6A 4CDGC 1UCBL 1S78C 1BIIB 3O4LD 2MH4A 2CHDA 4GFTB 4PJCA 4ZMQA 5F0LB 3ZE1E 3P30L 4UU9A 1VDGA 3SQOH 1CFSA 1SHMA 3HW7A 1WAEA 3QAZC 5KSVA 2VRQA 2XXMB 4KMTL 1TKWA 1QA9A 3S88L 2BVPA 4PJCB 5JIPA 3SCMA 3N44F 3N0PB 4JGMA 4GP4B 2KZBA 5DRXB 4YGVA 5KSVB 5DS1A 1JGVH 2W5PA 2YEZA 4WFHE 1XGZA 5CJQL 2FZ3A 4BQBA 2VCOA 3EFFB 4JQXC 2VH5L 5ISZE 2ZWLT 1IGCL 4M62H 1R33A 5I82A 4MFHA 1X5JA 3FSVA 5BV7B 3C5ZC 4AKOA 3DHPA 5T3XE 3GGWA 3VMPA 3W1ZA 1JI1A 1MPAL 4GIAA 1J9TA 4FS0A 4HEME 3GLEA 1CFVL 4GSDH 3UJTH 1CFNA 4A2GA 5BS0A 4OZFB 4PRPD 4DP6X 3VXNB 5HP5A 2OK0H 1IGTB 3VI4F 3OMZA 1NINA 4JW3A 4IDJH 2FB4L 3U0PA 5DTFB 4EN2A 1CFNB 2EDQA 5BS0B 3QYNA 4MXVF 5DLML 1BZOA 2K7PA 4ENED 3X3FH 4GKOA 1OVZA 4FFZH 3IVKA 1FYTD 3B5TA 5FYJL 1UD2A 1BF8A 4NFCA 2VE6A 5DRZB 3QWOB 2BFVH 3QJQB 3QEQE 1DHKA 3KPLB 3SKUD 1CDCA 1QFUH 4NQVA 4WEMB 1PG7W 4YUEH 1H3PL 3W9EB 1FNSL 4MSWB 2VE6B 3Q1SH 4HIHA 4NUMA 5AALA 4AMKL 4DT2A 3QXVA 4IEFA 3V0VB 4UQ2A 3LDBB 1DQQB 1U33A 4FXGA 1OP9A 2MHAA 1AO7D 4HIHB 3US9A 1QWHA 3VFUA 4PRDA 4UILL 5HTSA 5JPMB 3O0RH 1WG3A 4IRJC 2VSKB 3D2TA 3K8KA 5TK2A 5DUML 1U95B 3FBQA 1ZS2A 2IC2A 4AZ8B 3S37L 1Z5LB 3UG3A 3U7WL 3IGFA 2LVEA 5I1DA 1NBZA 4AEFA 1HTYA 3OHXB 2YEVB 2C3GA 2F8XC 1KTKE 1DJXA 1VAHA 5CZXD 4XGZA 1N5YH 4ZTOH 5I1DB 2BFGA 2CO6A 4DHLA 2FIKA 3BQVA 4BCXA 3KLDA 4XGZB 4YSEA 3Q0HA 2A6KA 4XXWA 4UQ9A 3IBOA 1NICA 1GZQA 4AW7A 5I1EL 3TASA 1MQ8A 4IBSA 4FLQA 1IV8A 3MYJA 3JTBA 4EE2A 3CDYA 5GIRB 4AZUA 3U2SB 3MLYH 3CFKB 1MHPH 5FV1L 3QDJD 1G9HA 3R19A 5GGUA 2VL5B 2Q7YB 4LOUC 3BWAA 3ISYA 3BP4A 3OSKA 2NY0B 1OTUD 3V6BR 4WLCA 3L1OL 3BWAB 3L45A 3QUML 1RUML 4GY4A 4NRXB 4WNQB 2GQHA 4DKTA 1R3HB 2AK1L 1DVFD 4FLRA 5B1JC 4L4VA 3VXQB 3TFKD 5KYYA 4PY7A 4NN5B 3EGSB 5IY5B 4IGBA 3SKOA 3V0WL 1G7PA 5MENE 4YN3A 5JYMA 2W38A 3QH3B 3H7LA 2EEDA 1CGYA 4FFTA 4GRLD 4IGBB 1JZ7A 3NZUA 1P4BL 3LQAC 2XKNA 4PEEA 2H32H 1VCBC 5D7KE 4JRXD 4I18A 5H94A 1H3XA 5I0DA 1FYHB 5ICXA 4Z7WB 5CJXC 4NSKA 2VITB 2QSVA 2GKIA 1WC7A 1WBZB 2GJZA 4PBVC 3H53A 5H94B 4AYGA 2DMKA 3Q01A 1BPLB 4OLVH 4FRWA 5ICXB 4YFEA 5DD1L 4KNUA 1HS6A 4S1SL 4M3KB 1QSED 5I1JH 2QSQA 3MACH 1QBLH 4M8QB 4HS6B 2XICA 3R18A 2IXQA 2CJ3A 4BDVA 3JT0A 1YVLA 2XWTA 3D1MC 3B9DA 2ADGA 4HU2A 4ZMPA 2WANA 4KQ3L 3DXAE 3KPOB 3QDME 4GINA 3W82A 2AJXL 5DUBB 4NGHH 2ADGB 1JYNA 3KPQA 4RGNB 3U0WH 2EDLA 3C12A 5TJWK 1IFRA 4QJ5B 3DX9A 3GT6A 3LQMA 1H6TA 1CL7L 1MFUA 3KPQB 3S3PA 1FAIH 3KW7A 3WNMA 3N1GC 3MROB 3LY6A 4ANWA 4NRZA 3V0AC 2JKWA 3K6OA 3P9LA 2DQEL 3KPPA 1WZKA 1X6LA 3RNKA 4DOHE 2LU3A 3MN8A 3PGCA 4YDLC 5DMIH 4RZCB 4TPRL 1Q9OA 1XT5A 5CJ5A 5H37A 4GMTL 1V7NH 4N2DA 3R06A 3WLBA 3MOQA 4PJHF 1J8HA 1F86A 4OFKA 5KYXA 4J8RB 5EZJB 4X5XA 5ITBH 2ENJA 3LKQA 3MLPA 5E2JA 5T8IA 1J8HB 2ZCZA 5CLTA 4WV1B 3Q05A 2GIXA 3LKQB 1WD8A 3F7YB 1SLXA 2JIXA 5E4OA 5AVYB 5IBTH 4HBQA 4M8UA 1DQTA 1HYSD 2A77L 3TA3C 1GC1H 1W0YT 3CFTA 5TE6L 3ZXAC 3IGAA 4OGYH 3W37A 1FPTL 2EILB 3LNFA 5E8PA 3PAUA 1M1XB 1CQKA 4APQD 1DVQA 3M1OA 4UUJA 4XMKH 1XGYH 3IGAB 1JRHI 1FFNA 3L5HA 3BAIA 3EJUA 5DJAB 4UUJB 3SPHA 2E9JA 1G1KA 1FFNB 2YPVH 3EYQC 1JTOA 2NUTA 5HGGS 5BCAA 1BG1A 4GBXB 5CD3A 1OCRB 2E8YA 1GIGH 4HQQL 5C07E 2VQ1A 4EMZA 1E6JL 2ICEB 4MA7H 2AMUA 3EDFA 5CD3B 1UFGA 1SF5A 4YPGB 3F6LA 1J7VR 2BW5A 4GSQA 4FNLL 3RVXD 3P54A 1XR8A 1TTBA 3E6HA 5JZ7C 4JPIA 1BD2D 1WBYA 3QUZD 4CSZA 3BVTA 1ZHNA 2BNRE 3BP7A 3O8XC 5FGCB 3UO8B 2RMNA 2N1TE 3DX2A 4L9LC 1AGFB 1ZKAA 4H8VA 4XOEA 5C0BB 2FQGA 4FE9A 4D3CH 3BAWA 2BMKA 5MERB 2BINA 4KRLB 4M1GL 2BJMH 5D7JD 3ZKMC 1T20B 1T1YB 3RIKA 3ARRA 4OCSL 5DQ9B 2EO9A 4MXQD 5ID1B 5F6HI 3ROLB 1PYWB 5AG9A 3LKRB 1RIVH 3MRMA 3FF7A 1KGYE 2NCEA 1T03H 3MLVL 4YL4A 3DK2A 2IPTL 4RCAA 2EE0A 2IBGA 2X28A 4HGWA 2CIKB 3FTYA 4QF1A 4OU3A 3MRMB 1T0PB 5DD5L 2HJKA 1K6QH 1ROCA 5BOJA 3IPFA 3V7MA 4WKZA 2MCAA 5C6PB 3O6LL 1A3RL 1NAKH 4U6YB 4E42A 4YSCA 4Z6AT 3IGKA 4OCXH 3FTXA 2P48B 3BPNB 3MNZB 5MEQA 5AB1A 4PVLA 4LPYA 4P46B 5C86A 4LCIL 4UNTA 5A2KH 4J3VA 2DMCA 1U8JA 2WSKA 3GHPA 3ZHNA 4U49A 5MEQB 4KBPA 1UA6H 2VLKA 4OZIF 2Q0ZX 4NZUH 2ZOTA 3M17B 2BPBA 4LP8A 4DUWA 1U8JB 2FE0A 4NENA 5GGSY 4EDXA 5I0WA 3GI9H 3FT2A 1RK7A 2MNWA 2C8NA 1BQHB 1X5LA 4IDLA 1JDCA 2C26A 4NZTH 3SDXB 2R2EB 3AU1A 1EO5A 3DIFA 3OG6B 1MCPL 4HU8A 3QQ3B 1UXMA 4AGNA 12E8L 1VRSA 2EIZB 1IKFL 1P5UB 2JJWA 3QFDA 4ZNCD 3AU1B 4P3DB 2P47B 2A1WL 3RZCB 3CSPA 2UY6B 1IZJA 3NCCB 2P43B 4PGDA 3U9UA 4HUWA 4ZTEA 2JJTA 5EDSA 3KLSA 3TBBA 