1XVSA

Crystal structure of apag protein from vibrio cholerae
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
124
structure length
124
Chain Sequence
MDVSLPCIKIQVQTRYIEEQSNPEYQRFVFAYLITIKNLSSQTVQLMSRRWLITDADGKQTVVEGDGVVGEQPRIKANDEYTYSSGTALDTPVGVMQGQYLMIDEQGESFTVEIEPFRLAVPHV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of apaG from Vibrio cholerae
rcsb
source organism Vibrio cholerae
molecule tags Structural genomics, unknown function
molecule keywords Protein apaG
total genus 22
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04379 DUF525 ApaG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1470 Mainly Beta Sandwich Immunoglobulin-like ApaG domain 1xvsA00
1XQ4A 1TZAA 1XVSA 2F1EA 5HDWA
chains in the Genus database with same CATH superfamily
4EAEA 5AZEH 5JXEA 4EI5D 1VADB 3II3A 5T3ZE 1QNZL 5JIPA 1A2YA 4I3RH 3VXSD 2BSDA 2XLLA 1X6LA 2AAAA 3KJ4C 5GRXG 1QNIA 5EBWA 1IGFL 4XBMA 5HHQA 3GIVB 2NNCA 2J8HA 5DJAA 3KD4A 3HRPA 4MCZB 1E6OH 2ZXQA 4C56D 3QCVL 4CL7A 2BNRE 3DVGA 2AEWA 1AJ7H 2WVUA 4M00A 2JSFA 1S6NA 3NRPA 5CGTA 3GRGA 4F57H 1HNGA 5DWUL 1T1YB 4MVBC 4JPVL 2EYSA 4L8BB 2GSIA 3HKFA 2PO6D 2GI7A 4JFFB 1A5FH 1NMBL 2C3VB 2X0UA 1NAKH 3V4VB 1I8MB 2Z8WC 4NQDA 3ARZA 4OW6A 4NKDB 3RWEB 4JO4H 4RISL 4JY4B 2HRGA 1IM9A 3BGMB 5FYLL 2UZYA 4ATTA 3EG9B 3DHUA 3EFOB 2VGLM 5LNGA 4P3WA 2WLZA 3QQXA 1PEZA 2RJMA 3HPLB 5DUPH 4JZJC 2OMZB 2NYYD 3MACH 3NJKA 3P4MB 1R3LA 4OJEH 1PEWA 2Y5EA 4DVBA 2IPKA 4P2QA 1F56A 3RAJH 4RGND 2ZKHH 2WHVA 4GAGH 5GZNC 4QHUB 4UQIM 4KO6A 4HH9A 2XZZA 1KTCA 1OCCB 2YZ1A 1RJZA 1TVBB 4NPYB 5D7JC 3DJSA 1NL0L 2O61B 5JYLA 2VDPH 4X50A 1VFBB 4N0FA 3N04A 3U46B 2WWNA 1LL1A 3T77A 3KPTA 4NYLB 1AHMA 4B7IA 4AL8H 5FKPB 4E42A 2VR4A 4ZW6A 4WI9A 4AEEA 5FA4B 4KKLD 3WFEH 5C7XL 2Q9OA 1RZ8A 5F1NA 1Q0EA 1HEJC 1JHLL 1WF5A 1WIUA 5TDOA 4F7CA 1GZHC 1VEMA 3QUMB 1XIWB 4BIKA 4JVPA 5EMYA 4AJYV 5E2TL 4E68A 4TNVK 1NEZG 3I74A 1LMKA 3KLKA 4E0RA 1IFHH 3WFZA 3TYGH 3H9SE 1F42A 4OCLC 4TSCH 3SEPA 3SCMC 2ENSA 2Q87A 2H2SC 3AG1B 3ZUCA 1ODAA 5AWNL 1WS8A 4PP1C 4QRRE 3WNPA 2VXUL 4N8VB 5LG6A 2OPCA 3SDYH 3CPLA 3RWGA 4S1QH 3FB7B 2WXLA 2WYZA 4R26H 5HYJB 4KHTL 1DBKH 1X5HA 1E3XA 1KIRB 1A14H 4B0MM 1A6UH 3GSWB 3HUJA 4YOKA 3NJHA 5IQ9A 1U3HA 3FBKA 4AH2B 4F9PC 2RCSH 2EXSA 1XIWC 4MB1A 4CSZA 2Q6WB 2LU5A 3APNA 1P7KB 3FQ1A 3AROA 4LVHC 4OQTH 1DBJH 5JHDA 1TJHL 2K7PA 4Q2ZA 1IC7H 3WHE0 3PREA 5K59F 1R75A 1U92A 3PY9A 1NANI 4JRLA 3T08A 3K6NA 4ELME 2ZONA 4PLNC 4QTHA 4TUOA 4LQ1A 1V7ML 2WLYA 4YHPB 5FGBC 4IOFD 3F8UB 1O6SA 3BH8A 1KIUA 1T22A 3ZYIA 3GSUA 4ZFOL 1ECZA 4PCKA 1EANA 4JJHA 1FF5A 1MHEA 4R0LB 1LWHA 1CBVH 2ED7A 2O5YH 4DH2A 4W4OA 1OV8A 2WNKA 1I9RH 3HRZB 4Z95H 3ZE0B 3DX3A 2QQKL 1TJIL 1NUFA 3ARVA 5CLXA 3PWVB 3PGCA 5FA4A 1Q1PA 4OVUA 1MCRA 2VR3A 4UUJA 4FP8L 4AC4A 2G3XA 1W8OA 2CLZA 3ARFB 4GSQA 1PY0A 2MKLC 5E8NB 3W9EB 3NCWA 3RKPA 3E1F1 4YFEA 3LRKA 4WWOA 2BNRA 1TETL 4D94A 2CGYA 2XHNA 3FTWA 4NP4H 4OD2B 1C16B 4H5SA 1HIML 3B56A 4KKBD 1R3KA 5I1CL 2B7DT 3UMNA 3AMLA 4QHUA 4F7EA 2A77H 5KYNA 3DBXB 1PZUB 3A67H 2QHLA 3QZWG 2ARJA 4NKMA 5C2BH 1Z9SA 3W2DL 1A4JA 4GRLD 2OMXA 3IDJB 1KJMA 3OX8B 4NX0A 4FFZA 5PCYA 5J1SC 3IJYB 1CXFA 4M7LH 3V6OC 1A1OA 5EBGA 3FQTB 4B9PA 3HPLA 3HI1A 3DO4A 3WHE1 3NP4A 2I60H 3H3KA 4J4PC 2YRZA 1DSWA 3BFOA 4KV5F 3SD5A 3TWCL 2WBJB 3FU7A 3BZDA 4OZFH 2WZAA 4OLUL 2NZIA 3KPSE 3QUMA 4O5LL 5F3HA 4OD2A 3BHBB 1F41A 3HAEA 3NIGE 3O6FD 1KTBA 5F21B 5E1AB 3BD4A 4F37K 3B1TA 3BN9C 2AJVL 5B39A 1OEZW 4XCYA 3FTGB 4FD0A 4QTIL 1BM3L 1TEFA 3FK3A 5CP3H 3IDMB 2P8PA 4NN5B 3H55A 2WLNA 3PJNA 4Y4FB 1RUPH 3FSOA 5DZOA 2EVIA 5FYKE 1O5PA 1A4BA 1MZZA 3B5TA 4POUB 1PQZB 1Q9KA 3H8NA 2Y0SA 4KK6D 4L4TA 5D55A 2VXVL 1JZ3A 4WUKH 1CDBA 1C8PA 3FTYA 4AXWA 4LPUA 1BXAA 1MFNA 1L0YA 4ZMZA 4LLMB 1JRHI 3ZTNH 3O3AA 1OARL 1E2VA 3O6FB 4L3AA 3TZVD 1YY8A 3NJJA 5BJTA 3F62A 1EZSA 1WHOA 1IM3A 4J1UB 1J5CA 2F8XC 1I7TA 2D7PA 3JV5A 4XODA 2P3YA 2NXYD 3VWJC 1NPUA 1EEYA 4K3JL 1DQDH 4UTAA 1MUJB 1QKZL 4NNPH 4PS8A 3SZKC 1DBML 4JFZH 4R3SA 2XSKA 1P4UA 4MB4A 2GC7C 2YFNA 3TA3D 4NQXA 4AEFA 3OAZK 1Y0LA 3RWCB 1MCBA 1JZ6A 5BW7C 4XMLL 2WZ6A 3G5XA 3MMEA 3T0EE 1MF2L 5FM5O 4HZAA 5B4MC 4CJ0A 1S78C 1THCA 4I5BB 3LKNA 5D6DC 5DYFA 1FJ1B 5HPMB 3D3VE 4PJBB 1HK6A 4OFYA 1WH0A 2ADJB 4YDZA 2O5ZL 3L95B 4F20A 5CN3A 4ERSH 3LS5H 1BOGA 3VE0A 1X7TA 2AANA 1S3RA 4N0YL 2WWKO 5F89B 4M5SA 4AK1A 5L4JA 4ZXBD 4L4JA 3QFGA 4XXCC 3L3HB 3ZDYF 4K7PL 1NWPA 3UJIL 1I9JH 1N8ZB 4RISH 2NY6D 4N6RA 5DHXB 5ID1B 3CXDH 3O2WH 4OF0A 2V17L 2FATH 4IKIA 1AGEA 2IJ0C 4H8VA 1CFNA 4CAGA 3DJTA 2YBRA 1DDTA 2G5RA 1S46A 3GMMB 4K73A 5IJBC 4G8FB 5IJVA 2QPSA 3IMBA 1UT9A 1BGXH 4X5PA 4X99A 3I6GA 3VXRA 3L17A 1IKNA 4HGWB 2IDTA 1ZHLB 3WHXA 1A7QH 2EUWA 1GGTA 1XB8A 5FGCE 2EQDA 4LESA 4N2KA 4F92B 5FYJD 3EO9H 4KROB 1BMGA 2XJKA 1E5AA 1WZMA 3K2UH 4LARH 5AKSA 2G3NA 1ZDSA 4XNQA 5A6MA 3N1FC 1Q9WB 4HEME 3APCA 3STLB 4JO2L 4MCYB 1FYHB 1R3KB 3GGWB 3WUWA 5CIPB 5EULV 2CCVA 3NIDE 1CN4A 4NCDA 2E7CA 5AOMA 1NCTA 3GO1H 2R0ZH 2BRRL 4IDJL 4APXA 4B60A 3FQNA 3O45A 4PGCB 5FC9A 4KZEH 2F53D 1XGTB 3LS4H 3A6BL 1G5AA 1AI1L 3N0AA 4U49A 5I1JH 4F15C 3ULUE 3CE1A 5KBMA 4TVPE 1T83A 3OKEB 