1XW6A

1.9 angstrom resolution structure of human glutathione s-transferase m1a-1a complexed with glutathione
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
217
structure length
217
Chain Sequence
PMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGNKITFVDFLVYDVLDLHRIFEPKCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFSKMAVWGNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase Mu 1
publication title Transition state model and mechanism of nucleophilic aromatic substitution reactions catalyzed by human glutathione S-transferase M1a-1a.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 75
structure length 217
sequence length 217
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2004-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1xw6A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1xw6A01
1H75A 2O7KA 1AAZA 2OE3A 5CNWA 4KDXA 10GSA 2HT9A 5ECHB 2PVQA 1Z6MA 4K7IA 3L9SA 4IQ1A 3TRQA 1GNWA 2YJHA 5B8BA 2B7KA 2H01A 1DUGA 1KTEA 5DQSA 1V2AA 3L78A 4EUYA 1BYEA 1I5GA 1X9SB 2H8LA 4Q5QA 2VL2A 1TK0B 3KD0A 12GSA 2FWGA 4AF2A 3LGCA 4ZBBA 4HUAA 11GSA 2L5OA 2VCQA 1E2YA 1TK8B 3GIXA 1PKWA 2MYGA 2JL4A 1GUHA 2KLXA 1HNBA 4DVCA 1WIKA 1G7OA 4IJIA 5FT3A 3GKNA 1TRSA 2L4CA 4KCEA 1VF2A 3M9KA 5CP1A 1SKWB 3ME8A 4KSMA 1FB6A 5G1KA 3GSSA 4XS4B 3F8UA 1VRSD 3P2AA 1GTAA 3U6VA 2VM1A 3C7MA 3QFBC 4ZB6A 3DXBA 4ML6A 2HRFA 2B1LA 2O87A 1PGTA 2LNTA 4G9HA 5ID2B 4Z7XA 2DMMA 2FUG2 2X8CA 4HU7A 4J57E 5IO2A 3LG6A 4DSSB 4PGTA 4EE0A 3BJ5A 5GSTA 1XCCA 1GTIA 3ZYWA 2HSHA 3APSA 3GTUA 2VUPA 4TKYA 1LU4A 4JRRA 3O3TA 2B1KA 4DSQA 1UA5A 3QCPA 4IQAA 4K7NA 2IL3A 3CSJA 5IMFA 3G7JA 5IO0A 2WCIA 2DIYA 1MEKA 4MJEA 3HYPA 1T1VA 2ZUPA 1M9AA 4OMVA 3TJBA 1FHEA 1XWCA 4GSTA 4J56E 1G7EA 5CRGA 4POMA 1K3YA 4L8EA 3P90A 3US3A 4WKWA 3CRUA 3ZIJA 2E2MA 1GL8A 1TRVA 2GVPA 1YZXA 2H71A 1LBKA 1GP1A 1N8JA 3F0IA 4OCFA 4YQMA 2BTOT 1X5CA 4GF0A 4F9ZA 4ZL8A 1K0MA 1OKDA 4QL9A 4I2UA 4HQSA 3QFAC 5HR0A 8GSSA 4K1FA 4P3YB 3GV1A 4QL7A 2VAFA 4AJ7A 3UBKA 1O6JA 2PUKC 2YWMA 3UAPA 1GULA 1USBA 3GKXA 3VI5A 3EU4A 3QR6A 3HCZA 3IR4A 4FH8A 1MD3A 2BJXA 4XHMA 3DWVA 5DJLA 4KA0A 2LSTA 1SK1A 3UIWA 4EC0A 18GSA 1J08A 1PSQA 2WJUA 4TRXA 1QQ2A 2GZZA 3LXTA 1OE8A 1OVNA 2C0DA 4GSNA 2PGTA 2C4JA 4HDEA 4BL7B 5KEJA 2AUVA 2DJKA 4WXTA 2NVLA 3KTBA 3IC4A 3G9BA 1EZKA 5KN3A 4PXOA 2YJ7A 4ZIJA 3KCMA 1FVKA 2CVDA 4O92A 3LXZA 3WGXA 1YY7A 2TRXA 2JU5A 1K0OA 1KBNA 3ZRDA 3F4RA 5ECIB 3QAVA 1GNEA 5CRDA 2RM5A 2BMXA 2AB6A 1PN9A 2FWHA 5IMAA 5ECSA 4MZBA 4K0NA 4E8HA 1Z7PA 3D6IA 5DAKA 2L6CA 3GMFA 2V1MA 2REMA 1Y25A 1SENA 1VF4A 3ZIVA 2LRCA 1SYXA 2H0GA 4ID0A 2WRTA 1JZWA 4FYUA 3RDWA 2PMTA 4NWYA 4WBRD 3IE3A 1ZMAA 4KSOA 4EVMA 5F05A 3M9JA 1XWKA 2FWEA 1QMVA 2V2GA 2NDOA 3PPUA 1GSSA 2HSMB 4TXOA 4N0VA 2KHPA 