2E47A 3PL6B 5BW7C 3ARFB 4X6FB 4IRSA 2F53A 1YQ2A 1A7BA 4OM1L 4NOBA 3P69A 3VGAB 1BF2A 2F53B 4WCYH 5FYKU 1DCEA 4PY8J 1FFRA 4LFHD 1K2DA 1FNEA 5AAPA 3N44B 1OAZL 3PHQB 3BRGC 4UDUA 4ZT1A 4UIMB 3B2PA 1T7WA 2Y3AA 2ITCA 3LD8C 1K2DB 1FNEB 3D0VB 5BO0D 1KCVH 4XMLL 5FUCE 3S8WA 5ABZA 2HG0A 2VUYA 2GK0A 3TEYA 4HWZA 1MFDL 4EUPB 4BSVA 1Z9SA 2I60H 1EFXD 2NXZB 4N9GA 5BJTA 2WUBL 4AYMC 1DDHA 3OXRA 4BSVB 1TJIL 2ZF8A 1Z9SB 4ES8A 4MDIB 5DCCA 1JWMB 2F18A 2K4AA 1CDUA 2C1PA 5FYKD 2E56A 2NTFA 4FL4C 3VI4B 2W88A 2F19L 2ITDB 5E2UL 1CGXA 1MFCL 3FTUA 1QX1A 1DE4B 1SLVA 5F7DB 3RA7H 4WF7A 2AXGB 2NTFB 4TF4A 3LSOA 4TS6A 2M8XA 4HHWA 2ZSVB 3BKMH 3G9VA 4YSAA 1J1PL 5D1QB 3IFOA 4FQJH 3C60C 2QPFA 1X5IA 4ICXA 5D1XB 2CAKA 2JNZA 3RIFK 1KFAL 5C09E 4J3WA 4YE0A 2DLHA 1YEDB 5E00A 3VXTA 2UXTA 4KNTA 1IGJA 2KDGA 4FCAA 4S11A 4WUUA 4GQZA 3HRZC 4ANVA 3S36X 4A2HA 3N41F 4NQED 5E56A 2JB5L 4PCYA 3TN0A 3T2PA 3DUUB 4I77L 4LEXH 4JFPB 1WTLA 3F58L 3KXFA 1G9NH 3U6RA 1SHWA 4TQHA 4AWJC 3G6JF 3ZHKA 1FZJA 3VFVA 4MB4A 3FTWA 3MV9E 4K23H 1JTPA 2JV6A 5FM4A 2HLEB 3R7RA 1FZJB 2BHFA 3IJHA 2IMNA 1XH3B 4ZUUB 5K93A 5TFSL 3VFVB 3KPSA 3JXAA 5ICUA 3T04D 2XWXA 5K9JH 2XQBH 3MLSL 4M3HA 2DQHL 1N7ML 4F37K 4QEGA 1YYMH 3K81A 5CEZH 2BC4B 1GS7A 4ODVH 5B8CC 5IT2L 4N6QA 1MWAA 1I1AB 3A67L 4UAOC 4I48B 4U1JB 1W16A 2AEPL 4ANKA 1M7XA 2OXHA 1MWAB 4L1DA 2IEPA 4Y4FC 4Q4IA 3Q7JA 5KANG 1F1AA 1RSFA 5I1CL 4ZFGH 1A6TA 4OZGE 1I8KA 5GS0D 4K3DL 4ZW6A 2IGFL 1QUNA 4H88H 5MI0C 4M5YL 5IMOA 4NQXB 4NLHA 8FABA 1A6TB 3MBEA 1X5GA 2AJYL 2Q8BH 1QUNB 3AITA 4IJ3C 3EGDB 2DM2A 2H41A 2XA3A 1NCOA 5F8QC 2CCLA 1AGBB 1TQVA 3FU5A 3IDJB 1PY4A 2AK4A 3BOVA 4PUBL 1HEHC 2B7DT 1E9PB 4G9DB 4XMXA 2CKBH 4OIBA 2E46A 1G9EA 2LT9A 3CSGA 3AUVA 1M71A 2BIIA 5JQ6L 1AQHA 1I82A 4RGOL 4HDIA 4OQTH 3RPIA 3HI5H 4IOFC 3PNRB 3G6AB 2C34A 4GBXD 5D7IF 3B6SB 4MB5A 3WN6A 4JFEB 5JXED 1M71B 1OY3B 3PNWB 4LCCA 2ZUYA 3RPIB 1EAQA 1CC3A 2ZCKL 4GQ9L 3FF8A 3HFMH 1DJGA 2YKLH 4OCMC 4P4RB 3MHZA 4XCNA 1EBAA 3HBZA 4JO2L 4H0GA 5AVQB 4KTGA 3FO0H 3MOBH 5GSVA 4K0OA 3T65A 5FB8A 2J3SA 5L2JA 3F8UB 1KCSL 4EKJA 2DIBA 3HMWL 2PPDA 1IQWH 1KXQA 5TQ0L 3J8F7 3T65B 4G7SB 2OJ1A 3LXCA 5C0BD 2J43A 5L2JB 1NM4A 5TDNA 3SY6A 5D70H 3BD3A 2W07B 4KHXL 3E8UL 3ARSA 5EBMA 3LZNA 5DK3A 2BVQB 4JKWA 5FO9A 5TDNB 3WHXA 4R0LA 3WKMH 1Y0LA 1BVOA 4KX8A 2BIMA 4PTTB 3BE1H 2A0LC 4ICWA 1L3WA 2DLIA 2L8AA 3GSNA 5FO9B 1U58A 5EZIL 4XBEL 25C8H 2YGQA 1D5XB 3FO9A 3MO1A 2W65B 4M9OA 3HZVA 2ZYSA 3MV7B 3L3IA 2YLHA 3ZZSA 1U58B 2OYKA 5LN8A 1L0QA 3BJLA 1MCOL 1L0XA 1Q4NX 1KTDA 1CGTA 4BZ2H 2B4CL 4R97C 5F44A 2R4RH 1F0LA 1J88A 1SQMA 4JY6A 1U2YA 4PJHA 5IESH 1CLYH 2FAUA 4FJYA 3MUY1 1D5RA 4N3UA 3MRBA 3P0VL 2NQDA 1A6VL 3RVTD 4QO1B 4PJHB 1YUHB 5AUMA 1O9ZA 2YGVA 4AV5A 3G5XB 3SYAA 1S9YA 3MRBB 1QBML 3VSQA 4CU7A 1A8JH 3HBPA 2BVEA 1EJ8A 3FSZA 3MGTB 3KCPA 1YNLL 2V9UA 1F02I 1OTSD 1S9YB 5GHWH 4DAGH 2VQ4A 2YS4A 2X1QA 3DDFA 2X40A 3RBGA 2AC0A 3X3GH 3MNVA 4DCQA 1AYOA 3KWXA 3MRNA 5HPOA 3L48A 3KCPB 3S5LA 4TQPA 3FFCE 3EO1B 4WW2C 2ITFA 1U3HA 2L04A 2EDBA 3R4RA 1NCBL 3U9PL 4IU3A 3HS0B 1BBJA 4WK0B 5KTEL 1YEJL 3SQBA 3WEBA 2ZCHH 4GKSB 4QHKI 3PL6D 4YHYC 1CE1H 1CGVA 4FQQA 4RH4A 3CH1A 4A7TA 4P99A 4O02B 1BBJB 4PJ8D 1WCBA 4AQEB 1TIUA 2OX5B 1UD4A 4AQOA 3I6GA 3FQRA 1GY1A 4OJFL 3CH1B 1A1NA 4G6KL 4KUCF 1TTCA 4KTEL 5F7EL 1R3KA 1JPGB 1UM4H 4LSPH 3FQRB 4Y4KA 4FTVB 2X3BA 1E90A 2BSBA 4R5VA 4TUUA 1TVBB 5DT1H 1R3KB 3W57A 3LRSA 2VXTH 1YZZA 1G7JB 5FYKH 1A4KB 3V6OA 3V10A 5DJ0A 1LHZA 4WJKB 3QHZH 1N9PA 1A6WH 2X4SA 4MKMA 5DVPA 3RFZC 4NP9A 4LASL 5DJ0B 1NLDH 1J05A 1CXEA 1R24A 3PXJA 4PLOB 2PXYD 2NY6D 2OJEB 4JZOB 2VDLH 5EUKA 2V2WA 4C57C 1XDTT 2QQLH 2MFNA 2MEJB 3F3HA 1HIMH 3WFDH 2J8OA 4Y19D 4OGQC 2V2WB 1WV7T 4HETA 2I9TA 1X3DA 4L3EA 2G60H 4PJ9A 1T5WA 3I75B 2NQCA 1PTZA 2EEFA 1PFOA 1HWHB 2APFA 1VZIA 5F70A 2I9TB 1KELH 2HA1A 4U3SA 4HIQA 3TWYA 2FCBA 4PLJD 3T3ME 4PJ9B 4Z5RA 1F8TH 1JNNL 3WNNA 1WFJA 2AERT 3DIDA 3AXHA 5FKAB 5I8KL 3VU2A 5SWZB 1EZSA 3BMWA 2N01B 1EAPA 4WTZG 4WFGD 1JHTA 1CDJA 1U6AH 3KEHA 1OO2A 1Q9WB 4UI2A 1HZHH 2NR6A 2IAMD 3LN4A 2NSQA 1U8OA 1EAPB 4LCUB 3F84A 3AQXA 1E8XA 2XN9E 1BGXL 1AG6A 1B88A 1DN0A 1S7SB 1U8OB 3OV6A 3MJ7B 4OZIB 4BSWA 5CKAA 3M7FB 4POZC 2B3RA 1K8IA 3UBXG 2V8MA 3V5HA 3TEXA 2VAAA 1JGUH 1J5IA 1A0QL 4M29A 3CVIH 1GAFL 3C6EA 4A7SA 1JMZA 2ICES 2OMUB 1WYJA 1LDPH 5I16A 3K2UH 2IBZX 1QLEB 4QAWA 3V5HB 4CVZB 5F7KC 4UBDC 