1BLNA 1XCQB 4JO4L 3O6LL 4XNAA 5SWQA 3B2UD 4NQDD 5HDWA 4HYTB 2DL9A 3ZDXE 5IB4A 2IH9A 1DVXA 2Y1VA 4HJGB 3HMXA 3WFCL 3UMTA 2ATPB 3VO0A 1JZJA 1F6AB 4ONFH 3UO1H 4FYTA 2FQDA 4HHGA 5AD0A 3MRKB 1DL7H 4YHMH 3QFDB 5DWUH 5MEOB 3MR9B 4DP7X 3RX5A 3TPUA 1MCIA 3FQ4A 3HB3C 2VLLB 3FZUC 4HIHB 4RZCA 5HDBE 1KYOK 4YXLH 4U3XA 1CIUA 1UKTA 2JQMA 3IDNB 1JVOA 2PPDA 5TH2B 1RVFH 4KNSA 1G94A 2VC2L 3RY5A 5I18H 4D9QE 2ZSVA 3FUHA 1A6ZB 4MDJA 4MMXC 1A4AA 5JUEH 2JKNA 1FNSH 2WLLB 3GRWL 2XU9A 4WWKD 3PL6C 5J9PB 4FMKA 4LNRB 3LIZL 3WMPA 3BCDA 3BRFA 4NO5B 5F7AA 4ZSOE 1G84A 2HPTA 2K4AA 3S5LA 3IDUA 3QIWD 1UJTA 4IHOA 4QXUH 1FFOA 1UD5A 4K3GA 3HE6B 1HX0A 1XF1A 4GMTH 2GJ6D 3H2WA 4DAGH 4WW1A 2Z93B 4RRPM 3TEYA 3C6LB 4PMEA 1G1KA 1OTTC 4WHTB 3LN4B 2G2NA 4YE4H 2F68X 5AOLA 4P2OB 4QXTB 5CCJA 1F6FB 1ZA3B 1UURA 4O58L 4PRHA 4JFED 1PG7W 5BV7C 4L9LC 3F5WB 4M7KL 2VIRB 4M29A 1G7IA 2DQUL 3GBLA 3VE0B 4MKMA 2X6MA 5D1ZI 3ML9A 1AANA 3QI9A 5E9DB 4LVOC 5CSGA 2UZXA 4TYUA 5C0AE 5I66A 4BZYA 2K70A 3R06A 3FFDB 1YEEH 5HSFA 5M95B 4L8SC 5ID0B 1U8MB 1C5DB 1F02I 2PF6A 4MS8C 3WMQA 5J12C 4FP8H 4ZFOB 2FJGB 3DSFH 3QQNA 4HXBL 4UIMB 4XVJL 4ZD3L 5IBUB 3GSVA 1L4IA 4P5KB 5GGVY 3C8KB 4TPRH 3U7WL 2O61A 4M8QB 3GHBL 4NT6A 3UAFA 2Q76A 5CUSL 2GJRA 1H5BB 4QO1B 5C0BD 4IM8A 4HMEA 4GUQA 4IRJA 3JTSA 3ARGB 3MREB 5T1KB 3LD8C 1NIBA 1XMEB 3A67L 3HPJB 2OBGA 4PJ9B 3RY6A 3P3UA 1UWEL 5J7CC 3VQ1C 4EUPB 2FO1A 1MCOL 2ZOWA 4OH2A 4PGCA 2E75C 3QQ9C 4MQSB 3OVUB 1I1FB 2YMXL 1IM3D 1QBMH 3D33A 3P4MA 3ZDZB 1WZKA 3RHWF 3Q01A 2BIMA 1YCSA 3F84A 1LP9B 3SKMA 1NDGB 4H0GA 1U8CA 4JKLA 1QLFB 3NCYP 5LBVA 1EAPA 3P11L 5JORB 2AZUA 1TENA 2AEIT 4OUUA 3WGUB 5CBAB 2R29H 5ADOH 5J1AB 1X5MA 5GQBA 2BRQA 3GBNL 3MRJA 3VFNA 1SEQL 1HOCA 1URLA 2L0DA 4FCAA 4A2MA 5D7JB 3K2IA 4PRHD 3N5AA 4P3DA 4TUKH 5DRWA 3ZBMA 3VFMA 3V6BR 4IIQB 2B2XL 2OSLB 1QATA 2DQJH 3GS4A 3DV6B 4M43L 1Q9LB 2ZKMX 1RIVL 2GSGB 4NPKA 1ADWA 2YAFA 5I6XB 4CVWA 3CVHB 4LKCB 4WSGA 1KYDA 4Q6IB 7PCYA 1JE6A 4NRYB 5FOBB 4RFOL 3O11A 2YEVB 3RWDA 3KPPB 1OO2A 3WSQL 1L7TL 2IPTL 2X4OB 4PG2C 1MFEL 2W94A 3FDWA 3DIFA 3KXFA 4WO4A 4JN2B 4OLXH 2KZ1B 1QSZA 3PDDA 2EDWA 1EUUA 4QR7A 2V7HA 2B5IB 3AUWB 5A3IC 2BP8B 3FQTA 4JFOB 1BG9A 1WVZA 1Z66A 3D3VA 2ENYA 2CKBA 4PBXA 3F00A 1FFOB 4UT7L 1BEXA 1U8KA 3R1GH 3WIIL 4JM2D 1R5VB 3FCGA 3ROLB 2UY6B 1TXKA 3WEOA 1Z6JT 2DWEA 5HPOA 3RTQA 4S1RL 4NNPL 1TO5A 4EZLA 4PTTA 2K3TA 3ARED 2WQVA 3MXWL 25C8H 4FMVA 4M7JL 2FE0A 1LDPL 1JYXA 2ZSVB 4JZOB 4DVRL 4HIEB 3RGVB 3ABLB 4POZC 1UT1A 1G7JA 4N8CH 1EA9C 1GZPB 2XKNA 3WNLA 5B8CB 1UYWL 3NCXA 3DTXB 5F9WC 4MX7B 4QNPE 1GC1L 1FNSL 5JHLL 1BVLB 4M1GL 1NUNB 4KK5D 4ODWA 5MP6H 3GSNA 3ZYOA 4C54A 2BC4B 1JCVA 5C07B 4L4TB 5GZNA 4PG9A 4YSOA 4PLJD 2A6JA 1ZGLB 3LV3B 2A9ML 1PNCA 1U8PB 1U6AL 1KCRH 4LOVA 1HHHB 1MFMA 3MV9A 2ZXEB 2V5YA 5GISH 5TD4A 3U1PA 3EYSH 4APQC 3H6AA 4BUQA 3MFFB 1JGVH 1UOLA 4V2CB 2P43B 3O3UN 3L4VA 2GSGA 2P4AB 2Y07H 4MNGA 4U7KA 4AV4A 4EI5A 1QRNE 1PYWA 2EDEA 4M56A 3SE3A 1A6AA 1KG0B 3AUVA 1HL8A 3NCEB 4Z7QE 4JFDD 4PRDB 3VU2A 3CHRA 2W91A 4BBWA 3BKML 4ZJ9A 3CZSA 1NGXB 4RX4A 3QIBA 3G6JE 5E1GA 3T4AA 3G6AA 5DFVD 5T5NG 5JHDD 3SCMB 5CSZB 1DQJA 4XX5A 4IRSA 5BXFB 1P4LA 4Q7DA 1H3XA 1WHPA 3VX1A 2H3NB 5EO0A 1ZJAA 5I17B 1CYGA 4ZTPL 4UWQB 2W65A 3RNKA 3DROB 4W9CC 2WXOA 3KPSB 3SHSA 4FN0A 1Y6NR 2XN9A 3U48A 3N43B 1IQDB 4G8GA 5INCB 4Y2DC 2X28A 2XTJB 5EF1A 3RZCD 1YPZB 4EUPA 2O6PA 4U1IA 3ATBA 3MLWH 1YEHL 3T8XA 5D96C 5FLUA 2LABA 3VJ6A 1FUNA 5E8OB 1JFQH 4PJ9D 5KVDH 4DN4H 1UD6A 2CE6A 4OM0L 1V5JA 1I7TB 2J8UF 4YHYB 2A74C 1KCUH 1DANU 2JJWA 1MLCB 2VDLL 3QXTA 1EDYA 4E9TA 1J1XL 1FZOA 1BJ1H 3BWAB 1XGYH 3L3HA 5C0BB 3EXJA 1F97A 5FX3A 3X13B 2IH1B 4OIFA 3P3YA 1GHFL 2VDNL 5IFAH 2GAZB 1FVEB 1RHHB 3CCHA 3H9SA 2ZKXA 3N85L 3NSXA 5LQBL 1KUMA 1VACA 2YPLA 4XMLH 4URKA 2IALA 5GGUA 1I3GL 1TQCB 4HJSA 2EJ1A 5ALCH 3VFSB 4M48H 1UXMA 5JLZA 3FUEA 5KUKA 2CIKB 3KL0A 5IQNA 4NS0A 1E8XA 4ZI8A 4LDOB 4G7YL 3G5XB 3MMEB 4NWTL 4C4BA 5JLZB 5KTEL 3SY0A 4XVUC 1CO1A 1PU0A 3US0A 1IZKA 2A9NH 1IV8A 2DY2A 2WINA 3APDA 5E1QA 2AK1L 1IC4H 2F8IA 4RIRB 1EERB 4R8WH 2XVBA 3V5HB 2VL5A 1INDL 1IGCH 1RUKH 1E6JH 4Y19E 1HZLA 4H8HA 4H2AA 2VDKL 2WXJA 4Y9BA 4Y9GA 5FUCC 3ECVA 5L4FA 5MEQA 4AEHL 4G6JL 4JHWL 2X4TB 4W9JC 3R19A 4TNWK 3TEUA 5D70L 4C56A 1TVDA 1REIA 5I1GL 1J48A 2YGVA 3SE8H 1N10A 1YN7B 3D18B 3HCVA 5JOFB 1WUZA 2NDGA 1D9KB 2YUXA 2ZP8A 4DQOL 1ZS2A 1CURA 4IBUA 3OKYA 2IH8A 3RWEA 3BT0A 1J8HE 3ARUA 4KJWD 1XVSA 2UX7A 3EGDB 1X4ZA 2OMTB 5EU3A 2H1PH 2XWEA 2W88A 2FTAA 5K9JL 1NGYB 1SOSA 4UDTB 1HL4A 2FB4H 2ZPKL 4LL1A 4HU2A 5GGVH 4XCEA 1ACCA 4UTBH 1OAKL 4GPVA 4NQQA 4ZFFA 3DOSB 4CU8A 4G9FE 3UBXA 2NX5A 2ZXDA 3QNZA 5G4NA 3DXAA 3OJMB 1LE5A 3AGVA 2X4NA 1MWOA 3DSFL 3G6JF 3MJ9H 3UJJL 1RY7B 4K07A 5IMOB 3QCTL 3GMPA 3QJHA 1E4XL 4FS0A 2X2YA 3QUZA 4NAQA 2GJJA 4MXQC 3T0EB 4DK5A 3BDYL 4OZHA 1JK9A 4LRNL 4OF8A 4YHLL 1WG3A 1MJ8H 5EC2B 3IFPB 5DJYA 2FWUA 2O6CA 2BS71 1IGIL 4MKTA 2OTPA 5I0VA 4HKXA 5CSBA 3SGJA 2DEXX 3IBOA 4QHNB 2HH0L 3RDJA 1P9MC 3IAQA 4NUGH 1UGKA 3AXLA 1AGDA 1KYFA 1LO4L 1Q72H 4BFOA 3O3BA 3ABKB 3OF6D 1B4JL 1EZLA 1TQCC 3FT3A 5IKCA 4MA7L 1EEZB 1N19A 1EJOL 1AH1A 2NX5B 3QNZB 3GGWA 2H3XC 