1LO4H 4RDQF 1AACA 3CMOL 2Q7NA 5GRXG 4BWWA 3APMA 4PRAB 4ODTH 2W0LA 1OLZA 4ZYKB 3MUJA 4CL7A 3VJ6B 5DRNB 4K9EH 5C0CA 1FBIL 1BVNP 4FFZA 4PG9A 4XVOA 1RHHB 2OS7A 4NO5B 3RB5A 2UZIL 5HHNA 3TV3L 1M7IA 4GMSH 1A3ZA 2VLJA 3MQIA 4PG9B 4I5BA 5FGBA 2VC2L 3S4SB 4DTGL 3K6NA 5ADPH 4N5ED 4F7PA 1WAAE 1HOEA 1YEFL 2VLJB 2IAAC 3DMMD 4I5BB 4YWGL 5DD0H 5LNGA 2J20A 3MXWH 1ZOXA 4FFYH 3GBEA 4GG8A 3THML 1T5XB 3T0VA 3SDYL 1QSFD 3TCXA 3UJJL 3T2NL 3I9IA 4ODBD 2WTPA 3O11B 1U8KA 1Y07A 2GG1A 4Y5XA 4F37F 3JWDH 3V4VB 2BCKA 2MCPH 4GAJL 5DJXA 4PS7A 1DJYA 3MBXL 5DMKB 1U8KB 2O5NA 4PJ5D 4Y5XB 1HH9B 3RWGA 3RX5A 1S7VA 4JFOB 5IB5A 4KZDH 3C5XA 3M88A 5DD6A 4R96B 4N1EA 4D94A 4N5UA 3BQUA 3KL5A 2FJHA 3DO7B 1S7VB 1XFPA 5FS5A 3H42L 4O2EA 2VMFA 5LNEA 5F0PB 5E24E 4DK5A 3BQUB 3LZRA 4FJ6A 4I9WE 4UQ3A 4X5LA 4KK8D 2AVFA 4O2EB 2CHNA 1KPVB 2F54B 4U1GC 1CYWA 2PW2A 3RWEA 1HXYA 3KNBA 4J3UA 4UQ3B 4XCEB 1JFHA 2XU9A 5IWLC 5DC0A 1VENA 3IJEA 3QORA 1XHHA 1EDHA 3FB7A 1WA2X 3L3OA 3FUHA 5DJ6A 3V79C 5EF3A 3EJTA 1HVXA 3KNBB 3N41B 1ZVSA 3NCEB 3IJEB 5D2NE 3FB7B 4GSRA 5DJ6B 5SWSB 4RMUA 4YHIA 3QZNA 4MXWH 1MUJB 4R3SB 3UTSE 4JFFA 4KROB 5I1HL 1NC4B 1VEMA 4D9LH 3G6JB 4P3CL 1UT2A 3NSDA 4G5ZH 4KDTA 5DJYA 2L0DA 4M6NH 4JFFB 1B0RB 3RAJH 4J27A 1NCAL 4O5LH 3NGBB 5DJYB 4XN9A 3NVQA 4MA1B 3TTSA 3BFWA 1E8ZA 4XBMA 2B5IB 2HKAA 1P69B 2F9BT 1D9KA 3DSFH 4Z23A 1ZE3H 4YDJB 2H3XC 1GW0A 2OM5A 3BPCB 4HX1A 1LO2H 1J1OL 3GK8H 5IQNA 1JF6A 5CXPA 3NZHH 5HYSB 4HJ0C 4ADJA 5MHSE 2H32A 3M1CA 3RDJA 3Q2LA 2A99A 2X3AA 2E74C 2FYVA 4P2QE 5TTRA 1YLBB 1U8QB 4HBCL 4ZOAA 4KK9D 1VFBB 2YMXL 5F9JA 3U36A 5CEYB 4OT1H 1F58L 3FUNA 2V7NB 5LKNA 1YNKL 3REWA 2UWEA 5D2NC 2DQTH 5E2TH 1TVDA 4YLBA 1LO5B 2QSCL 4KH9A 3U36B 4PGEB 4HF5H 3D2UD 2V4LA 4JFZH 1ITCA 3IT8D 1GGCL 4KDWA 3GJEB 1OK8A 4L8SA 4O4YL 4MBRA 4XTRC 3DARA 4UDTB 2VIRA 3RL1A 3CQFA 2R9HD 5AOKA 5D7IA 3TP4A 4RMQA 5AOZA 2O72A 2C9SA 2QLYA 3C87A 4R7VA 3A4DA 3QSKB 2VIRB 3RL1B 3U1SH 3Q44A 4DFIA 2XFXA 4Y4HA 4FTVD 3QWQB 4AY0A 1A4BA 3W0WA 3FRPB 1EFQA 3O6ML 1TEGA 5DGRA 3OAZH 3T6WA 2ITEA 5BOZG 3AT8A 1SUJA 4AV4A 5IJVB 1CBJA 4YHLH 3IBEA 3MBWB 1GXEA 5KYUB 1A25A 4DPRA 3GSNL 5DURB 3ELAT 5E9DD 1I85A 3GSXA 3QG6B 1C5BL 4D7BA 4QYAA 2X05A 3ZT5A 2HKFL 4NXSA 4OKDA 2FGWL 4P57B 4TVSa 3GSXB 3X1GA 1G9ML 4J3BA 1AJ7L 3WG7B 5J6GA 3KLHD 1W80A 4XE5B 3V55A 4Y1AD 4V2CB 3FUEA 3KWUA 1NFDF 1Q0YL 3OAZK 1MJ8H 3PHSA 3O4LA 5J6GB 1TO5A 3TF7C 3QISA 3QUYD 4GKZB 3CFJA 1JHKL 1P4IH 1C5DA 2B4CC 3N5AA 4PTUB 3JWNE 5GGRY 3TCLB 4B9YA 3FTGA 4N2EA 4RZKA 2C5DC 3GTTA 5TDOA 3K71B 2YD0A 1C5DB 4AM0B 5SWZD 1GZPA 3FTGB 4JDVA 1W8NA 1CUOA 2VZOA 1OLLA 3MMEA 3BWSA 3A4AA 2B08A 2DMBA 4FMKA 4HJUA 4NUJA 4UMSA 3ESUF 1J18A 4U3XA 4ZFFA 2JF1A 2YPVA 3MMEB 5SWQB 4W81A 2HN7A 1WA1X 4NUJB 4U1KB 4F5CA 4KAQH 4PRNB 3T0WA 4MS6A 1BP3B 4ZFFB 4G5AA 1G7QA 3B2MA 4PRPA 1IKNC 2DIAA 4R6UA 4WO4D 1F1DA 3V0HA 2G5BA 1DFBL 1CD1A 2D0FA 5EZOH 3WNPA 1QKZH 1QUPA 1WS8A 3PQYE 3TJEL 9CGTA 3PWUA 5A2LH 1MH5B 2APSA 2NX5E 1UACH 4GAFB 3SYPA 4FI7A 2HH0L 1FYTA 2JELH 1F6AA 1O7SA 3KJ4C 4PMFA 4HFUL 5J57B 1SF3A 3JWNC 4NQSA 3BLPX 1YJDL 3Q5OA 2DLEA 4KVCH 3ZKSD 3BGFB 3HBQA 4KKLD 5J56B 4IMKC 4ZBJA 1RQ5A 1KGIA 1GHFH 2J8HA 2NY7L 1HILA 1PZSA 1BOYA 2H2SD 4HS8H 4JPWL 4ES9A 4N0YH 5I18L 4DGIL 1P7KA 1ZY9A 2R0LL 5CGYC 2J57A 4JPQA 4U31A 4ZQKB 3GXTA 4OGXH 3ARDB 1AD0A 3EH4B 1VACA 2X1WL 1RZ7L 4BUGA 3W39B 1F97A 5T5NG 2AJZA 4FFVC 5F9AC 3AT0A 4MAUL 4O51A 4FLOA 1FAKT 2ZKHL 2EEBA 1MRDH 2AJZB 4G6JL 4GYBA 3D7PA 4H8WH 2V2TA 3VSUA 4LVOC 2ZXCA 4Z0BH 3MXVH 1BG9A 3D87B 1HXMA 1M2VA 5EEVA 4LSUH 3QIBC 4OLZH 3FRUB 3DBXA 3PYCA 4KJQD 4ORZC 1T2QL 1MWOA 3SQOL 1FFPA 3IETB 4PJXE 3MLUL 4FCHA 3LEVL 4LCVA 5J11B 5IFJB 4G6AD 3Q1EA 5IZ7A 5CHNB 3VAEA 1DVSA 2IALA 3BN9D 1P6FA 4EIZC 2F54D 3QZWG 1RFDH 1OHQA 4J28A 4N68A 1A64A 2E9WA 2OMXA 3HPLB 4FHKA 1JDDA 5DMGD 3P4NA 3QA3B 2GJPA 2WAHA 4JCMA 3INUH 4M62L 1EZLA 1R5VB 3RGHA 1VZHA 2BO0A 2FEEL 2P46B 1EEZA 1N64H 5IJKC 2IH3A 1PLCA 1DVFA 1C12B 2JJTC 3BGMB 3PWPD 4DKFL 1GYWA 4E9XA 3ALWA 4H5SA 1VESA 4AYID 3O6FC 4GSDL 4KROD 4Z7VE 3UJTL 1Z3GL 2Q2LA 3A24A 4J6IA 1OM9A 2OK0L 2C7FA 4U33A 1OOWA 5HDWA 3GHBH 1ZHLB 2QQKH 3STZA 2QADD 2OSWA 1C5CL 5F7BA 2BHUA 4XMWA 3QJZA 1Y6KR 4XNMB 5TE7L 4IBUA 1AGEA 2V7HB 3X3FL 4JO4H 4JRXA 4FFZL 3D05A 4P2CG 1SHXA 1AXSA 3G08B 4AQ1C 3EDDA 4U6XB 5FA3A 3DX8A 4ZOCA 4AQ8A 4UOW1 5I73B 2TRHA 1QFUL 3FK3A 4YUEL 1AXSB 1ONQA 3DLQR 2J1XA 2FJGB 3CHOA 1H6UA 1XTMA 3S36H 4RQQA 4QJ4B 1DZBA 4XNDA 1QSEA 5EFIA 2A6JA 3IN2A 4WO0A 3B2XA 4LESA 4UT7H 3UYPB 1RUQH 3KPSE 2CA3A 3K7UA 4G1EB 3Q9QA 4RQQB 3LRMA 1G7IB 1D3CA 3GM8A 2EIMB 3ARXA 2CA4A 3IMSA 4L1TA 3UTQB 2QTEA 5HVHB 1L7IH 5F1NB 1E43A 4L1HA 5AW8B 5HGAB 3FB6A 1EDQA 3II2A 4JM2F 4LMQE 4QRPA 3T2QA 4KPHL 4G3YL 2GBUA 1CG9B 2ZUQC 4RX4A 5DEFA 1KGCE 1NC2D 2B2XL 4QRPB 2Z4QA 4F7EA 3RGBA 4EI6A 4ZTOL 4NWUH 4AC2A 3A0OA 4M43H 4LSVH 2OR8A 4F7EB 1XR9A 1CIDA 4FQ1H 3BAYA 3S34H 5FF6A 4RMSA 1KBBA 1VLXA 1AGCA 2ENSA 1OV8A 2Q5BA 3RVVC 1NL0H 4XR8C 2XFGB 1EEQA 1XR9B 1P1ZA 2I25N 2YQ2A 4Y8AA 2UXFA 4C58B 5EIVA 1CE6A 3OGOE 1JNHB 1TQCB 5D6DC 5FA4A 4U4BA 3WO4C 1PBYA 4WK4B 3MV8B 4TM9A 3MLYL 3ZTNH 3IFLH 2VLRB 3NAAH 1INEH 1MHPL 2WBJC 5F1IA 3WFZA 1CE6B 1TU2B 2VYRE 1U3JA 2AK4E 1WFUA 1AMYA 2VZUA 1D2OA 3LVTA 5E6IC 1IAIM 3FU9A 2EEXA 4YHNA 1DVUA 1EDYA 2CDGA 2P7TB 5KG9B 5DURD 5DZVA 4F80A 2OSLB 4Q6YA 5EU5A 4HD5A 1A9EB 3SPVA 1TJGH 3EJRA 5INCA 1C8QA 2UY7B 5JIMA 3JQOB 2ODHA 3FH8A 4FZEL 1G43A 5HYJD 4JANA 4DW2L 4AKQA 3PWVA 4ALAC 4P9HC 5EC2A 3A6OA 3CDFA 3OXSB 3H9ZA 2DM3A 1BFVH 3V4LA 5MP6H 1V54B 3QEHB 2DBLH 4N90E 4OCNC 3RURA 4Q14A 1OP5H 3GMRB 3WS3A 2A38A 3ALXA 2AW2A 1HNFA 2HPOA 1SYVA 1NMCB 2WXIA 3NJHA 4MJHA 1KG0B 4Z7IA 3VTTA 4Y9FA 4G9FA 4XOCA 4XNBA 2E4FA 3OAYH 3SPCA 4HMEA 5KWYC 5EF2A 2D7NA 2KS0A 1F90H 1L0YA 2WQWA 4JPSA 5DZ9A 4BE5A 4B9FA 3UAJA 2WD0A 1I3RA 2NY5H 1EXUB 4IKNA 3G04B 3FQWA 3GHEH 1OSPL 3LOWA 4XPBH 4OLVL 3EHBB 3AMKA 4EI5C 4YXLH 1H3TA 2WQRA 3QS2A 1AD9B 3SBPA 5K9QI 1G5AA 2CKBA 5I1JL 4BH7A 1XGUB 2Q3AA 2R1WB 3FQWB 1QBLL 3F12B 4L1LA 1OP5K 4HUXB 4JQIH 3QDGD 2ENQA 4OQTA 4DO5A 4C59B 2OW6A 4KKAC 3L2MA 4NIYE 3ZU8A 1IVLA 2Z31A 1DVTA 4N6RB 5CCJA 1FFTB 1PAZA 5AW1B 1MVUA 4YAQB 4PVNA 3QUZA 3UO1H 4PREB 3OAYK 4C56B 5KSAB 4KOBA 1CFTB 1B2WH 3KL3A 4NGHL 5KSBE 4NT6B 5I75B 3ULSA 4Q6IC 3U0WL 1D5IL 4X7CC 2LAGB 3NPSB 4WI9A 2ZG2A 4LDLB 1ODAA 2B0SH 2G3ZA 4TN9A 2K3HA 5IG7B 5D7JA 3ARQA 3CXHK 1H6EA 2F58H 4WTWA 5ERWA 1FAIL 2DEXX 3WMQA 4HIPA 3VCLA 4FG0A 4GSUA 2HRLA 4CC0A 5KN5A 2CO7B 4CW1B 4DO4A 5DMIL 1M3IA 4JAMA 5C0AE 2HTKC 5AYQA 4X98A 1R5WA 2ZICA 2O61A 2PYEE 3HR5B 1JPTH 1NGZA 4MCZB 3MRKB 3G5ZA 5ITBL 4ZO8A 2DBJA 4X98B 2AF2A 4MA3B 3QVAA 4GW1B 1H8OA 2I32A 3AXLA 1JAEA 3ZGIA 4MCNA 3IJYA 1X7QB 3AT9A 2XG4A 3FT0A 5BUGA 3ZKQD 3D4GA 1FV1A 4BZ2A 3WUWA 1RK0A 2GHWB 4MJIB 5IBTL 5A7EA 3V6FA 5C0JA 1OM3H 1GC1L 1FV1B 3QQ9D 4J12A 1AGDA 4R2GC 2BIPA 2ESVE 4G2AA 2C9QA 2WXOA 2GJ6E 4XB7A 4OGYL 3BP5A 3UH8A 3A21A 2ED7A 5JDSA 1TENA 4H1LG 3WJJA 3KWVA 3WEOA 2DWEA 4C47A 4KU1A 1NFDA 5EG6C 3AABA 2AJUH 4XMKL 2FHCA 1XGYL 2OTWA 3JWOL 4G1MB 3ZQWA 3BP5B 4NERA 3DJRA 4WJ5B 5JDSB 4IBTA 2Z93B 1NFDB 3DOIA 2OTWB 1MAMH 4M7JH 2YPVL 4G8FB 2Y7NA 1R75A 2I7SA 2WKLA 4HC1H 4NQCB 2EUWA 4YVUA 2MRYA 2NTSP 1GIGL 4TYUA 1RZGA 1L3NA 2FYYA 4MA7L 4WI3A 1MJ7H 5JIIA 1OAQH 4QOKB 2F7IA 4F33B 5C0IB 5TK4A 5BVJA 3DOSA 2DYPB 4X4XB 3SGDH 4IIQA 1OSEA 1QFPA 3L17A 3QO1B 1EXHA 3KYNB 5E70A 2A74A 1EFXA 1JVOA 5HVWA 2X44D 3CVHH 4JK0D 2HT3D 4F9LA 1FUNA 2Z7UA 2BZDA 4ZO6A 1Q38A 5ECGA 5INDB 5H2BA 5GRYA 2WGNB 4D3CL 1IAOA 1AR2A 3B7RL 4NLAA 4EN3C 2BJML 1QWNA 3P3SA 1ORQA 5A2BA 1TSRA 2CLRA 3SPGA 1HWGB 4PWKA 3CIAA 2VDKH 3BUTA 3CHQA 4I2XA 1RIVL 3WE1A 1ORQB 2FTAA 1PZ2A 4H20H 2CLRB 1T03L 3VXRE 3MNWA 3PXHA 4NDMA 4Y2DD 4JGNA 4B5ZA 1K4CB 2ZXWB 4R7DA 3M6DA 3ECVA 5HHMB 2E4TA 3C6SB 1HHHB 5F7UA 4Z0XA 4X6DF 1YY8A 1NAKL 2VDLB 4R7DB 4XRCA 2G3MA 2WLLA 3BW9B 3GEFA 4BKSC 3H9SE 3BJ91 4XVUC 1E4KC 1D7CA 4LIQE 2HVJA 1CTOA 3N9GH 1UXWB 2BWIA 4KKPA 4OCYH 2CLZB 1Y18A 2WLLB 5I1KH 2BY1A 2FD6H 2ZX7A 4L8DB 5CF3A 3KLAB 1P6AB 1QQDA 1UA6L 3FFOA 3JTTA 4PJIA 2ZG1A 3KPRA 4FZ8H 4NZUL 1CICB 3V52L 2QKIA 4XH2A 3EJYC 4ZW8A 3ARBC 1ZLEA 4PR5B 3GI9L 3P0GB 4QRSB 3KPRB 2O6DA 2R2BB 4NZTL 1SEBA 3CN2A 1AHMA 1ZJAA 2J72A 3E38A 3DPBB 3K8MA 4OZ4A 1S78D 5DWPA 4G6MH 4UM9D 3JV6A 2K70A 1JCVA 4LLDB 5L9DH 2XA8L 4G8GA 4JVUA 4Q56A 1PD1A 2G4EA 1G0DA 2ZAGA 1T89A 3LRLA 3SPJA 1PVHA 2QPEB 4JY5H 2EXWC 3DUSB 3S37X 1S8DB 4K71C 5TF0A 2CCWA 4ZXBA 3GJFH 2D7OA 4JRFA 2EDFA 4WCYL 4X9BA 4QXTB 1NUDA 1K4DB 1IMHC 4Z7OF 4NN6B 3X2QB 3C5ZD 4KJWD 2MTAA 2WBWB 3T8VA 3VFMB 4DP7X 2A83B 3UIZA 3WKPA 4J4PC 5FM8A 2XTJE 4HXAH 3NN8B 4XC1H 4JFUA 5IUSA 4MDRA 1TZ8A 2EKSA 2I60L 4FLHA 1HU8A 3U83A 3IMRA 4FHJA 4M7ZC 2JKTM 3D50A 1GS8A 2XHNA 2AXFA 4OD3H 4YHPA 1AHWB 3GJFK 1U0QA 3FSOA 