1IBFA 4CJ1A 5GSRB 3ELQA 3FU8A 1GTNA 4A38A 3AS2A 4KRNA 3VXPA 5TQ0L 4RMBA 1I3UA 3EW3B 3PFQA 3P11H 1II4E 5I73C 1L0QA 1PAMA 5D7LB 4WFFD 4OGAD 1NFDE 1OP5H 5IJDC 4JRYA 1KENH 5HGAB 2HG0A 4NLAA 1Q4NX 2B4CH 3L81A 1OT1A 1GIGL 3T0XA 1HSAA 4DERA 1B6UA 4ADIA 1I1CA 5C0JB 4YZWA 3CDCA 4FNRA 4JDEB 1JN6B 3AC0A 4M43H 1W0WB 4NHCL 5DJ6A 1T1WA 1CQKA 4GW4A 5HGHA 1EH9A 4GSUA 1YJDL 3HMXH 5KYWB 4B97A 3D30A 4BSWA 4ANXA 1FLRH 1JZHA 3AAZA 4Z3EA 3TCLB 2HCZX 1MCLA 3NFNB 2ED8A 3B7YA 1CT8A 1J8SA 1ZT7B 2IAMB 3SJVB 5IEHA 3BPLC 3LEXA 3NAAL 2JJSA 3V5HA 5LJYH 4F7MB 3NJIA 2D8KA 4LCUB 5DMGD 1R0AL 3VM5A 5LBSH 5GS0H 1ZV5A 4OM0H 3VGAC 1J88A 4G83A 4P9HC 3HG5A 3IJ9A 3LRGA 3EGSB 5KS9B 4Y2DA 2OW7A 4Y5YB 4MDIB 3HZYB 3RJDA 2HTLD 4NKIL 1OPGH 2Z31B 4TQEH 2FBJL 1CZ8L 3T0DA 4HUXA 3C60D 1W0WA 2VMEA 2YAPA 3CZFB 4YR6B 2J6EA 1N3NA 4JHVA 5C0JA 4J3TA 3VNZA 1C9SA 1EWHA 4Z0XA 5BS0D 1UASA 5IWLC 1YN7A 3D18A 2BINA 3HCVB 4QRTA 1N67A 4XOEA 4KXCA 1EO8H 2R0LL 4YC2B 3KCPB 4MNGE 4ZX4A 2DB8A 3WENA 4Z7OE 1NIDA 1YC7A 4NENB 3KJ6H 2YFOA 1T03H 4U6YA 4O9HL 1UXWA 5HJDA 4BE5A 5FHBL 1XDTT 3QS2A 4QWWD 1WTLA 1XEDA 3MRLA 1NUDA 1BFTA 3PAUA 3SE9H 5D7IF 5EZJB 2ADIA 4PJDE 4WFEE 5FYLH 2COVD 1MCPL 4DKDC 2WWMD 2MQ3A 1FE8H 2DS4A 2AAVA 4ZMWA 3DX9A 1N2RB 1ZA6A 4L4VE 4IOSD 4QOKD 4NBZB 3RVUD 2OM5A 3GUTB 2XKSA 3GIZH 1BP3B 3V0JA 1QLEB 5FO2A 2ZUTA 4A6YB 5DJZA 3GHPA 1NM4A 3CVIH 1KZYA 1JV2B 3C8KA 3O81A 3WEAA 1O7SA 2A6DB 4P06A 3BQUC 3M45A 1U58B 1DQLH 2DJMA 5E99H 1L0PA 4ECNA 5IHWA 2GT9A 1YLBB 5KANI 3EJPA 5EZOL 4IRSD 4AGOA 5AUMB 3MOAL 2VDPL 4ICXA 2B1AL 4L9DA 3EBIA 3WJLC 1H3TA 3MRNA 1DVFC 4M7ZB 1H3VA 1GZHA 5SWZA 1G7HB 1JWUA 2DQGH 2AEPL 1XTMA 4NC1C 4P5TA 2CBMA 1OSZA 1QEWA 4JGJA 1RULH 1H5BC 2AJXL 5D71H 3KYKL 1T1WB 3QDJA 5HGHB 4B5EA 3EFFB 1DVYA 3PHAA 5FECA 2N0KA 3CH1B 3TV3L 1FAIH 2UZYB 5T5NF 2H2PD 4B95C 1CDIA 1A6TA 3VI4A 3ZZ1A 4F8LA 1J5HA 5D2LE 5ANMA 2QKIA 3MACL 1T0PB 3DYPA 3FT2A 2WLJA 4KO5A 1A65A 1E5BA 2K3HA 2VSKB 2AXGA 5FYKU 4FXKA 2XBDA 3VD4A 2FIKB 3MRMB 3UOAB 2C7FA 2AKRA 1QSFD 4PGDA 5CP3A 1KBWA 1D7FA 5C07D 1PYWB 4U1LA 2H32B 5IROC 5KVEE 2CUMA 3RVWD 1UQSA 1YAZA 1A3RH 4C56E 1I1RA 1R3IH 1MCDA 1T5WB 1TVHA 3KGSA 3ULUF 2MOVA 5DFWH 3TO4C 1S7XA 4CSPA 1WT5A 5DHDA 2J6EL 1MW0A 1WBYA 1S9VB 4AVIA 2DWDB 2PCYA 5C0GB 4W4NA 1DJHA 1RMFL 4KVPA 1CUOA 3QUHA 2RR3A 4I13B 1OKEA 1BZQK 2PPFA 2YUZA 5JPNA 4HKBB 3CZKA 3HNTH 3PXJA 1W0YT 2AMUA 2HVKA 2JNZA 2OJEA 2FH6A 4FLSA 2IGFH 4B50A 4RNRB 5HHVL 3FS9A 2UXFA 3QWRD 1KGXA 1RL1A 1IGFH 4BQCA 5I76B 4TXVB 4YSRA 3EOAA 5HHPA 1FNGB 2APTA 5D1ZB 1AKPA 4Z95L 3ASOB 4K23H 4WO4D 1OP4A 3O45B 4K2UH 3SGDI 2J55A 3DBSA 5ANHA 3B6SB 1ETB1 3SYOA 5AEAA 4HZLB 2CM5A 1UGNA 2H1PL 3L5IA 3AG3B 5IVXB 1CD1A 4F7TA 3HR5A 4J8QA 5IVXF 2OL3H 1DBBH 5KVMC 3OC8A 2PN5A 3PAYA 2JKTM 3A5VA 2ESVE 1M05A 1MRDL 2FR4A 1BVZA 5IUSA 5FXCH 1ET5A 4AMKH 4N5UA 3VFUB 4WI2A 2VRAA 1WEJL 1CGWA 5L88L 4OVVA 1O7DC 4UOJA 2DWSA 3UXFA 4BE6A 2KLSA 4UT9A 1KY7A 1DLFL 5FF6B 4X83A 2DLFH 1ZTXH 5AW5B 3C5JB 1MWAA 5EO1A 2QGEA 4PJFB 3ULUD 1BAFL 5HJ3A 2H6PB 4YUEH 2CPUA 2J1WA 3NQIA 4TVPH 1MNUL 4R0LC 1VRSA 3DX8B 2HH0H 1I85C 2CBTA 1MKFA 4O51B 4ESKA 2VJ0A 4QRUB 4RBPH 5I26A 3VXMA 4JAMB 2B5IC 1ZLVK 4M48L 5BUAA 4ZODA 2VKWA 3BIKB 4N2AA 3E7JA 1UXSB 1TTCA 4DTGL 1J10A 3KLAA 1FVCA 3EYQC 4GKNA 5EOCH 4JO3H 4X42A 2A9DA 1FVDB 1G7IB 2NSMA 3RLSA 4EI6A 1JNNH 2EH7L 4W6YB 3VFTA 4LEOB 3PHQA 3MTRA 1S7UA 2FJUB 4KI5E 4D9QD 1SXCA 2YIHA 2E7BA 3DX1A 4JE4B 4QCIB 4MXVF 1XWVA 1OVZA 3PWJA 4ZTOH 3AM8C 3S5LG 5KN5B 4MAUL 2G9KA 5E8OA 4LB8A 2NR6C 1PG7X 3MA7A 4LDLB 4X7FC 3RWIB 5ICXA 2EYRB 5CO1A 3EYFA 1C5CH 3HI5H 3SDAA 4BH7B 5ISZD 5SWZE 4PD4J 3L9YA 4OSUL 4UZUA 4HSAC 1CFQB 1IGJA 3WFBL 5D7KE 1XH0A 1NBYA 3N41B 4U6TA 4MA1C 1MY5A 3KLAB 1HYSD 4LSVL 3MN8A 4OIBA 5I0WA 1TZIA 1YSOA 3BEWB 4OFVA 4WJ5A 4UAOB 4F5CE 4ZX3A 3ZHKA 5ECGA 4N2GA 2EDOA 1XXFC 1NBCA 3B9AA 2ITFA 3QHFL 4ZAKA 5BZDB 3RDTB 5F0MB 1FYTD 4EDXA 1UH3A 3BKCL 4RH4A 3CFCH 5IM7B 3WNJA 3ZKXB 1OAUH 4JHBA 1U8JA 5SV4A 3WU1A 2YRBA 2ENJA 4L2LA 5A40E 4CKVX 5BMFL 3GIVA 2MFNA 4OF6A 4TF4A 3BLKA 4CC4A 1CLOL 5A7EA 4HLJA 2IAND 4I89A 3D85A 3NEXA 1R33A 1DUYB 1KTDB 1LO0H 2XETA 3QDJB 4WIQA 3B37A 3L3OB 4JMXA 4L3EE 1UOKA 4J3OD 5LO7A 4KC3B 2XVLA 3OG6B 1AVAA 5IGXL 1HWWA 2PNDA 2VLRD 4NM4L 2RCSL 1MEXL 3W9DA 3MX0B 4YNYA 1NJ9A 3IB4A 2X53A 5MHSE 4GBXC 4R4FL 3FUMA 4XBGA 5T1MA 1NJ9B 1IEHA 3QAQA 3ATFA 4JVWA 2QPDB 4NPJA 3CN3A 4LKXA 5K9OB 3QG6B 2R9HC 4JDZB 4YSSA 4HUNB 4H5SB 4FJ6A 3WI9A 3LHPH 2YAHA 3KPSD 4GXUN 4L4TE 1ZLWH 4HJGA 4GO6B 3ARFC 2PW2A 4FFYL 4Y89A 3TBCA 2ALAA 3ULVL 1OGAE 1O7VA 2DLHA 1V8HA 3BPOB 3DGGB 1E9QB 1P4BH 1Z3GH 2KS0A 2LT9A 3K6OA 5B1JC 3MLZH 2EAEA 2ZAGA 3V52L 2B1AH 4FNSA 3N06B 2XUWA 1ECYA 1Z1WA 3ALXA 1AXSB 2C5DC 3RZCB 2XTJD 4Z7NB 5DDHB 3SBPA 1WO2A 3VSQA 1RULL 1CWVA 3CX5J 4Z7QF 2F61A 2JJSC 3IAGC 2YD6A 3CUPA 2AABH 4BFBD 4JPWH 4XNUH 3SN6N 3G5YB 2X2IA 3B9KD 1I31A 1ODUA 2LFEA 1EEQA 2OJZL 4PJ7E 4Q0XH 4U7SA 5AENA 3X2QB 3O41A 3N42B 4HISA 1MXDA 3NACL 5HYSA 2MRYA 3QI9D 5FM8A 3S36L 3FULA 3KPLA 2E9BA 5F1OB 5K1VA 4X98A 3A3YB 3I6GB 2AXJA 4V1DB 3VXRB 4Z0XB 3RDTC 4O2EB 1INQB 1AZRA 2R0LH 2CKBL 1KXVC 2EUZA 4WUUE 4FNUA 2NY5L 4JE0A 3UTZB 