3E3QE 4CBZA 4XP6H 3Q5YA 4XVTH 2MCMA 3DJTA 3RA7L 4YQXH 4GUPA 1KCBA 2I07B 4FFYA 5AZ2H 2NZ1A 2P5EE 3BKML 1HWWA 1NCGA 3SQRA 3STLB 4FQJL 1SXNA 1XEDA 1P7QB 2X38A 5E8DH 5JHBA 1O5PA 2Y1YA 3ILQC 1L9PA 2P26A 5E94B 4U1SA 4KZEH 2QEJA 1JHLH 1XQ4A 3B2UD 5JA8B 4J1UA 1MCDA 1TZIB 2HJFB 3SDDC 2DPKA 3EKCA 3BIKA 3SDCB 4DVRL 1NM9A 1QFWM 3NFPA 3GWJA 4IRJD 4U1SB 5KSAD 1T80A 4C56D 1CD0A 3STBA 4F57H 4MNGA 4J1UB 2FWOA 1N4XL 2XTJC 4LEXL 3WIIH 4E41A 3EOBB 5IQ7H 4FQHB 1G9NL 1CF8H 1HH6A 1K5NA 1D7DA 1PLGH 4E41B 2CK0H 2VMCA 1CT8B 4JM2B 4K23L 1HQ4B 4Y2NA 3SJVA 2HVKB 4U1HA 1HH6B 5HDBE 1NPUA 4KRPB 5DJCA 4QCIA 3VXPA 3QFJD 4X6EB 1F4WH 5BXFB 4TSAH 1CXHA 3BUDA 3E3QC 3PP4L 1AOHA 3QULA 2GBTA 4K4KA 4WEEA 3SJVB 4BFOA 2XQBL 2YAFA 1N18A 1FN4A 4YBQD 5KW9L 1RJYA 3LRHA 4AITA 4RISH 4WWKA 4TLUA 4ODVL 3VSVA 1JJUA 3FT3B 2HLFD 3BDYH 3SZKC 4JDZB 3D5OF 4JUSA 4CADA 5AENA 2WK2A 2UWEE 2YAHA 2YRBA 4X7TA 4YHKH 5DUJA 3SGJC 3GRBA 1N8OE 1S7TB 4XCCH 1A9BA 4HVBA 5AD0B 4RFOH 1ETZB 1N68A 3UCQA 3KLKA 3EBGA 5DF0A 5L8KB 4U1NA 4MJID 5HHOA 1KN2L 1A9BB 1XF2A 1TLMA 3KAAA 4ZAKC 5I8EA 8CGTA 4NPJA 3LZQA 3FU7B 4U1NB 1DLHB 4XN4A 2Q8BL 3EJQA 5J13B 2IG2L 2Y4SA 1UGKA 1YN7B 5B3NA 1V7MH 3P77A 4HMDA 1KJ2H 4JL2A 4OAWA 4QYOB 3WTXA 4DEPB 1AHKA 5AYTA 3BESR 3W0WE 3WELA 1CU4L 5IVZB 2XPYA 1KZYA 4N25A 1PD0A 3ZUCA 4KV5E 2IIJA 4ODXB 3VFRA 3VSTA 3OKMB 1H5BC 3IU3A 1ZV5A 2CKBL 2IWEA 4F8QA 1E6OH 3VFRB 3QCTL 1UWFA 3MC0A 4OQTL 3AROA 3HI5L 2BOBA 4PJ8A 4NQCD 2Y24A 3IU3B 4OF8A 4DSYA 2ZCLH 4G43A 4ABWA 4KK6C 1MELA 4M93B 2XI9A 2VDRH 4GH7B 5AYUL 3TYFA 3LV3B 5IMMA 2G2NA 1JP5A 4LSRL 2OMYA 4FA6A 1T21B 2YKLL 3HFML 4G43B 4KJYA 4QOKD 3WYRA 1ROWA 4HISA 5DMJB 5FC9A 3S8GB 2EKJA 1ZIBA 2P5WA 4JN2A 4W4OA 2DYPD 3FO0L 3MOBL 3OMIB 4Y0GA 4DUVA 1P7BA 3HTLX 1MFEH 3HPJB 4KJYB 2WQ8A 1I7RB 1IQWL 2P5WB 2CBPA 2WLZA 3AWFA 5C08D 5JPNC 3TPKA 1I1FB 4KZ0A 4Q0XH 5B22A 5D70L 3CQQA 4MJ6B 4FA7B 5I74C 5ETUB 5A3IC 3DSNA 4YSPA 5MEND 5JO5A 1HSBA 3WKML 5DR5L 1U8NB 3H2PA 2CZNA 3BE1L 1G5GA 3AREC 4XPGH 4JKNA 5FHBH 5JO5B 4B9ZA 1HSBB 3BVNB 25C8L 4FJZA 2FHFA 2QHLA 1LK2A 2MTPA 2WO4A 4YC2C 4WHTB 1ZGLP 4XWOC 1H0DB 4F5CE 5HDOA 4K2UH 4WDIA 3UGUA 3WBDA 3ZT6A 2QELA 4FADA 5HYQA 1BVNT 2F1BA 3O2WH 1WT5C 2DQFA 1VPOL 4BZ2L 4PRPE 5AOIA 2R4RL 2RTTA 1BAFH 4WDIB 3RDTB 5HYQB 2PABA 5IESL 1SVCP 1CLYL 3P9MA 1DQIA 3TBVA 1X4YA 1VFAA 1RZJL 5E6ZA 3FH5A 4JY4A 4OJCA 4UOQA 1JZ6A 4P2RA 2ZYHA 2R0ZL 1FYTE 3P9MB 2IAMA 5LBVA 3QCUL 2VDOB 2NXYB 4JY4B 1UEYA 1OCZB 2D3JA 3D12B 3TA3D 1WFNA 2ADJB 3LEYH 3VGHA 2FX7H 1NEPA 3BEVA 1TETL 4DAGL 1NFKA 3BHBA 3NCMA 3HMXA 3X3GL 1R3LA 1MZYA 5BUAA 3BEVB 1P6WA 5I30H 3JWOC 3FO2B 4XBPB 1BZ9A 3DO4A 1AO7E 1F13A 3MOAH 4XOBA 3D9AH 1PIFA 3O4OB 2ZCHL 3PGFH 1CE1L 1JF1B 2W81C 4RESB 4G72B 4HH8A 3WTYA 2Y7QB 1K85A 2MKWA 3NJFA 4PD4J 4PJ6A 4Z7UF 2ZOKA 1NAMB 3VE0A 5EU6B 4M48H 4NB7A 1X5FA 3DV6A 1UURA 2AVGA 2D9QB 2DJSA 2IDSA 4MA8H 1KXVC 3EYFA 1YPZE 1UM4L 2ALAA 4P23B 5TH2A 4PRID 2GUOB 4UCFA 1SDDB 1WF5A 3V4PH 3DV6B 4ZD3L 1C1EH 3OR7A 4XVJL 2OTUA 3ULUF 5DT1L 2XSKA 1KCUL 5EOTB 2VXTL 5FYKL 1PQZA 4IHOB 1DUZA 3U7YH 4PJEF 1IARB 3OR7B 2OTUB 3E1F1 3BIAX 5B38B 3QHZL 1F11B 4P0DA 4BKLA 3KYAA 1KFGA 3DMMA 1PQZB 2JK5B 1NEZA 3FCGA 3OR6A 4EF3A 3EBHA 4X8JB 4LVHC 1LM8V 2J88L 1QSFA 3CZFB 3QDJE 4IK7A 4NHCH 1LP9F 4OV6F 2AV1B 2VR7A 3GMQB 3TVMB 1NEZB 2W91A 2B59A 2O6CA 2V8LA 4S10A 1GYAA 2QQLL 1HIML 4YIQA 3HC0A 1KXHA 2NW2A 4PJ5A 1CGSH 4MVBC 1BJ1H 2Z0BA 2JJSA 3V4UL 3F5WA 3NJNA 2G60L 3HC0B 3QXDB 4YIQB 1QPKA 4ZX6A 5IKCB 3RL2A 3QNZB 2X6CA 3Q3GA 4NKDB 1MW2A 5HHPB 4F15B 1BA9A 3ULVF 4YXKL 2H0EA 3ILPB 3B1TA 2B1HH 4JQVC 1KB5L 3Q8FA 4XP4H 5C07D 1F8TL 1WQVT 4N24A 4Q9QH 1ZHBB 3MX0A 1I9JH 2K78A 5CZXC 4HOXA 1RXLA 2KC0A 5HHQA 1TPXC 3LKSB 4GO8A 4X6DB 2P5PA 4L18A 1U6AL 5F8RC 3F7PC 3MX0B 3ZKXB 4JRXE 3RPKA 3W81A 1HZHL 1TLKA 1LEKA 2OJZL 4AQAA 4TUKH 1MEXH 1NGYB 2QMKA 1GKEA 2BNRD 3H2QA 1NA8A 1SVZA 2RFXA 4ZW3A 4F9PC 4JVPA 3K6DA 3HE6C 3KGSA 1LL1A 3ECQA 1OW0A 3NIFE 4I3GA 2AEQH 1V3JA 4WKXA 1QSEE 2MKLC 4N4YB 3P9WB 2VDMB 1JGUL 1OTUC 1AQ8A 3MNDA 1RJZA 1PKQA 4A38A 3GMOA 2BVTA 4JCLA 3WN5B 2ISDA 4PV8A 2WINA 5DJ8A 1GYCA 2DQGH 1LO4L 3OKYA 3WIHH 4JZJC 1NUNB 3OZ9H 3Q8EA 4QRUB 4E5XG 1MNUL 4HIXL 5TQ2H 3NJXA 3TFKC 4UINH 2COVD 5AW5B 4YEEA 4L29A 2ZX8A 1MI5E 1NDTA 4K9EL 3LRKA 1A1MA 1UJ3A 4CVXA 2XJKA 4CN6A 4Z8FH 4L29B 4GRLC 2X2YA 1KGJA 2V37A 3KYMA 4HUNB 1XGPB 3E2HC 3MRDB 5AAMC 