1D2OA 4DIXA 2Y3NA 5IMKB 5IQ7L 2JKIS 4FJYA 3OB0K 4IK7A 3QULB 4Z7IA 3QO0A 4Z23A 4I4WB 3DIVA 5E70A 2CGRL 2PYFA 1BZ9B 4WHYG 1FFPB 4QCIA 2JJTC 2Y7QB 5FHBH 2XXCB 4AZ8A 4FXKC 2XQYG 1NTDA 4N8VA 4PWFA 3QIWA 5T5FA 3IPFA 2Z1KA 3RZCA 4JM0A 1MCPH 2GCYB 1MCHA 4YN3A 2IAMC 2EDTA 2HRLA 4LVNC 5AUMA 3C08L 5SX5H 1KJVA 4QTIH 4D8OA 4OI7A 5D1QA 3W11C 4AM0B 1AQKL 5IEKA 3P4OA 1ZVNA 4P49A 3V0IA 2F18A 1WCBA 4XWOC 1CFMA 2BW4A 1TPXC 2Z91A 2UVFA 4LPYA 1ZKAA 3UADA 2FD6L 4OLZH 1DVFA 1UD2A 4HCIA 5C0ND 2YPVH 5I71C 1M56B 5MERA 1HXMA 4FXKB 1DQLL 5SV3A 3HE7C 1I7RB 4WY7H 2NTSP 1K8DB 5J11C 1C8QA 5ACZA 5D7SL 4XBGB 1KBGH 3UZQA 3OKDA 4HK0B 4PI0A 2Z65C 4XVJH 1H3PL 1BQLL 1QAWA 3FFCB 2ADIB 2AEQH 3N1PC 3DVNB 3P1VA 2EZ0D 4KMTL 4V1DD 1E7UA 1W72H 3PPSA 5DD6A 3JWOL 3RURA 3MUUA 3DMMA 3Q6GH 1CL7I 3KWUA 3IGKA 4ODTL 5CJXA 3SPCA 4F9LA 2I25N 1KIQB 3HI6L 5B3SB 2IFGA 1NC4D 2ORBL 3P4LA 3Q0HA 3VA2C 3GINA 3P3RA 5LDSA 4P2QE 3S5LB 3UH8A 1EK3A 3ILQD 4L05A 4GAJH 3H4HA 2OTUB 4P2OC 2X6AA 5DLLA 4PJIF 2FATL 1BAFH 1ZSHA 1VKXA 1SDDB 3SYAA 1FNLA 1ETZB 1N8ZA 3SOBH 1W8NA 4LGRB 4QAWA 4LCIL 5B39B 2DLIA 5J56B 2AQNA 1MIEH 4JFXB 3KDMA 4HALA 4WW2A 5J06A 3FO1B 2ZSWB 3BT2H 3CHSA 1JZIA 1S9KC 1FNAA 3P54A 1M1XA 3KL3A 3BLPX 3TH4T 3ATDA 4CMMA 2H0JA 1U4FA 3T0AA 3LZLA 3KBPA 5HPMA 3MV9B 4N2NA 3ILDA 5I23A 3ML8A 4YVNA 2OMUB 4F2MA 1IBGL 3QUGA 5IB5B 3JBG7 4FTDA 3HUJF 1IVLA 3MRQB 2OP4H 4FF9A 3O4LA 3WJMB 2XI9A 1TDQA 2C9RA 3CXHJ 4WAFA 1G7QA 4PWJA 3HNTL 3O8XD 3D39E 3NCJL 4Z7VB 4TUOB 2W60B 1E8ZA 4ZDHB 3WSQH 3ZVVA 2J1YA 5EU6E 1I75A 5IG7B 4H2CA 1SHMA 3ARXA 1LHZA 4NZRH 1C16A 3NH7L 3S35H 4J7RA 1R47A 1UUNA 3LXCA 4J3VA 4GO9A 5IR1B 4DKFL 2EADA 2X4QB 2ZUVA 3DMMD 3L7EB 4QYOA 4ZMTA 4QIRA 5CMAB 2VL5B 2Z6FA 3ISRA 4NUMA 4PMFA 3RA7H 3VXSE 3ZHLA 5LXGL 2JWYA 3ZKND 4GS7C 5CU9A 4JB9L 2OR7A 4ONFL 3UO1L 3KM2A 3NRQA 3FU0A 5CJQL 4LPTA 5I8KH 3FCSA 3WS3B 4ODHL 5ADOL 4S1DC 2CDGB 3HS0C 3O4LB 3MYJA 5EF2A 3QHFH 1YZZA 4JAMA 1ZPLA 3HJ0A 3HMWH 4AUJA 5CKAA 1CG9B 1USZA 5BOZG 4P5TD 5T3XL 1G7MB 2BLFA 1JXGA 3P73B 5IQ7H 4YSEA 3IVKA 2IADA 2VZSA 3WTTA 1CE6A 3Q2CA 4TLTA 2ICES 3WS6A 4CU7A 4EPSA 4F3FA 3F04A 2H1XA 1CMOA 1SJEB 3CPUA 4M4PA 4Q6YA 5E1AA 4N6RB 3O11B 3D07A 5GS3A 3IRZA 5LXVA 2QPFA 4HC1A 3GB7B 1H6UA 1S7SA 3DJ9A 2G60L 3JSSA 5DD3L 2RTTA 1M6UA 1RVFL 1K5WA 2XICA 4JJ5A 4XXDA 4FQXB 3PDOB 3Q1EA 4AQ8C 4L1HA 4NJ9L 1RSYA 4LLUB 2DYPA 5DVKA 1G6RH 4X9HA 3D6GA 4H1LG 4NZJA 3SJVD 1FNEA 3ISYA 3LPGA 4HFWA 4LHUB 2E7LC 1N6UA 4KDVA 3GJFA 4M4RA 1VEOA 4F27A 1HFUA 5FYJH 5GGTA 4F33A 1CTNA 4A67A 1HDMB 5EU6A 5TGBA 1A02N 3UTPE 3H56A 5FUZL 4WY7L 3G6AB 5EO9B 4S0SD 1J1PL 3NJGA 4LBAA 3FFCA 5I1EL 4JL1A 3S8FB 4U6YB 4RRPG 3QH3B 2W80C 3FH5A 1P7QB 2AQ1A 4KRPB 2NXZD 5H4YA 1A7OH 4FG4A 4XOAA 4NNYA 3UX9B 4ZUSA 5BMFH 3OJVC 4HUKB 2DI9A 3NCCB 3MVSA 4UF7C 4ZSOB 3WJLA 1T7XA 4UBDD 1QUNA 5MENA 1KLUB 5KVFH 3V0EA 4NT6B 5J6SA 3UABA 2NDFA 1U95B 3PP3K 2E6PA 3BC9A 3MJWA 3S3DB 2A6JB 3GXTA 1S9VA 5I75C 1W0VB 2DM2A 2ITDB 1JFQL 3WV0A 1PZBA 5DD0L 3AY2A 4DO6A 1I3VA 2PPCA 5AVUB 3EYSL 2C3WA 3FT4B 5HHME 3RB5A 4AQEA 3QG7L 2OR9H 1F4WL 4QTHB 5T33H 1FC1A 1IM9D 3M8OL 2WXMA 3MLYH 5CM1A 5DURB 4XWGH 4Y2NA 2ZG2A 2R1WA 3GI8L 4JKNA 4WENB 1A3LH 3JXAA 4XCYB 5BV7H 8FABB 3TF4A 2CUAA 4EQ3A 1WCQA 4X7TA 1YJDC 5D9SB 5DMJB 1MPAL 4WI3A 2XTLA 1D9KA 4UU9A 4G7VL 2QSQA 3BZFB 3CHOA 4W93A 5IB2B 1JTOA 1WDAA 3SDCB 4IGBC 3RWFA 2GK0B 2GEQA 1EFQA 2VQTA 3CD4A 3SBWA 4XPAH 2A73B 4NO2A 4JG9A 4YXHH 3CBKB 3QYCA 1KGCD 2E8ZA 1FSKC 3ULSA 1AHWB 1KY6A 3ARDB 2XWTA 4FX5A 2VDRH 2R59A 1D6EA 1HZKA 2L7JA 1UCBH 4Y2OA 3CK0L 2Q8AL 1K9TA 2NW2B 3O3EB 1JZGA 4TQPA 4W9DC 5AZEL 1M7UA 3ZK0A 2I5YL 3LPPA 1RIVH 5CEXA 4FQXC 2MPAL 2TRHA 3F05A 4FFWD 2XG5A 5IESL 3EO0A 2XX0A 3OKKA 1K5NA 4YVUA 3ZTEA 2X87A 3H3PL 3VGAB 1HJBC 4AIXA 2NQ3A 5DZLA 5FYKL 3HNSL 3ZE1F 3O2DL 1MFEH 1WC7A 1AOHA 5D4QA 2VDOH 4WHDA 2PXYC 5BZZA 3OKLA 4BZ2L 4HOMA 1GRWA 1I1YB 4MCZA 2NNRA 4F57L 3TP4A 1AHWC 1IGML 4JS7A 4M03A 4UQ2A 4Y4FD 1LDPH 1CR9L 3EJQA 3BVTA 3IEAA 3VI4E 4E9SA 4TTDC 5J6GB 3CHXA 3PGFH 5ABZA 3EJYD 4BA8A 1E5UI 35C8H 1LK3L 5FDYA 3TNNB 3FOMB 1IGTB 2EDNA 4OTXH 2ESVA 4JM2A 4N1HB 2NT0A 5EO9A 3C5ZC 1K4CA 5IFJB 2EIEA 5HP5A 4HBCH 2YXFA 2YMTA 1L9RA 4UM8B 3ZDZE 2BNQD 4JPVH 4YHPA 2WLHA 5DMYA 5KSVB 5CINH 4PY8I 1T20B 5HHXL 3ROOB 2NLJA 2X1WL 2EEXA 4HG4K 5BQDA 1TQBB 1E65A 5IZ7A 3HFMH 5LNEA 4BEIA 5C08B 2WGXA 1QSEA 3EG9A 3RP1A 1NCWH 3L7FB 2CDFA 2OA9A 5L2KE 5EA0L 3WHXB 2ZX6A 4HWEH 4U1HA 4LDCA 2OMNA 4X98B 5GZOD 2CDEA 1U8HA 4GRMB 2NW3A 5IQOA 3QEUA 1KNOA 3E8VA 1S5IH 1UENA 4XRCA 1NCBL 2WUBH 3MJ7A 3WIHL 4C83B 3T3PF 5I1AA 1UM4H 3OAZH 4A1RA 2JE8A 1CFSB 2VDLB 1CFNB 4IBZA 4XC1L 4CW1B 3HHMA 3LPFA 1OHQA 4Z3IA 4Q58C 3GSQA 2UZIH 4OLVL 1VPOL 3UCRA 5DS8B 4KNTA 3WY3A 2C4XA 4K7FB 2V7HB 3S34L 1GIGH 1RCYA 3MROB 3VWKA 1JF6A 3BH4A 3F12A 1SHSA 2D7TL 3T2QA 2N0MA 4KITB 5E0FA 3F5WA 2WK2A 2QADC 2CNZA 2V9RA 2FNBA 5E51A 3DX0A 2FEDD 3BDYH 4B9ZA 3TT3L 4LLWB 1FH2A 1ZIBA 2OZ4A 2WXKA 4TVSa 1OF2B 3H54A 5DJAB 5E00A 5JDSA 3P77A 4BJLA 2OSLA 4C59B 4FG0A 2GAZA 3ETBF 2FSEA 4LLAA 2IFFH 1LO4H 1Q72L 4GAJL 5AVRB 1EAQA 4LSQL 3X1FA 1XGYL 2DRUA 3BKJL 1XBRA 1F8TH 2AXHA 4W9EC 3CDGA 4ZPTA 5DLML 