1AC6A 1A2YB 3IFPA 1ZLDA 4GMSL 3L54A 3LQAH 1UWXH 5CILH 4CVXB 4Z7OB 2BY3A 5D7SH 5ADPL 1TFPA 3KYMB 4OI9A 5CINH 1RU9H 3EBAA 3MXWL 4FFYL 3PJSB 3E80A 4EBQL 4ONHA 3IPEA 2NDGA 1F18A 3D2UA 4B3VA 5KVEL 1AIFA 2WJ5A 5AVRB 3MUZ1 4X7FC 3JWDL 1EHAA 2CDEB 2MCPL 2DYRB 2HZHA 2HSIA 4KZDL 1UWXK 1X4ZA 4XVSH 1UYWH 3C60D 4ETQB 1AZCA 2DQDL 4YGAB 3ZE2F 5IB3B 2IAND 3Q43A 4OZHE 3CZNA 5T5NF 4ZMZA 1T7VA 3IYLW 4FEMA 1AR1C 3NIGE 4RMRA 1E3ZA 4O2FA 4ZPVA 3L4YA 1NTDA 2LE9A 4M6AA 1I8MB 4R5TA 3QI9B 3HNSH 2HT2C 3PWLB 1TQSA 1SJEA 2A4ZA 1KNOB 1KYOJ 3C5JB 1JDAA 2N1KA 1XH1A 4PYHA 5CSZB 4EIBA 2AABL 5FXCH 1WBXB 3GBMH 1HAWA 3GSUA 5E9DA 5J89A 4K5MA 2X1XR 1XH0A 3QIWB 4TXVB 5IB4B 3FN0H 1UENA 1Y7VA 2WLHA 5IROD 5LG1A 3GSUB 1FL3A 5IGXH 2WM0A 4MXWL 2XWCA 1UADC 4LLQA 1SFDA 4Y1AA 1ZRUA 1NOFA 5B1CA 4D9LL 4G5ZL 3CN4A 3L5WB 4FFWC 2GK2A 5AW7B 5JMRA 2NRDA 5LBSH 3QUYA 4RGMC 3RAJL 4FC3E 4MX7A 2J8UF 4PJAF 2WY3B 1BD2E 3NABH 2YMTA 3NA4A 3OG4B 4X4KA 4ZMWA 1KBGH 2JQAA 4O5LL 1LMKA 2QPSA 2VO8A 3I6KA 4I4WA 3V7AG 3C2AH 5KBLA 3RDTD 5I28A 5ABDE 3C6LD 5F1SA 2X7LA 3M1BB 2VM9A 5IF0A 1I8UA 1I8LC 5KS9A 1RVFH 1LO2L 3GK8L 3NZHL 5LWYH 3T4AC 1AZZC 2ATPA 3QJTB 1T5KA 1UCTA 4LSQL 4APQC 2R83A 4OCWL 1HEJC 4X7SH 3P4OA 3QEGH 3BWZA 3V8CA 1CIUA 5I0XA 5KSUA 4A6YH 6PCYA 4OJEH 2WMPB 2YEQA 4UF7C 3QIUA 2C9RA 2NNFA 2VSCA 4OT1L 5KSUB 3WAJA 1SOQA 5F9OH 5EULV 5IM7A 2DDQH 3KS0J 3NRFA 2A3TA 3LIZH 3QIUB 2DQTL 4HK0B 3K6SA 4JQIA 1FE8H 1XGTA 4PU2A 5BRQA 4PJDA 2BVOB 3NEOA 4JFZL 5I6PA 4IS6B 3MCKA 2AJ3B 1G4RA 1DBBH 5E2VH 2EO7A 4KVPA 3RVXC 1M6UA 4ODSL 4FYSA 1IE5A 3MCKB 5AL0A 3D30A 3QUZC 5EU6D 3ABKB 3VA2C 3IRZA 3B3IB 1TTFA 1YYCA 1SEQH 3U1SL 5GGVH 3IDIB 2CE6A 3RTQD 1DZ0A 5B4MC 1DBJH 3D4YA 4ISVB 4N3TA 4MD4A 4Y9GA 2BX5A 3HHRB 3Q6GH 4N2FA 4PPTA 2ENPA 3IWVA 1D6EB 2JLLA 2Z34A 4FQCH 5ICZA 2FJFA 1DO5A 3MDJA 4MXQC 3VI3A 2CHWA 4YHLL 1HHJA 1YC7A 3QUHA 2HG5B 1Q0EA 3GNMH 3RHWK 1IM9D 2ZYIA 2R27A 3FQUA 3WY3A 4F7MB 4UT6H 2JCCF 1AAJA 1AKJD 1C7TA 3TVMD 4U7KA 2FECI 3LDBC 4TOYH 3GMMA 2BSRA 1U92A 3GRWH 5ENWA 3FQUB 4KRMB 4QI3A 3MREA 5E6SB 4MZ3A 5JPMC 4AXWA 2F7RA 2LW3A 5I8CA 3TEUA 5ENWB 1MJ8L 1JNLH 1T3FB 3NRQA 2VN5A 3ARZA 2P28B 4AXWB 3T3PF 3GIVA 3PE9A 1YNTA 2H9GB 5I8CB 1KZQA 1XMWA 3UAFA 4DN3L 4TL5A 1ZTXH 3OHXC 2YLKA 3C5SA 1HDMA 3MRCB 3LZFH 4MLSA 2IQAA 4N2OA 2NY4D 2WLNA 3ZQXA 4NRYA 2PWGA 2ZOWA 3ISWA 1RZJC 4HCRH 4MDJA 3CDGA 3V5KA 2EDTA 2V2XA 3C5SB 3VB9A 1ZLSL 5D71L 3L5XH 1HSAA 3ZZQA 3G5VB 1E67A 4NRYB 3HMXL 1UCBH 1KBWA 3ATAA 3GSVA 3CDGB 4OV5B 2Y5QA 4Z7WE 4E9LA 4GXVH 4Y16B 5DC9B 4OF3A 4WSJA 5T1LD 1UZ8B 4HC1A 4KMTH 1JE6A 3ES6A 4CVWA 3OKDB 1D5MA 2NY0C 1Q9LB 3HLKA 4JFDB 1CDGA 2KI6A 3ES6B 3A4FA 4MS8D 5EZOL 5GSRB 1QKZL 4YR6A 4F2EA 1BQRA 1GJUA 4MAYB 4UB0H 2PR4L 4TQIA 1ESOA 1UACL 3FQ1A 2XIDA 4TNWK 2B9AA 3EO9H 4NQEE 3UTZA 2JELL 1RI8A 1HCYA 1WIOA 3CVHA 1PCXA 1GMEA 4UQBA 3B56A 5IMLA 5KBNC 1E3XA 4PJIE 4BGLA 3C8DA 4NPYB 3ZX1A 4NN5C 3T0BA 4Z7UA 4HUVA 1HZLA 4DKAA 2BWQA 2BHZA 2PTUA 3FB5B 4KVCL 2QV4A 2BZCA 5E0QA 2VLLB 4IOIA 5CGBA 4FQLL 2FR4B 4OD2B 5KVFE 3WCYA 2X9ZA 4Z7UB 1IIIA 4A1RA 1GHFL 4ZX4A 4HS8L 3D4ZA 3HN5A 5A2AA 4N0YL 4DVBB 4A7VA 4YXHH 1JGIA 1UASA 2ID5A 2VQTA 4BFKA 2VDKB 1PX8A 1MFAH 3FFDA 1FSKB 4HXBH 4FYQA 5C9KA 1CURA 3TEWA 2HLAB 5FAAA 1H3PH 5IK3B 5I6XB 2PKDA 4PJEB 3BFQG 4DF9A 3QQDB 5KJ7E 4HKJA 5HGBB 1NC2A 1MLBB 2GTZB 1LP9A 5E95B 3CWGA 4NM4H 1MRDL 4Y7MA 4HKJB 1WS7A 1XBRA 3H55A 1LP9B 3NT0A 4Z0BL 2VDQH 3MXVL 4PH8A 3V5DB 4LSUL 2F8OA 4N2CA 5H37G 4AIZA 4BQCA 4OLZL 3RFRA 3S37H 4ZFOB 3U7WH 2LR4A 3ZW3A 3FT4A 2F68X 4PJFF 3HVDA 1AQKH 4AIZB 4W9DC 3CHPA 1ZPUA 3QI9D 2QGDA 1B3JA 4H2CA 5HYIA 5JOFB 1JK9A 1OANA 5IQ9B 5L0QB 5KBDA 3BEWA 4R7NA 1RK1B 1CS6A 1Q0XH 3OF6D 5FGSA 3INUL 2KZWA 2JQZA 3SOTA 1XCQA 2XVBA 4FF9A 3WJLC 3HJEA 3FUIA 4U05A 2I24N 2OMVA 1N64L 2PWFA 5B1AB 3SE3C 3TBCA 4GXUM 5HYJA 3C9NA 1WISA 2EDYA 4QHMB 1T89C 4NO0D 1WRFA 5KVEE 3WTWA 3EUDA 3GJFA 1UWGL 1ACYL 3S2AA 4QRQA 3C9NB 3ROOA 4WFED 2DJMA 3GHBL 2QQKL 4WV1C 4X4ME 1M6OA 2F5AH 3ROOB 5GJSL 3T9WA 1PZAA 3I02B 1S7UB 4PWIA 4BRVA 5IFAH 2OQJB 5HSFA 2Q3ZA 5FGCE 1HE8A 4JO4L 1LE9A 5GS0C 2YXFA 2MOVA 3TBTA 2PCFB 1M6OB 3APCA 4XI5D 2PF6A 4PRHA 2O5ZH 5C0BE 2J55A 1Y6NR 4XX5A 4ZPTB 3TIDA 3SHSA 2M1KA 3L1GA 3V0WH 1TTGA 1I8IB 4L4TA 1ZVNA 2AJSL 2X0VA 4J3OC 1OE1A 2Q6WA 3CFCL 1TTAA 3S36L 1FO0H 3HAEH 2B15A 3DX4A 5KANI 1YY9C 2MPAH 4CUCA 1BDYA 3UZEC 2SEBA 3T08A 3QDGA 4I88A 3E1ZA 2EQDA 5IVXA 3BPOB 1HCZA 1M7DB 2J7LA 5CN2A 1L7IL 2F15A 3OQRA 4LB8A 4YSUA 4GBXC 5BZDB 1JV5B 4YHML 2Z7WA 5JXEC 32C2A 4FD0A 1F3DH 1Z0MA 2ICEC 3VD1A 3IDMB 3KZ8A 3RX8A 3DJZA 3WL9B 4DP9X 1O75A 2FO1A 4K3GA 32C2B 1JUFA 2GYSA 3B9KA 4P5KA 4Y5YB 3EDJA 1QEWB 5HJDA 3VDCA 4NWUL 4MCMA 3RWHA 1AG0A 4BHUA 1JUFB 3EH5B 3FQTA 3B9KB 4LSVL 4P5KB 4KQ3H 5D5MA 4XMPH 4OCRH 1K5WA 4FQ1L 3S34L 2AJXH 5I6LA 5E8OB 4V1DB 1MFVA 3FUFA 1IBDA 3S3JA 3DI3B 3RNQB 2DQJH 1NL0L 3IMBA 2KUTA 2X4OB 3DRTA 4PWJA 2DJ4A 3K74B 1ILUA 2XG5B 3W11C 5IHUL 5CGMA 2VQUA 4YO0A 3IFLL 3NAAL 5L2KB 3DRTB 3ZE2B 3UYOD 5C6WH 5F88B 4EIUA 3CHRA 1R5IA 3PV7A 5E9AA 3N42F 4MD0A 1HHIB 2CGYA 3AQZA 1WA0X 5D4IA 2W92A 4QY8B 2EICA 2RCSL 1KB9J 1BVKA 1R5IB 2F8IA 2LHAA 3FZUC 5F97E 3U4BH 1S5HB 4WI8A 4NZRL 3O3DB 1P2CA 5AVSB 1UOWA 4TVPD 1BVKB 3ZYIA 2W59A 4QTHB 3MRLB 2YPLB 1ETJA 2JE8A 1AVAA 1BFVL 2AQ1A 5AAWA 3BPNC 1FORH 1QPXA 4ELMF 2DBLL 1VEPA 1BMGA 4P5TA 3RVTC 3LPGA 3MA9H 3W9DB 1QLRA 1AFVH 1BAWA 4FG6C 2DQUL 1S7RB 5D7LB 4A7QA 3AACA 2J8UA 4P5TB 4BE6A 1JVLA 3FN3A 3HLAB 5E1IA 3KPNA 4U0RC 5D9SB 4ZZKA 4PIRF 3FUKA 1RZFH 1QLRB 3OMNB 4QD2E 1MCCA 3RP1A 4PJAB 2J8UB 5GISL 1A6AB 4JO8A 4AG4H 1XF4A 4XCFH 4BIKA 3FCTA 1FPTH 1KJ2B 4XPBL 4CRPA 3L4WA 4M7LT 4I9WD 2DWXA 1P5UC 2QFPA 3QXTA 2ATKA 2KLRA 1MHCB 1X5KA 3CGTA 4MBOA 4P4KA 4AV0A 3RZCC 1FVEB 3BH4A 3FCTB 4GLRH 1WUZA 4MXVE 4JQIL 2VRKA 3GKWL 4HIIA 1HOCB 4Y16D 3ILEA 4BCYA 3PREA 3EADA 4Y19E 5D1QE 4ZUTA 2C7UB 3G5WA 3MRFB 3PL6C 4G7VH 3ARFC 5GZOA 4RAUB 1XXFC 4ATTA 3FHEA 4EPSA 4XNXL 3MA7A 3UO1L 4LCWB 4ZUTB 4CNIB 1B2WL 2DI8A 1UH4A 2IFGA 4PQXA 1W8OA 3VGAC 1OK0A 1THAA 3OKLA 2XZCH 2VDPL 3DJ9A 4JG0L 4MAYD 1E6JH 4MMZB 2RGSA 2V9RA 3KVPA 4NQDA 4YDKL 5EA0H 2GCYB 3BSZH 1KACB 1TF4A 2PCPB 4LF3A 2B0SL 2EDMA 1IC4H 3UACA 1E27B 3T6XA 2F58L 4WFGE 4GEIA 4QPEA 1X4XA 4LF3B 4ZMAT 5BRZB 2W80C 2NXZC 3COOA 4KMLB 4U2ZA 4W9GC 1YMMA 4Y2DA 2QLVB 1DQJB 1X7SA 4IOSA 2YJQA 3VX0A 2V33A 4XN7A 1YMMB 2D7MA 1JPTL 3F00A 2PXYC 4KKBC 4KO6A 5GGSB 4M5SA 5ILTH 3D25A 4BV1A 1RIUL 3UP1A 2AQQA 3LKPA 5FO8A 3GTVA 5IJBC 2Z3FA 1EJ6A 4PRBA 1M4KA 4ODWB 3ULUD 3L3JB 3CFDA 5D1QC 4RA3A 3MJ9L 1PNCA 4PRBB 5ESVA 5HY9B 5D1XC 3GS7A 1FNGB 3GMPA 4BZ1H 4TNFA 4NKOB 2E9IA 1F4YH 3EZJB 5DYOA 5IOPB 3T1FB 3CSYA 3P2TA 5LJYH 5D2LA 1MJJB 2GJRA 2XY2A 1AIZA 4PLJC 2QVTA 2AZUA 5CSBA 1XD0A 2C9AA 1PD6A 5DHYA 1A14H 3CSYB 4FXTA 1VF5C 1MCBA 5E4IA 3UMTA 3TS8A 2E8ZA 2JCCB 3FCSA 1ASPA 1XAKA 3GZPA 4Y1SA 5ALBH 5D93B 5KVDH 1SY6A 5DHYB 5AB2A 2AJUL 1QRNB 1NANH 3FCSB 1QD0A 4LDOB 4OLYH 2WGXA 1NDMB 2PP8A 3MZTA 1A4JB 1T0NA 4KKZA 1MAML 3K2IA 3HG1A 4M7JL 2VJXA 3T3PB 4E9TA 1U3YA 3H85A 3QAZB 4HC1L 5LXGH 2XY1A 3CU1A 1JBJA 2IWGA 1E2WA 2YA1A 3HG1B 4JQXA 1MJ7L 1E28A 3T0ED 1MCHA 1FJ1A 1IGYA 4L0ZA 3GUTB 3C5ZA 1OAQL 2YRPA 2O6PA 1LILA 3FU8A 4PJ5E 1E28B 4W6WB 3H9HA 5G4OA 1I1AC 4Z76A 3V6ZB 3BVXA 3CVHL 1C7SA 3H9HB 4UAHA 5JHDD 4Z76B 1QR1A 1HHKA 3V4PA 4CGTA 1LYQA 2V9TA 2GSGA 1JF5A 5EU4B 5A43C 4Q97A 3IXTB 1A7OH 1WHPA 2OR7A 4QRRB 1QR1B 1ZT1A 2WN2A 3OWEA 3HR6A 3H6JA 3UG5A 1ITBB 2QMJA 2PO6B 1ADQH 4FHBD 3T09A 4XMLH 3MRJB 5D1ZB 5AW3B 3UAAA 1HZKA 2XIIA 1S7WA 1NCNA 4H20L 4N5EC 2VZTA 3TNMA 3TLRA 1CYXA 4LNVA 2QKSA 2RR3A 3BT2H 1CPUA 2Y9RT 4OB5L 3VWJB 1BZDA 1RUKL 2WUBH 3QE5A 5EBGA 4E0RA 3CUPA 1CLZH 1W0WB 4LKXA 3UTTB 4W9EC 1M05B 2OMBA 2EECA 4ZDHA 4E0RB 4X6CA 3QUXB 1UEMA 2KZ1B 3VXUD 3MV7E 4IRJA 3CTTA 1PKQE 4OLXH 4Y5VB 3DROA 5E0FA 1Q1PA 2P9RA 2E3VA 3AB0B 4HALA 5ISZB 5D96C 2C9UA 3EH1A 4JRYB 5DDHA 3R0NA 4HEMA 4AE0A 1BYPA 4DK6A 1Y1DA 4RAHA 3DROB 3MRPA 3HZYB 2CUIA 5DDHB 4C8XA 1OAYH 3OAUH 2HFEA 3PQYD 3PY9A 4R4ND 1LEGA 4V33A 3MFFB 3MRPB 2NX5D 2VR4A 4KK8C 4M4RB 4JJ5A 2W0FA 1YECH 5FLUA 4WWNA 1MXGA 2AQPA 4G6ML 1BFSA 4KZCA 4V1DD 1W0VB 4HUCA 3FOLA 3ZL4H 1OAKH 5EO9A 2Y5EA 1L9NA 3NCWA 5EOCH 2KPNA 2BDNH 3F58H 4GW4A 5ELIA 3ZIMA 3QEQA 1Q94A 3EBIA 2NW3A 3O9WB 3HHSB 2DLTA 4N2BA 5ADOH 1LWRA 3T2OA 3WEAA 1E3FA 1F2XK 4R7LA 1OW0C 1AI1H 4PJFB 1N3NA 3CH8A 5J9PA 1ZT7A 3QDAA 1BWWA 2CPUA 4L8CA 2RHEA 3LS4H 5DHVB 2GEQA 3WIHA 3NPZB 1ASQA 1UT1A 2DQHH 4D0DB 1N7MH 1A7PH 4LHUA 5A16A 3DVFA 1ZT7B 4L8CB 2NNXA 1JL8A 5B1JA 4HXAL 4JLRB 2YPLD 4XC1L 5J1AB 4H1LB 4G82A 3O6FD 5B1BB 5C0FB 3NZ8A 4X99A 4FTVE 2QHRH 4KTDH 2A2QT 3TYGH 3CFEA 2WYIA 1A8ZA 1FHNA 5MEOB 4OD3L 2J56A 4X99B 4I1PA 1KBPA 1BZ8A 2K4WA 1KBVA 3REVA 4C4UA 1UB5A 3TM6A 2G9KA 2IH1A 4XP6L 2OMWB 4XVTL 