3SDYL 2N7BA 1FC2D 1J8KA 5HVFB 1U8OA 1PL3A 1P1ZA 4W4OC 3EOTL 3T2OA 3CVDA 1YN6A 3EJRA 1DP0A 4KI5F 4HIIA 1CZ8H 4YK4C 1PG7L 3G9AB 5GSRA 4AUYA 4F7PB 4RESB 2MTPA 3MLVL 2AEQL 2BVTA 1SN0A 3T65B 2CR0A 2Y2TA 3FH7A 3ILPB 2E46A 3L8QA 4W6XB 3D25A 3ARGA 3MREA 4GQPH 2WCSA 1J7VR 2GBAA 3DX7B 4R4ND 1VGEH 3VFOA 3C5ZB 3RJQB 3WFCH 3FTXA 2LW3A 3UCQA 3BUIA 4QRPE 4G6FD 2CJ3A 2FGZA 3TN0B 4CNIA 4UQ2B 3ZKQD 3NA4A 1UB5A 2A5UA 4HWZB 1M9SA 1RZJL 4HUWA 4YGVA 3VRLE 1RLWA 3O9WD 3ZDYB 3EH2A 5F6IC 1ZHBA 3DHMA 3IPBA 2XWBB 2CR6A 1ZHBB 1NFDA 1SVZA 5B1AB 1G0DA 3K1DA 5A2KH 2UZXB 2X4SA 1G9MH 3CLFL 2C4FU 2NQCA 2X10A 2XBZA 2YD3A 3KYNA 4ZFZB 1H9DA 1OCRB 4XMKL 4JGMA 3I75A 1RZGB 2NY2D 4LLYA 4D2NA 2J21A 3D25B 4BZ2H 5DQJB 2WBWB 3PDGA 1OAKH 1IKOP 5DO2C 2CBQA 4GFXA 5DD6B 1KEMH 1E2WA 2Z93A 5F6HI 1RHFA 4LSRL 1CICB 5FHAL 2VSMB 5F9OL 1DUYA 1JGLL 1P5VB 2VNCA 4HS8L 4X6EB 2WSPA 3T6QC 2V6HA 3P2BA 4YS4A 2ODIA 4JFFE 4EIZC 3ARDD 4Z7OF 4XNDA 4P9HL 1M7IA 3TBWA 3CZUB 4LU5H 3PQYE 2IMNA 1OSYA 4RGNB 1U21A 4F7EB 1QP1A 1SGKA 4H20H 4ELMF 2ZCLL 1FL5B 3B83A 1RZKL 5F1KC 3GKZA 1A4CA 3RL1A 1LMIA 1FN4A 3SO3C 5HHXH 2KH2B 2IDUA 4NQDE 3I9IA 2WXQA 5F7MC 1JPFB 4HW6A 3LY6A 2X7LB 5DR5L 1GSKA 5C09A 4G71B 1JD7A 3UG4A 3H9SD 4GP5B 1XH3A 4TUUA 5FUOH 5C09B 3KS0H 3MA9H 1ANUA 3U30C 4UOZA 4I0PC 2AFNA 1DDHA 4OQ1A 4Y1AE 2NUPB 1M71A 3MO1B 3MGTB 4ETYA 3F12B 4YQXL 1TVHB 3WMSA 5FR3A 5EEZA 4HIIB 4OZHF 3EF7A 1YN6B 4QHLA 2BZ7A 3FPYA 2J8OA 1ASPA 1BPLB 1SPDA 1PLGH 4HX1A 5AAMC 5DCCA 4JPQA 3SDXE 2NT1A 3IFOA 2YC1A 4YXHL 1PD1A 1AY1L 1KTJA 2YA1A 4ELMA 3GLDA 3KH4A 4GBXB 4LP8A 3JYBA 1AIFA 3N41F 3X1BA 3KYKH 3T0EC 2XN9B 3TASA 1YEFL 1A1NA 2NY0D 3QIUB 2IG2H 2OZ4L 3NCYS 2W65B 4HIJA 2PWEA 1KN2L 4XXWC 4YLBA 3K7UA 4AYID 4X0KB 4PY7A 1NMCC 2VABB 2VQ1A 3QGVA 4GS7B 4KV5E 4LHUA 3VXTA 3BUYA 2VXVH 2W9DH 4UDUA 3VRLF 3JT2A 1QKZH 4PJCE 4Y7OC 3GXFA 5BO0D 1KTLB 2CKNA 1ZHNA 1BSIA 1HAUA 3C09B 4M5ZH 5EUOA 2FBJH 5ABDE 1EZVY 4QDGA 2YBRB 1NEPA 5FA3B 4PJXB 4RWHA 4WSJA 3HS9A 3HZVA 3CFMA 5JW4M 3QORC 4K3JH 1S9XA 3GZOA 4D8PB 3GXNA 2IPUK 3DA0A 4LLVA 1WBZA 3PG2A 4G6AC 3SGEH 3BVWA 3LRSB 2HA1A 3VD5A 3ARBC 1HTYA 3DURA 3PWPD 3RX9A 5F3BB 2B4CC 5E6UB 4BK4A 3VMOA 4BZ1L 1WZAA 5EFIB 5F96L 2QFPA 5LCVH 3L54A 3DRQB 4KRPD 2NY3C 3HZMA 4W9ZA 3ARGC 1YMHA 3TVMC 5DFTA 3DTXA 4B3EA 1NFIB 3HKZA 1TTFA 3JWOC 4NO3A 2XVKA 1KBVA 4PS3A 3LS5L 2A1WL 2IXQB 3S37H 5IHUL 3FAXA 4NQXB 2DW5A 2GYSA 2P80A 4PJGF 5GJSL 1NDTA 4JQIA 4RMSA 1FNGA 1LWJA 1JCKA 4H1LH 4IRZL 1TQBC 2X0VA 5G5DA 4BK8A 2CO1A 2JVUA 3QSKB 5E9AA 3FYIB 4XVTL 3DHPA 4QRBA 5I5JA 1ES0A 1INEL 2AMGA 1BQKA 2HJFA 3FO9A 3EHBD 3T3MB 3LQAH 3VDCA 1E3FA 4R90L 4MZRA 3SDCA 1B4TA 3DV4B 3KLHC 1KJ2L 4BM7A 4YWGL 2VTFA 4N1CA 1PAZA 1PLBA 4WTWA 5EF0A 3T0BA 3SDCD 5ESVA 2BIHA 2XG4A 5D7IB 1FWXA 2CO4A 2AVFA 1MW2A 2WUCL 4IBYA 2J71A 3CG8A 3CFJA 4RFNC 1D6VL 5EN3A 5F89A 2ZWKA 2QQNH 3CSBA 3X14B 4Y2DB 2FHFA 4YZFF 5E9NA 5FOBA 3HNVL 5B39G 2C34A 3FUIA 2P8PB 3TT1L 3UEZA 1VCAA 1XTLA 4M6ML 2YS4A 3FQ2A 4DGYL 2IPUG 3TURA 1JF1B 1XGRA 1MFBH 1U8IB 2CO7B 3EYOA 4OD1H 4ZPVA 5F7UA 1CVRA 3HC3H 3NZUA 3RJOA 5LWYH 4PJGA 1NBYB 3L1FA 1TYJA 1CTOA 2HLFC 1QA9B 1R5WB 3EJZC 3V9CA 2HRHA 3EJCA 4X5LA 5BRZB 3BKJH 5CILL 5J1AA 3H53A 2VXTH 1OM3L 1OD9A 2J1KA 5IQ9B 1DVZA 2VZVA 4IS6A 3V4PA 5EU7C 2CGZA 1P4IL 5L9DH 5DU7A 1B0GB 3IMWA 3RGVD 1Q94B 4PJ8C 5FDWB 3VD3A 3BVDB 4PM1A 4A7TA 2OR8A 5DD5H 5AVWB 2R2HA 1YEDB 4HF5H 3FQNB 3T6XA 2HWZL 3IU4L 5D7LA 1OAXL 3L2LA 2ADFH 5H94B 2FL5B 1N0LB 4KK8C 4HMDA 1VAHA 3DBXA 4MXVE 4Y9FA 3AW5A 4BSVB 3QW9A 3IFNL 1N0XL 2PMZA 2VXUH 3HZKA 2JXMB 3DHJA 3HN8A 5JUEL 5CEYA 3DPBA 4JREB 4IW4C 3AS0A 5KVFE 2H26B 5F7HA 1NKGA 3D69B 5I6NA 4X99B 4XPTL 4XBPB 2FSEB 3A47A 1XSIA 1I1YA 1N68A 3VYOA 2V5TA 1GC1C 3D2TA 3LRSA 4XBPA 3WIHH 3DETC 4HCRA 4G6ML 1HL5A 3ULVC 1IBYA 1CPUA 3H9HA 2EKJA 2ZX7A 3HAEB 1CK0H 2H7WA 2XN0A 3AJ7A 1MLCA 1UJ3B 2FQFA 5FPIA 4PJIA 2IBBA 3S2CA 4HXBH 2VIRA 3MBEC 2KKQA 2VMJA 3ELAT 1XL4A 3IU3A 4OFKA 5HHVH 3FMGH 3GSUB 4O2FA 3VFPB 2QPEB 2NR6A 3CV5A 1WK0A 1X5XA 2Q8BL 2YD2A 4YBQD 3MROA 4XNZB 4QJ5B 2MEJB 4R84A 4A68A 4J3XA 5IB1B 3QRFM 2R4RL 1MRFL 1QWUA 3IGAB 1Z9MA 4U6XB 4NO0A 4AYSA 5L4IA 1RIHH 3BDXA 2E86A 4PRID 5C97A 2CDEB 2PABA 3VSTA 4QRTB 5E23A 2GTQA 4RVBA 4PY8J 4WKZB 2F58H 2ZUQC 3O8XA 4TVPD 5FAAA 5BZWB 1MHCA 4QT5A 3B7UX 4CGTA 4IOIA 4KTYA 3K71A 1HL9A 3PGDB 2AABL 2FO4A 5ISZE 3H9ZA 7TAAA 1DO5A 4A7UA 3IDNA 4WI7A 1H19A 1LQSR 2QTVA 3O6KL 1XF5A 5TH2A 5MEQB 3ZGHA 1HH9A 3DRTB 3WEMA 4YFLF 4NZTH 4QD2E 2NY7H 3KLLA 1V54B 2D3VA 5GS1C 5IB1A 4F2FA 3TBSA 2Y3AA 3RVXC 2BSEA 5FUOL 1EEUA 1RQ5A 1MJUL 3UAJA 4GXFA 1EFXD 1A8ZA 4ODSH 2HRPL 2O4EA 1BQHB 4U1SA 2AK4B 1FNFA 1QTYT 2RD0A 1IO4C 4XBEH 3QUXD 4LRIC 1NGPH 3VXUD 4XH2A 5ESVB 5I6MA 1JDAA 4R7XA 3MV8E 1MI5E 1QO3B 3C12A 3VH8A 4GI9A 1B0WA 1OTSD 4PS4L 3BAXA 4FNQA 5E6IC 1ZS8A 3NK4A 2Z92A 5KBPA 1G7JB 4LU5L 2LLNA 2WB1A 3CFKB 3BJLA 4YMPA 1PY9A 4PWKA 2IANE 4XCFH 5AKRA 1FN4B 1OW0C 1E5ZA 4CVXA 1D5XB 4CRPA 4K5OA 1W9XA 4JGUA 1KB5B 1HT6A 1QTSA 1FL5A 1N64H 2GBVA 2R56L 2KI6A 4CADA 1JZ7A 3UTTB 4X8CA 3F58L 4KRMB 5T3ZL 5B7MA 2EC9U 1OGTA 3GMOA 2OL3A 4U6XA 3QIUC 4HDIA 3TONA 4IJ3B 1ZHLA 3D06A 1IBZA 1RU9H 4AVKA 