4NO3A 4JO1H 3PDOB 3PHOA 4YQXL 4KK9C 4RBPH 1KJMA 1KXTB 3GZOA 3M45A 2J5WA 1BFOA 3OLIA 2D73A 4PI0A 4FQ2H 4I3SL 4XP5H 4PGCA 4UQDA 1BFOB 4M9PA 3HS0C 1AQDA 3FB8B 4KZEL 2FT8A 2VR5A 2VISA 2ZOLB 4L1BA 4PUBH 3VFGL 4A67A 1LD9A 4WZ9A 2LFEA 4OZGF 3UZVB 2BNQB 3H3PH 4JVWA 4KY2A 4W9FC 5HI5C 3FCUB 4F57L 2BS71 4DESA 4LP4A 5C08A 2GW5A 2R9HC 5D4QA 3WIIL 4RBPK 5K59E 2WNKA 2ZCKH 4XNZB 2TRYA 4WIQA 4EXPX 1CF8L 3SBQA 4N8PA 5SWZE 1SJMA 3FDWA 1PLGL 1SOSA 4OCLC 5F21B 3S5ZA 4PW9A 1WWWX 2CK0L 5MENA 3DVNB 1KBKA 3O3AA 5A6IA 1QI4A 1H8LA 1CXKA 4WFFE 1TQUA 5HI4D 3QPXH 1F4WL 4TSAL 1OSZA 3O3AB 2XWJA 4FQXB 4M4PA 5TQ0H 4PW4A 1XEUA 2BSDA 4KH2A 2MQ0A 5DVNA 2HUHA 1E4HA 1OSZB 3CX5K 3FYIB 4OZIE 4KHXH 4RISL 1J5DA 3BDYL 4YDLB 2Q20A 2CJUH 5IQMA 4L3AA 3EFOB 1H3WM 1VKXB 2OI9C 5D55A 4C4KO 2WP3T 2WBJD 4YHKL 2ERJC 5CSGA 4QKXB 1AKPA 4PJDE 3QZPA 4XB3A 2ZWSA 5LBSA 1UD3A 4UIKH 2ADYA 4XCCL 2GIYA 1U4EA 4RFOL 4ZUSB 1PAMA 4QHLA 4XN1A 3DXAA 2XYCA 4FN0A 1VIWA 1URLA 3N42B 2K45A 3C8KA 1SZNA 1YEGL 2Z8SA 1JV2A 2ZTBA 1HN1A 3TA3A 2B4CH 3PU7A 5FOBA 2UX7A 3QDMB 4ORGA 2XC8A 4XP9L 3RWIA 1V7ML 2MSPA 2H3KA 2NY1B 1MCJA 5H8DA 2HX7A 1A7QH 3P0VH 1QATA 5GS2D 3RWIB 2L7QA 4A6YA 3B9AA 4ELMB 2A9DA 1UKQA 2CSPA 3OGCB 3L9BA 3C75A 4EIGB 1V3MA 3Q2VA 5CAYB 4KGJA 3C08H 1G0XA 4QXVA 3EOTL 2UX6A 4A6YB 1U2CA 5CM1A 3O3BB 4QIRA 3S9DB 3LIZA 5GJTH 4S1DD 1ULVA 1D7FA 1S9WA 3TURA 2ZCLL 2YGNA 2NYYC 4DOHB 4Z9KB 2F8VA 1AP2B 1EJOH 1ZAGA 2VDRL 3ECBA 5ANME 3BX7C 4WO4C 4MZRA 2KHAA 3S4SG 4H13C 4Q9RH 1HNYA 1IC7H 4J39A 5IB1A 4HLJA 2F5BH 4M7LH 5KTEH 5LNDA 4KKAD 1MFEL 3TV8A 4LHQB 2E7CA 4X0KA 2G2PA 4OFPA 3RLSA 3OJDA 4KX7A 4L9LA 1DANU 1IBBA 4Q0XL 1B6UA 3I3EA 4AQZA 3JWNH 5JXAH 1WWCA 3DVIA 3O8XB 5DJDA 35C8H 4L9LB 2F54E 4KKRA 5DJZA 4G70B 1XGQA 2JB6B 4PJGA 3NP4A 3BFOA 3WFHA 2HT4D 1IBYA 4N2NA 2OCFD 5JOPD 5DJZB 5FHBL 1S3RA 1JSYA 3CBJB 2XXFA 3PXLA 4NUPA 1JWSB 5K5YA 4LLMA 3BDBA 3VWJD 4UT6A 1KUMA 1I9EA 3PWPE 4QNPF 5SWSE 2HTKD 2X4NA 4K2UL 4LASH 1XB6A 5IB2A 3O2WL 3GRWA 3G6JE 3BP6B 1A1OB 5C07A 1S9XA 1G6RB 1BAFL 1U91B 2C3WA 2DMHA 2BS8A 2IWFA 3OB0H 3P2DA 4BHUI 4GS7B 4JGUA 5L8JB 3VWKD 3PJLA 1F3RB 5KUKA 3TO4B 4GRMA 4TLKA 2FO4B 4JRYD 4G8IA 5EC1A 3ZDYF 4NC1E 3IGLA 1I7TA 3BXNB 4HCIA 2A4CA 1FC2D 1FH2A 1SY6L 2ZWNA 2BNRA 3PIQB 2UXGA 4X9YA 2CUHA 3KM1A 4U2YA 1VSCA 1L9QA 3HB3B 4HCRA 4HULB 4R2GD 4G80A 5DVLA 2P1YA 2V5MA 1A4AA 1YN6B 2VGLM 4ELKA 5I8KH 5FECB 2P44B 3X11A 4BD4A 3OB0K 2X6UA 4W70A 2E7DA 4ZMNA 1BV8A 1KY7A 3BUYA 3MOAL 3RWJA 4ELKB 5BOPA 3VGBA 1FRGL 4AOFA 2Z4TA 3X11B 2BY0A 3D9AL 1WO2A 1SOXA 1ZA3A 2WQUA 1NBVH 3D39B 3F6JA 3O9WD 3PGFL 3BUYB 5HYSG 3RWJB 2WXPA 3AAZB 1TNMA 2XQ0A 4WWOA 4ABVA 3BSHA 1BGXH 3BRFA 1KTLA 3O0LA 5E1QA 4MJJA 4KROC 4M48L 2RAMA 1R3IL 3FUDA 3UDWC 4CMMB 1MY5A 4FA8A 1IL1A 5ICYA 1A0QH 4MA8L 1CDIA 1LEIB 1GAFH 5JORB 2MCG1 3V4PL 1XCTB 3OKKA 4XHJD 3WDHA 4M1DH 2X4UB 1JPFB 5F0JB 4QGTA 4MA1C 3AM8C 4OF0A 1VA9A 1G7MB 3U7YL 4NC1C 3MTXA 1FCGA 2FVNA 4G7YL 3CMOH 2EYRA 5GRJH 2I7OA 5J1TC 4X5WA 4AGQA 7PAZA 2DD8H 4N2GA 4DGYL 1T2XA 3UPCA 1FBIH 2GJ6D 2QGCA 2KKQA 4NHCL 4YK4B 1G7LB 3DGGA 2PYFA 2XV0A 2PPCA 4EN3D 1NMAL 3IDYB 5GZND 1FG2A 2VABB 3NEXA 4UOZA 2VXQL 4QT5A 3TV3H 4J6RH 2Z8VC 3QR1A 2EEAA 2O6FA 2VC2H 2WXRA 5F7LB 4BQ6A 2IDQA 1CGSL 2G2RA 1QR4A 4HIJA 3I9GH 1RCYA 3FOMB 3C60A 3QARA 4UANA 4LPVA 2YGPA 3SGEH 3LNHA 5AW0B 3MNMA 3US0A 4UTAH 1YDPA 2CO3A 4HIJB 3VUAA 5KUMA 5EOQL 2B1HL 2KYIA 4HJJH 3MV11 4XP4L 4JFSA 4GKNA 2AJVH 4LLYA 1PPIA 4B9PA 4Q9QL 4JDEB 1I9JL 1QACA 2HRPH 2BNQD 4RAVB 4XCYA 1AYRA 1NIFA 3HRZA 2XWZA 3NDZE 5E6UB 5CCGE 4GKNB 3NCXA 3OPZH 4K7PX 3DTDA 1V10A 2WVVB 4XP1H 3NBNA 2OMTB 3UC0H 4NJAH 5J3HD 3HRZB 3IF1A 3TFBA 4TUKL 1MEXL 3T8MA 1INQB 4HLZH 3ARBD 4JFYB 5IROA 2MNUA 3AQYA 4P2OB 1TJHH 2AEQL 3CLFH 5C0GB 5E5MA 3IXAA 4FQXD 4UV7L 5ALCH 5FO7B 3BIBX 3QDGE 3X17A 1SVBA 4CKVX 4Y9BA 2LABA 3MRQA 4ZTPH 1XF3A 5FX3A 5IVXE 4BZYA 1A21A 5B8CA 1KIQA 1XGRB 2DQGL 5LAXA 3WIHL 5LGKA 4P5MA 4NQTA 1P84K 1LLAA 4G59C 4LZKA 1GYVA 2EH8H 4WNJA 3T77A 4WJG3 1L0PA 5TQ2L 4ALAH 4UINL 4P9HH 1I7ZA 3NCYP 5IJDC 4Y4FA 4AK1A 1MFNA 1TQWA 1RAMA 3T77B 4YNYA 3MKKA 4N20A 1LNUA 4BFJA 1C16B 3CVBA 4WGVB 4HJGB 1T6WA 1I7ZB 5C09B 4Z8FL 2ZX5A 4KO9A 3QUMB 1I7UA 5GS2H 1NCAH 3LMJH 1LNUB 1GGTA 2X4QB 3FXIC 2OYPA 3LH9A 5CILL 2ROYA 3LQAL 2DH2A 4GRWF 2WNWA 4DN4H 5D7SL 1HJCA 2WLIA 4X9FA 4F92B 1OF0A 3GKZA 4JJOA 1NDGA 1FO0A 2WCGA 3HAEA 3U46B