4HDIB 1J9QA 1IQWH 2CKBH 5DSCB 5IVZA 3SBQA 4FQPA 4PBVC 3HS0B 2GB2A 3MKKA 4DP0X 4BWUA 1OSPH 3R1GL 1JVLA 4C4KO 1A9BA 4J6RL 4P5SA 1SUHA 5LGHL 3OXSB 4GUOA 1UM5L 4DQAA 4B41A 3UBFA 5JIHA 4J3UA 2AJUL 1BDYA 1JYWA 2J4WH 3CZGA 1SOQA 4WKXA 5FKAB 3UZVB 1H6EA 1RPQA 3MOQA 1FGVL 4QI3A 5DC4B 1DTUA 5FKPA 4E42B 4BKSC 1JOIA 2HT4C 1U8IA 2N56A 3U46A 4X6BA 5HD8C 1U6AH 1TQTA 1EVUA 3GZKA 2BHZA 3E6FA 3FB6B 1SQMA 3HG1B 4ZAKD 1P6WA 4HV8A 4LQFH 2HFGL 1HZHH 1IEBA 2W8CA 3TNMB 3U9WA 4F58H 2XTJE 4I85A 4PJ6A 4L4VA 4JDVA 3S96B 1TETH 3EGDA 1A3ZA 1YPZF 3QO1B 1TU2A 5EZJA 3DUUB 5D2LB 1JPGB 2A9MH 1JXJA 4XVSH 4PPTA 5E9DE 2A77L 5EUKA 4P48A 1CVSC 4BKTC 1EXHA 4MX7A 5L8JB 2NY4D 1G4RA 5L7XH 1MEXH 2ZX9A 2VWEC 4AZ8B 4JBSA 3EYFB 1YYCA 4BH7A 5A16B 5D5MB 2YBGA 1A7PL 2DTML 5ACZB 5JW5A 1ED3A 1RERA 1OW0A 4JKPH 2CXGA 2IGTA 5HGDA 3OR7B 2Z31D 4W9IC 2WPGA 5B8CC 4AITA 3IJHA 1EXUA 5E8PA 1CXEA 4ABQA 4LAQL 1J9RA 3AQXA 1I9RL 1OAZH 3SO3B 2ZOUA 5L6YL 3X3FL 3BLBA 4JO1H 3ZR6A 2QGBA 1HHKA 3I9GH 3EJSA 3II1A 5IMMA 3HZMB 5HJBA 3GSXB 1F0LA 1KJ2B 1WFMA 3IDMA 1XGUA 4YL9A 4P3CL 4M8RA 3GMLA 3B5GA 1ET8A 3TO2A 4NUJB 5I0ZA 1UCTA 5EU4A 1YA5A 4MMZB 4JJ5B 4XXDB 4W9KC 1ZGLM 3Q9QA 1G9MC 1ZXKA 2XIBA 1IFGA 4HKZB 4K9EH 2EXWD 2ZCZA 4ONGH 3VFRB 1FZOB 3VWKB 4OCYL 1E4JA 2V8MA 1FDLH 4JCLA 3HLAA 1UOWA 4MMYB 2MCPH 1L3WA 2JB5L 3GJEB 3VWKD 2V37A 4M7LL 2F5BL 4XXCA 5CGBA 5ECJE 3FO9B 3IGFA 1E40A 4NYLA 4JLRA 3QEUB 4K3EL 3QJVB 1KIQA 1ETJA 4XCCH 5EEWA 2AV1B 3BYTA 4LOUC 5A2AA 4YWGH 4KJQC 1LWRA 1FAIL 1Z9NA 1D5BA 4JRYD 3JTTB 3KBFA 2AHIA 3BUYB 1TIUA 3BUBA 4U1NB 3SQBB 3BD3A 2EH8L 5JHAA 4AEHH 1JXDA 4KY1L 1ZVHA 2FJFB 2J3SA 4OGYL 3S7GA 5J12B 4ILDA 2J8UB 5ICUA 1EAOA 4Q9RL 1WA0X 3WCYA 4WFED 4O02A 2AK1H 1P84J 4HGMA 3QIBB 1XEUA 4P2QD 3U0PA 3FHQA 4LSUL 3S0PA 3UTQB 1T1ZB 5B38G 3WL9B 5KG9A 3SO5A 4YX2L 4H8QA 1LGVA 4HJ0D 2OJEB 3DGGA 4TOYL 3CU1A 4AVJA 1H5BA 3APFA 3CIAA 2OI9C 4XPFH 3ZR5A 4D8PA 1SLXA 3D39A 4N0YH 4X9IA 3SSGA 1FLTX 4F24A 4MNQB 3VUAA 1HSBB 1U9KA 1PD0A 4GMTL 5IQMA 3DO7A 5T5FL 4X5XB 3OQ3B 2UYLA 4KKCC 1D5MB 1U8JB 2KDYA 1NGZB 1NCJA 3SPVA 4OUOA 2P5EA 4M7KH 3U83A 5B7FA 3HG1D 4ZAKB 1MFBL 4YHIB 4P2CG 4ENZA 1VCBC 2HFEB 4B9IA 3T04D 2PCPB 4ZW3A 2WWOA 3I02B 3IJSA 2GTWA 2FLBT 1I7ZA 1NLDH 4YDVA 1YMMB 3IF1B 4I1NB 5JO5B 3ZIYA 4ZYKB 4KUCF 1JYVA 3GS7A 3L3OA 5HHQB 4V1DA 3GNML 3ULSB 1BQSA 3D85B 4JHUA 2I9TA 3W39B 4MMZC 1TNNA 3ISWA 2V0AA 4S1SL 1SNRA 1TCMA 3MI6A 4UILH 2XZCH 1XB6A 4UTAL 3PQYB 4RGNE 5FUZH 1JERA 3LYRA 4K9EC 1M42A 1RURL 1YEGL 2GY7B 2UXGA 2QL1A 3O6LH 3LVEA 3A4AA 3U0WH 1EFXA 4NEHB 1OB1B 5C0AB 3QJUB 3QUZC 4DGIH 5H35A 4Q6IC 4NC1E 3WN5B 4WWID 2XZQL 3BWSA 3CZEA 4ADGA 2R4SL 3FONA 5J3HD 1JIBA 2P45B 4KK9D 4GMSL 5AALA 3S2AA 2F15A 1BGXL 1XCXA 1Q1JL 2YEQA 4Z3HA 2QVTA 1JZ5A 4LLDB 1JFHA 2QHRL 2EDKA 1AMXA 3KR3L 4ZTPH 2WOYA 1HILA 3X3FH 2YGPA 1M53A 2VAJA 3ZW3A 4DCQB 3QXUA 3EO9L 3MRJB 3V5DB 5CEZD 3VU1A 3ZE2B 1I9IL 4FKKA 3BZ5A 3VI3B 4MA1B 5BUGA 3MNMA 4HCRL 3VTMA 2EXYC 4KQ3L 4PJXA 3VAEA 5I1IH 5DHYA 3C5JA 3P30L 3HNSH 4KZEL 4PRNB 1IM3B 1EUTA 1LO2H 5DZJA 3RI5K 3SODB 3WD5H 5KANG 4OZHE 4I3SH 1N0LA 1N9PA 3G9VA 3QH3A 3V8OA 5JNYB 2NY7L 4ORZC 1EFXB 5KSBA 1F3RB 4JQVA 3RKDC 5CS7A 1NFDF 4FKHA 1M1SA 5AWNH 5TE6L 5JNYA 3SDXF 2A9CA 4FQCL 4OB5H 3PWUA 2NNFA 3KGTA 3DROA 2HRPH 1SBSL 2O26U 1Q9OB 2F5AL 1QBLH 1M4KA 5LQBH 4KTDH 4WK0B 4IDLA 1NGQL 4ES8A 2MOQA 3IBEA 5AOZA 1I8AA 2F58L 4O2EA 1HU8A 1ZANH 3CWGA 1FI8C 2WIIA 4IBVA 3W0WB 5F3FA 3GM0A 4PJCF 3ZDZF 4FA8A 2X1OA 4N68A 1L9OA 4ZFOA 1CGVA 4U1MB 1P2CB 4Y19A 1OQOA 5ITFB 1O9VA 3JWNG 2CHDA 1BBDH 4TMPA 3OKKB 3NGBB 2HJLB 4PJXF 2J43A 3WN5A 3KVPA 3ZE0F 5IF0A 1AACA 2HZHA 2P5EB 1WD9A 3SGJC 1A7NH 3MLTB 5LDUA 1HKLH 4L2YA 4K8RL 1DQMH 5CR1A 5C07A 1F6AA 2BS9A 3MBEB 5GZND 3UJTL 4RAUB 1GYAA 5A43C 4X9YA 4GG8B 3LKNB 1T1XA 4UV7L 5D1XD 1JNHA 5TFSH 3TIDA 5LAXA 3NJFA 3SDDC 3TCLA 4WFFE 1LO0L 2CK0L 4XAKD 5D7JD 4DUVA 1HHIA 3EF4A 2FGWH 1A1MB 2KT6A 1J1OL 2A4ZA 2CM6A 5ITBH 3KWVA 2JIXD 1CU4L 5IT2L 1JVKA 2H32A 3B3BA 4G82A 2FYYB 4NJAH 1OT2A 2QMJA 3QXAB 1W6LA 1G87A 1WZLA 1U8QA 3QQDA 1OPOA 3SDAC 5CCKL 1AC0A 3QG6A 2X4QA 3L7EA 1QNZH 3MZTA 4LT7A 3K5RA 2HT3D 3E1ZA 4TUJA 3V4VL 2PCPA 3BPCA 2K9FB 5IBLD 4LCYA 2CJSA 3AM8A 5SWZD 2MCG1 1B88A 5KSUA 1EO5A 1PZ3A 1R3JB 2CIIB 2CRYA 3IS1X 3B34A 4B9FA 2VYRE 5F7KC 3PGCB 1SF3A 2HX9A 1IC1A 3P0VH 1E27A 4TPRL 3QG7H 3U6RA 1G7QB 3RPIB 1QI4A 4B7LA 4RAUA 4XH2B 2DQFB 3DURB 3QS3A 4P59L 5F3BA 4PRIA 4HGWA 4HHWA 3US9A 1S5IL 4ANKA 5DEGB 1FYTA 1AQDA 1MRCH 3TH2T 5B38B 1U3ZA 2GK2A 1X5IA 2XNAB 5DS8A 4AIZB 1LILA 2GT9B 1KC5H 1QSFE 4TLSA 1DSFL 4CW1A 4PGDB 1FGVH 4IMKC 4TL4A 4X2UA 4ZMNA 4AV0A 5EUOB 4K3EH 4RMQA 1XGTA 4BCZA 1FGNH 3UZVA 4J2QA 3W56A 5FYKD 2BP0A 1ACXA 2DWXA 1MCJA 3E6HA 2GUOB 1OGAA 2IWKA 4XNZC 5C8JA 4W9HC 2KUTA 3K46A 4LHJB 3QARA 5FECB 3V6FA 2WZPD 3RIFK 5I6OA 2VZOA 3F83A 3QYMA 2GHWB 3BZ4B 2IFFL 2H47C 1UUSA 4L3EB 4HCFA 5EU3B 1MNNA 2OMWA 3T0WA 4BZ1A 4ZMPA 2YC1B 1EMTL 2CGRH 1CF8L 4R96B 2PXYA 2UXVA 3BXNB 1E43A 4O2FB 2WANA 4BQ8A 3CC5B 2R7EA 2NY6B 3F7KA 1IGTA 2YPKA 2FCBA 1B90A 1L7TH 3EKCA 4J8RB 2XFGB 4KQ4H 4X4KA 4ZUTB 2CK2A 4G7SB 4GLRH 5B1JA 4AYMC 3GMRB 3Q8FA 4MNHB 4ZUWA 1L0XA 4XMPL 3AITA 3BFQG 5C86A 3WTYA 1NCNA 2BSTA 1OM9A 4XB8A 3G5ZA 3REWA 2J2ZA 3WELA 3SKNB 4UV4L 5CLYA 2F5AH 2DQEH 3UZEC 4AQ1B 2WJ7A 3ZPDA 2ZP0T 4J5VA 5E8DL 4ATWA 1ZV9A 1NSNH 3LZPA 2GKIA 1ADQH 1YHPA 2YLKA 4JHAH 2PKDA 4RBPK 4F2EA 2JKLA 3FSVA 4IKLA 1N5AB 2X1PA 1QBBA 1EPFA 3CDYA 4NQSB 2VITA 1PMYA 4JFYB 1UB6A 35C8L 4TS6A 1N4XL 1F4YL 1YEKH 5DXWA 3U1SH 1X4YA 4U1LB 3FTGA 4P2OA 4QXTA 5E24E 5DS1A 5H94A 1NICA 1CB4A 2X9YA 3GSQB 1C08A 4AJ0A 2ZJSH 3TN0C 1G9EA 3ABGA 1ED3B 4MS6A 5CINL 1YY9C 4I2XB 3ARBA 4BFIB 4I48B 3L3GA 3O6FC 3GMNA 5DHVA 3V4UL 5A16A 5ILTH 1YQVL 2KQNA 3X3GH 1BF8A 1AGCB 3MRPB 4AQAB 2SODB 4ZOBA 1MJ8L 4JKMA 2DQCH 3QDGB 5AB0A 1DQQB 4LLMA 3ZMRA 4G8GD 4LSDA 4WCYH 3S48A 2ZXAA 5DEFB 3PWPB 1RZQA 2ICWA 1KCUL 3GJFB 3KYOB 1WGVA 3MTXA 5CIPH 4Z78A 5I8CB 1CF1A 3S5YA 4TULH 4IKJA 8FABA 2CHXA 4EZKA 2CBOA 1G9NC 2ARJB 4JFFA 3VXPB 4XN8A 4KX8A 2EO7A 1L9SA 3ZKMD 2BRRH 2WQUA 4IDJH 4R26L 5D1ZA 4GI6A 3AWFA 4KI1A 3EUDA 3FCTA 4OGZA 1IUZA 2MH4A 3M07A 3R4RA 2OZ4H 1CI5A 4MJ2A 3BP6A 3TZVC 4UNIA 4OCNC 1TTGA 4JPKH 2AJYL 1IAIL 3W9EA 3FL7A 3RIAF 3SZ6A 2BVQA 2CRZA 3A6CH 5T1DL 5D1QC 5D71L 2NXYC 4EDWL 2GG1A 3C6LC 5KYWA 5JPNB 2HTKC 3FT1A 1UH4A 3KDPB 4KUZL 1JN6A 32C2B 5CD5D 4F37F 3KWWB 1HQRB 1NCAL 5JQ6H 3IMTA 1NLBL 3QDMB 4PTUB 1LEIA 2F54B 2CLRA 2IWFA 4J28A 4OZIE 2EVJA 1JAEA 3QXDB 4I9WD 4NAMA 3MFGB 3U0TA 2UWEE 4BFJA 2EE3A 5B4MD 5IOKA 4APXB 1FYTE 1IAMA 4UZSA 2WZ0A 3D48R 1LQBC 2F54D 4AYDC 1SM3H 4Y1TA 2YAMA 1OLLA 3U0WL 1IKFL 5ESAB 1IX2A 4ZMVA 2X2UA 2NQDA 3QEQD 2WQWA 1PLGL 4CU6A 2VC2H 2YSSA 1E6OL 2Y9RT 3DWTA 5TDPA 3ZSTA 3VD2A 4X6DA 4LPWA 2X70A 3RBGA 2CU9A 2NY1D 1Q1JH 4PGBA 2Q6WA 4M7LT 1NIFA 1PX3A 3AREA 3QPQC 3HG0A 3B2VH 4PRIE 4HKXB 1DQQA 1ZTMA 1E4HA 1N12A 1N3NB 2QEJA 4Z1PA 5E4EB 2DQJL 3CVBA 5C08D 3P0YH 3NDYE 4U1JB 1QFUH 4HPOH 2IV8A 1EO8L 1NC2D 3WFHB 5L0QB 1BVNP 3Q6FA 1VIWA 3EH5B 3K4AA 4R4BA 4N6QA 1KN4L 3EOBA 5HI3D 4RZKA 3VG9B 1RZJH 3ECUA 5JXAH 3MRGB 4W6WB 2G4GA 1RUPL 2CUIA 5I73B 3QQ3B 1NOLA 4WTXA 3QUYA 4K5PA 3SE9L 1UVQB 4N0RA 4HJJL 1JHKL 2CXKA 3FO0H 4OF3A 2HMIC 2AQ3A 2Q0ZX 5DC2A 3TA3B 1G1YA 1WE5A 2CDGA 4LCVA 4XMPH 1T0NB 4LE8A 4CUCA 4QHMA 4K71B 2FJHA 5GGUB 2WY3B 2XXGA 3G6DL 4U1JA 1JV2A 1SFHA 3MUHL 4HIJB 3FRUB 3SDDB 4JUSA 3WKMH 4BELD 4PV1C 1OTUC 3QHZL 4X9BA 3GBDA 3FH8A 5TQ0H 3DC0A 3TT1H 1LTXA 1LK2A 4FULA 4UB0L 4DVRH 1L3NA 2OAAA 4QY8B 4Q4EA 4BRJA 3Q5YA 2VW6A 3BIBX 3JWNC 2R2EA 3OWRA 1B2WH 4J39A 2JXMA 4HD5A 3U30B 4AVHA 4HT1L 1TTRA 3C5XA 4HLEA 1R5IA 4ELKB 3CUPB 1A4KB 4WI8A 4MZ2A 1DZBA 1PX4A 3KAAA 3NSDA 3NRFA 4U3CA 1DQTA 1L9TA 2V9QA 5GS2H 4FLOA 3HB3D 3S88L 5F7DA 1QSEE 3S96A 2PPAA 1AO7A 1INEH 2APXA 3VFVB 5FYJU 3N9GL 4BYHA 3P40A 2GIXA 2H3NA 3VFSA 3JTSB 4PRHE 4NUGL 5JMOC 1QEXA 5EIIA 2FSDA 2N1KA 3GBNH 4KPHH 1TMCB 4WWKC 1BPVA 5CFAA 1ESOA 1OAXH 1DSFH 2RB8A 5KVEH 2FWSA 4KU1A 3TTYA 1NCDL 4UQAA 5CHNA 3Q2WA 4K15A 4PV8A 1FPTL 5JQIB 2Z31A 1AAJA 3ZL4H 2Y2WA 5KBDA 3PF2A 4QXVA 5IMOA 4G9DA 3MRBB 2F7OA 4WI6A 1TVBA 2ZUXA 4NPYA 2BY0A 1RH8A 3DXAB 3SE4C 3R06B 1KJVB 1OTTD 2I85A 1MXGA 3L5WB 3NIFF 3RG1C 1E5YA 4A2LA 4X6DF 2WQAA 4L48A 2VLJA 4EBQH 3MRCA 2DV6A 1DQML 4Y5VB 1NH6A 4XPBH 5CJBA 4HSQA 5CZXC 4JY6A 3X11B 1JV5A 2N7SA 4GUPA 4MNQE 3AY4C 2F08A 1CLYH 1KT2B 1MREL 2Q7YB 1KB9K 1OLZA 4MS8D 1JWSA 3AT9A 3CLEL 4P4RA 3HE6A 1E9PA 2E0PA 4BFKA 1AI1H 5FW8A 4YLCA 1DQIA 2MIZA 2BWIA 3TYGL 2F1AA 3ARBB 3FN0H 3SB3A 2IGFL 3L9RA 2EIJB 1BV8A 4S10A 3UPAA 4PRPE 5F7NC 2WP3O 4ACPA 4JFHD 4JFVA 2P42B 2VUKA 1QOKA 3Q44A 4ZYKA 5I2IA 1N7MH 5IESH 5HHNB 3BAYA 2KLRA 3IJSB 1JF1A 3OB0H 3EHBB 4V1DE 2EEDA 4PJDA 1QO3A 3AMKA 3II2A 1NMAH 3A4DA 1P5UB 4LCCB 3QK0A 4JFQB 3GBEA 4B5ZA 3VFOB 4G1MA 5I1DA 1VZHA 2FZ3B 4N25A 4XNMA 1XT5A 3OAUH 4YH6A 2J1XA 5IHHA 1W0VA 1E28B 3BVNB 3DOIA 2A9NL 2IALB 4PRIB 1K4DB 2OZNA 3AADB 4QHNA 5GJSH 1CR9H 3SKOB 3H42H 3BVXA 3JQOB 4YHYC 4FC3E 4LCWB 3LKSA 3FT9A 2VLJD 1RUKL 1E6JL 4I9XA 5I1JL 1AQ8A 3T1FB 2IOIA 4LIQL 4S11A 1M1XB 2G75A 3S6CA 3RTQD 3OXRB 2PYFB 3SOBL 3CC1A 4G6JH 2ID5A 4WW2B 3R7QA 3K4ZA 5D70H 1YRKA 4PJ5B 3GDCA 4R90H 1LE5B 2GJZA 4FQLL 2BIOA 1T5XA 3LIUA 4I88A 3QXAA 4D9LH 2A74A 1NC4A 3LPWA 2DTSA 3BMVA 1HI6B 3GRBA 3T2LA 5KW9H 3NA9L 4ABWA 1FG2A 1FP5A 4MJID 2YJLA 2YN3A 2B20A 2VQ1B 1UXSA 3DVIA 1UADC 3RI5F 1CFBA 2V3FA 1S7RB 5CN1A 5I1HH 1DJZA 1CICA 4TSBH 5F7EH 3KW8A 4NUQA 5A3ID 5I1LA 2WYTA 3TEXA 3VWJA 4PJIE 1FL3A 1A5FL 3ARWA 2PYED 4GQ9H 3I6SA 2R56H 4KRLB 3FHAA 3RYMA 2LFGA 4HXAH 4JRWA 1TO4A 4OD3L 1BIHA 2YEZB 3QUKB 3D9AH 3T2PA 3HBQA 3IDIA 5ITFA 1M7DA 4V2BA 1NAML 1DVTA 3ZTJH 3AREC 3IKCB 4LP5A 1BD2A 3AT8A 3NCMA 5I8OH 4ODSL 3BDBA 4WU5B 5GRVL 4P3DB 5KYUB 1RJYB 2PW2B 3V79C 4POZD 3UTSE 2O5NA 1P7HL 3PXLA 4MMZA 2AS5M 1HE7A 4JHAL 1AG0A 1W16A 4UIKL 3GQFA 2ZG1A 3HG3A 2YRLA 4M6NL 4NQEA 2J4WL 2F7PA 3TJHC 5E5UB 1PTZA 4HAKA 4KXAA 2F53B 3S4SB 4CA4A 3VTTA 3TYFB 2HG5B 5D2NA 1JPTL 2YHGA 4GAYA 2BNQE 3VACA 4K8RD 2VW4A 4AIOA 4I77L 1FIGL 4PLJC 3RGVA 1ZAGA 1JPSL 4BHUA 5LUMA 2QDVA 4JW3A 1WWCA 3BWAA 3H2PA 1A3RL 4YSAA 1PG7H 3J2PA 4APQD 3FT0A 4EUPG 1GJIA 3CX2A 3P69A 2VXQA 3HBPA 5HGBB 4KKAD 4E9QA 4JPKL 5HI4C 2R7EB 2J6EH 1NEUA 1XSOA 4NZFA 5HGBA 5L2KD 1DUZB 4HD9A 3RRQA 1IM9B 3BGMA 4WUKL 4QO1A 5I1GH 2EVGA 2FUTA 3NABL 4XGZA 4QY8A 1DE4B 2CR3A 3HE6C 4GKOA 2Q1EA 1QR4A 2DM3A 2WXRA 4H25B 1IQDA 4G8GB 1CLZL 1HILB 1MAMH 1KIPB 2EC9T 4JFTA 4LEBA 3HC2A 4LO9A 3QYNA 1FVCB 1NWOA 3AY4A 2HG5A 2CCWA 4B9YA 4OLYH 2HT2C 5FGSA 3BVNA 1A6ZA 4G8EA 4MDJB 2BVOB 4BQ9A 2WNWA 3GSOB 3NSJA 1XO8A 3PNWA 4M9OA 1I7UA 4KXBA 1X5KA 4MBRA 2EILB 4G6MH 4MQTB 1RZGA 1SHWA 2HFTA 4ALAL 4AC2A 5KZCD 4ZFZA 2LU4A 1NGXA 2BW5A 2DQHH 4ZMQA 2MOGA 5EG6C 5E6RB 5J13B 4Y2DD 2DI7A 5A2IH 3RZCC 4HWBH 1CGTA 4RETB 1BZDA 1SVCP 1VA9A 4NKOA 1I8KA 1NPNA 4NHUB 1X5ZA 2N3JA 4PJ9C 2GABA 4WW1B 2AXFA 1QW9A 3MHZA 2R4RH 2XQBH 4NFBA 5D6CB 5B38A 2O5ZH 2WCPA 1JZDC 5GGQL 4CVUA 5DEGA 5LLIC 3HOGA 1TJGH 1U8HB 5E8EA 3FRPA 4RAVA 4Y4HC 3CH1A 2KL6A 2J5WA 3U6XS 1F90H 5E5LA 1FL3B 1ZDQA 3VWJB 2HVJB 3O9WB 3W5NA 3FBQA 1ZOXA 4H88H 4IMLB 4JANA 3UJIH 5BPPA 1MPAH 2LU3A 3I02A 1VESA 4DFHA 5FO8A 1P84K 1MJJA 3LRMA 4X7TB 5DJ8B 3RVVC 2IXQA 1OD7A 1CD1B 2NCEA 4MQ7B 5CIPA 3QFJB 1NFIA 4HIXL 4NM8H 4PJFF 3JT0A 2KC0A 4G80B 1UWYA 4KXDA 4QTFA 5A6LA 1KSRA 4AENA 2QMKA 4L9LB 4RFEB 3SKJH 4Y4KA 5GXBB 3NDZE 2WSKA 2PTTA 5F8QC 4E41D 2VL4A 2GJPA 1XXDC 4PIRF 1UWXK 3FRPB 4M5YH 3W5MA 3VRIB 1M2OA 4H0IA 3T2NL 4DGWC 1OAQH 2VT0A 1NBQA 3B3IA 1XCTA 4GSDH 1CFVL 5HJ3B 4KXZI 1JNHB 4TSAL 5AZ2H 1TCRB 4PJHE 4MD4A 1ASOA 3QP3A 2ZX5A 4AYFB 3VXNA 3ZU8A 1A0QL 3PFUA 3O4OB 4ETQA 1Z7JA 4PJCA 5AZUA 1P7QA 3W57A 4FNLL 3CXHK 4G1MB 4Q4IA 4MAUH 5I1DB 4HS3B 4OCYH 4LMQE 4WW2F 4DKFH 1X5AA 1ZT4A 4FABH 3TJEL 3H2QA 2ADJA 3OJDB 3FFCE 2VABA 3VXMD 2B15A 4NKIH 4HFUL 3VQMA 3WFDL 4MD5B 5GGSY 4D7BA 2RH0A 1X5GA 1KIPA 1N70A 1PZ5B 1Q90A 2DAVA 4F8NA 3FF7A 3NFSH 4MXQD 1LXMA 4IOIB 3QZOA 4TN9A 2RGSA 2ZNXA 5I6KA 1MY7A 3PQYD 4PUBL 5I0XA 5GSVA 3WIFB 5KEZA 3BEVB 2JCCF 4TKWA 4J6RH 5LGHH 1JMZA 1OT4A 3KPRB 3GMNB 3FQXA 3PUUA 4G6KL 3MUY1 5DHVB 1GAFL 5B7EA 4ZD3H 4TQIA 4KX7A 5IFAL 1GSMA 2ITEA 4HKZA 3V0HA 5EA0H 3HVDA 3OPZL 4UM9D 3L5XL 2CCLA 2F8VA 4HUUA 5ERWA 1BF5A 5DA4A 2YUVA 4N0UB 3VG0H 1QLEH 5IJKC 3LRHA 3JWOH 2AQTA 4J12A 4ZNEA 4QOKB 1IBHA 1FJ1A 4G8AC 4U6VH 4ODTH 4FA7B 3BZEB 3U9UB 3D39B 4KPHL 4P99A 4OGAC 1UG9A 3H9HB 2WVVA 1GJUA 4YPGA 1OK8A 1UATA 3FF8A 3OKOB 4GRMA 5I5MA 4KJPD 1AR1C 3WXWH 3L16A 2BNQA 2GITB 5E5MB 2DQUH 1FRGL 4R3SB 3RIAK 3U4KA 2OYKA 4LAJH 3ARQA 4PJGE 2IH1A 5IR1A 4GMSH 4PJFE 1MWAB 1QSFB 2DIJA 3CFIC 5EO1B 4X6CB 5C08A 1QR1B 3OL2A 2I7OA 1KGCE 3M6DA 4KTEL 1K5NB 2BIQA 2WQ8A 4X4XB 5E95B 4DP1X 4P46D 2BY3A 3DX9B 5EPMA 3LPOA 4KQ0A 3ABZA 5DK2A 2EDDA 3JWDL 3LTVA 2XBTA 4DQOH 4G42A 4LVNB 3S9DB 1X9UA 2OMVA 4J2XA 1RZKC 2DYPD 5DJDA 4RGMC 3ZE2F 1YPZA 2Z4QB 3NCFB 3RBSA 3MZGB 4X8JA 3FT3B 4OU3A 2XWTB 1HXYA 1TJMA 4S2SA 3QDME 4JY6B 4XX1E 4HFWB 4YDJB 1OAZL 4PJHF 5FO9A 2KPWA 2HTLC 4OD3H 1G0XA 1JGUH 3V6FB 5J6GA 3NZ8B 4YHZH 2OSWA 3KEDA 4AE1A 4K5MA 2Z3FA 4CKQA 1T7WA 2YD5A 2IDQA 4AMWA 2MCPL 1KB5A 2P9RA 4L8SB 4X7CC 1A7BA 1BOYA 3LQZA 1ZLVH 3DYOA 5CR8A 4N3TA 3GB7A 3OXRA 4PJGB 4Y5YA 4PRAA 1RZIB 2WTOA 4OFPA 4EVNA 4Q9QL 1A7QL 2H0EA 3MGAA 5IW1B 4KROD 4HKBA 1V3LA 4C47A 1NAMB 2OV0A 4L1DA 3NA9H 4BGDA 3FU6A 4XCEB 1KJ2A 2HN7B 2WKLA 1TLMA 3QJXA 1SJXA 1U3YA 2KZWA 2ZPKH 1PVHA 1WISA 3LEXB 2OSYA 1A6WH 2PO6B 1DFBH 2DBJA 4G7YH 2Y23A 4NWTH 2WWMC 4PVNA 1YEJL 2V2TA 2FZ3A 1AHWA 5E2UH 1E3ZA 4KX9A 1T66D 4R4BB 4UOQA 2BCKA 4FYQA 4JPIB 3EYUL 4P2AA 4WFGE 3RVUC 4OZIF 2JK5B 4HUVA 1EDQA 4L3FA 4FFVC 5I1IL 2JB6B 1P1VA 4M62H 2B08A 4C56B 4JDEA 5HDQL 1Y18B 4KJYB 5HTSA 5JW5B 5I2IB 3LNGA 2MPAH 3N55A 3NGBC 5GRUH 4HIEA 1TJXA 5HDOA 3BQUD 4JG1H 3F6IA 4EN3C 2MKWA 4Y4KC 5A2FA 1AQKH 2CLZB 3ARFA 1F3DJ 3O0RH 4NQED 3VI4B 5JOPE 4OCRL 5DJXA 3QO1A 4IRSC 4N90E 4AK2A 1XSKA 2VE6B 1NL0H 3GYRA 5FM5M 2YWYA 4P23C 4JG0H 1CDCA 4A2GA 3OMNB 4LDEB 5EZIL 5I1KL 5TPWL 2J6WA 4KOBA 5E7FA 4J3WA 3VSVA 1RZKH 2OXHA 3BZEA 1KEML 4KKZA 3DNKA 2V2TB 2CLRB 4KZCA 2XV0A 1U8LA 5E08H 1H6FA 4LVEA 1MFDL 5A6IA 4H8WC 3DX8A 1GH7A 6PAZA 3D3VD 5INDA 2OX5A 1ITBB 2D73A 4FG6D 1DR9A 1O6SB 1OWRM 2BSTB 2VUOA 1BA9A 4I18B 3QIWB 3V2AR 4RGMB 4X4YA 3PIQB 1CC3A 1SYVB 3CSYB 2BZDA 4H20L 4OCWH 1RJLB 1YNTF 1IGYB 3RUGA 1RUML 1MG2C 2D7MA 3UBXI 4AYEC 4CILA 3KPOB 1UA6L 2WBJA 3FU7B 3WOVA 3JTBA 4YSQA 4X6FA 2Q5BA 4PJ8A 4BUHA 3KJ4B 1PCSA 4Y5VC 3VFUA 1GKEA 3G5VB 4WKZA 5KSBE 1M05B 2FR4B 5C0CB 5CAYB 1PZ5A 3S3SA 4B96A 1WPCA 1JNJA 2G5BB 2WW8A 2YAEA 1SDYA 2F54E 4S1SH 2HXAA 5KZCB 4OZIB 4LCIH 1FGNL 3MCLL 1JNNL 2AERT 2CO2A 4UM8A 1DQJB 5GSVB 2FL5A 2ZNWA 2GUOA 1D5XA 2YKLL 1CYWA 5DUML 4EEEA 4ZTOL 1VFMA 2ZKWA 3C2SA 3KPOA 1K8IA 3L4WA 1MFUA 2BDNH 4AZUA 3GHBH 1KCVL 1IJ9A 3C09C 2FX9L 3BVUA 4FA6A 4LGSB 1DYZA 2WBKA 5D1QE 3T3PB 1OANA 2XWJA 4D3CL 5AW0B 4WO4C 3SDDA 4A2DA 1J11A 1T2QH 2NNXA 4HETA 1A0QH 1SFDA 3AVEA 1CF8H 1WRFA 4Z8FH 2EACA 2L7QA 3H1ZA 4C58B 4P57A 5TE4L 4DUWA 3WTXA 5FCUL 3FNKA 3EGSA 2C9SA 3BO8A 5KS9A 3BH8B 3UYRH 5F7FA 3VTAA 5FYLD 3TJEH 4WDIA 1R0AH 2VDMH 4PJDB 3I3BA 2GSIB 3QJTB 4YHOL 1FH5L 4G80A 1BG1A 1EQWA 3O2DA 3G5ZB 2VDQH 4N1EA 3SKJL 1B9KA 2Z8RA 1COBA 2RHEA 4J3OH 3KMDA 2I32A 4AH2A 4FTVB 2WYIA 1D5IH 4PUBH 4M1CC 2B2XH 1MI5A 2VXQH 2FRGP 1JUFB 2UY6A 1DBMH 1R46A 3C8DA 4JFZL 4KZ0A 5E1HB 1OAQL 1BF2A 4GIAA 3MV11 4CVZA 5EEYA 4NDMB 2FEEL 2JK5A 4HUVB