3N9JA 5ECRB 4OO5A 3RHBA 1FOVA 2EIOA 3KP8A 1EV9A 1ERTA 5D9XA 4F0BA 2DJ2A 2CZ2A 4YQUA 4H86A 3F3QA 4XRAA 4OFNA 5EY6A 4LLRA 1WRYA 3GRXA 1YQ1A 1X5EA 2N5BA 5EVOA 4EO3A 1OKTA 1YDKA 1AC1A 1K0AA 6GSSA 4EKZA 3IDVA 4ZB8A 4LL4B 1O7UA 1JZRA 3GH9A 2YP6A 4GLTA 3FKFA 3L4NA 2YNXA 1YKAA 2YPMA 2FNOA 4IS0A 2YN1A 1GWCA 2B3SA 4GSSA 5G5EA 3J7Yb 5F0GA 4RUVA 3IAS2 4RI7A 2A4VA 2B7JA 4MZWA 1QXHA 3M0FA 2TRCP 1GSDA 2WGRA 3BD2A 3HXSA 4BVYA 4MJCA 1ON4A 3APOA 3KMNA 4X0XA 2C8UA 3E0UA 4FIWA 2I3YA 1A8LA 2CVBA 3SBCA 2P5RA 1R5PA 3HJOA 1THXA 3Q19A 2ZNMA 3FYGA 3HDCA 3VI7A 3ZZXA 3UEMA 3ZFLA 4EL1A 2LV3A 2FLSA 1PKZA 1SL2B 3A2XA 3HY2A 2H75A 3HVXA 1V58A 4OCEA 2GSRA 3GSTA 1PD21 1T4YA 2LJAA 4HJ2A 4KF9A 6GSXA 1EV4A 3GHAA 3TKSE 4EXJA 4PURA 4Q5NA 4ML1A 3HJMA 3QAWA 1PL1A 2LTKA 1M2BA 1A0RP 1NHOA 3ZL5A 3FY7A 3EU3A 2H30A 3KP9A 1LJRA 3LQ7A 3HZ8A 3HKRA 2CAQA 4K7OA 4WR4A 1T00A 4HZ2A 3KXOA 3I69A 3GN3A 4RQXA 4QQ7A 2H6XA 2KP1A 2F9SA 2P0GA 1EGOA 2HZEB 4F0CA 1MDKA 2HRKB 7GSSA 2HI7A 1YEPA 4LA1A 3L0HA 3D5JA 14GSA 1O73A 2LQQA 3P7XA 5B7CA 5HFGA 3A3TA 1AQXA 3U5RE 3DYRA 3EMXA 3PGTA 1TU7A 2DLXA 2IFQB 4IN0A 5DCGA 1M9BA 3TJJA 2YOIA 3UJ1A 1WE0A 3A2VA 3UMAA 5KN2A 3FRCA 4N11A 2HQTA 5IMCA 1Z3EA 1FVJA 5B6NA 5IIZA 4YAPA 4BWSA 5HR3A 1B8XA 2QC7A 4FYCA 2R5GA 1WWJA 4K8MA 3UARA 5H5QA 2ON7A 4HZ4A 3VK9A 4KX4A 3NOFA 1WJKA 3FW2A 3RPPA 2RM6A 2B6MA 1JLWA 2JZRA 1WOUA 4MA9A 2X8HA 4LMWA 3R2QA 4G0KA 3F9UA 4EDZA 3QDNA 4WBJA 3IOSA 1U87A 4JE1A 2UZ8A 2H73A 2V41A 1FO5A 3E9JB 3Q18A 2OE0A 1VGLA 2V6KA 4KCAA 1QUWA 1U3AA 3H4KA 4NXIA 4PQIA 2VIMA 4X1UA 3TJKA 4NHWA 3CYNA 2PN8A 2HSMA 5B8AA 1XOBA 3ZMKA 1XWBA 2GQKA 1YF0A 4G19A 1SK2A 2C0GA 2C80A 3QMXA 5H5SA 3UL3A 5HFIA 1KEBA 4Q5RA 2AJQB 1SJZA 1B4QA 1QK8A 2L6DA 5G5FA 17GSA 3WYWA 2VL9A 2PERA 3HVSA 5DALA 2JACA 5IMZA 5G2ZA 3ZFBA 4V2NA 3CSHA 1HQOA 1OE7A 3TOTA 2C3NA 2OKAA 2GLRA 2L4QA 1HYUA 4BWQA 1A2LA 1ZL9A 1J9BA 2JSZA 2PU9C 2OJLA 4NHZA 4HS1A 1SYRA 3L9VA 2AV4A 1XZOA 3EYTA 1FG4A 1XBSA 5DBQA 1Q98A 1XOAA 4WEYA 5ELAA 2GQMA 4F82A 1HNAA 4KUNA 5DQYA 2RIIA 4CW9A 3MDKA 3IK9A 2VOCA 3DVWA 2FHEA 3TB2A 1X9MB 1TW9A 1Z7RA 3APQA 2IMEA 3KIJA 3FEUA 1SL1B 5CYYA 3M3MA 5G30A 4KW6A 3TOUA 5ECPB 2GT5A 4K6XA 1K0NA 3I43A 2VO4A 2LQOA 4TR1A 1ERUA 3H1NA 2VD1A 1JFUA 3VWUA 1NSWA 2JZTA 1V57A 5C00A 1AIUA 4ZXGA 3S9FA 1F6MC 1M2AA 1AQVA 1EOGA 2L59A 2DBCA 2ON5A 1EOHA 1XWGA 2K8VA 3IRAA 3PH9A 1EEJA 3VFIA 3W8SA 2X64A 4MJBA 3GUSA 2B5EA 5FWGA 3IC8A 3VWXA 2LRTA 4I2TA 3C8EA 5LCZA 1OC9A 4BVXB 3RAZA 5DCHA 3HZ4A 3M8NA 1SKSB 2CZ3A 2O85A 3QD9A 2HZEA 1THOA 4RI6A 5KN0A 2H6ZA 4MPFA 1SD8A 5A4VA 1EP7A 5E59A 4KDYA 2EIQA 2M80A 3HA9A 3OR5A 1K0DA 3TKSA 4TR0A 2ES7A 1EGRA 1R26A 4TOPA 1XWAA 4NAXA 1SK0A 3TJFA 5F8BA 4TXVA 2CQ9A 4KAEA 3N5OA 2RLIA 2DJ0A 1F2EA 2GT6A 5HR2A 1OYJA 3LWAA 3UOMA 1X0RA 4N0ZA 3ZREA 3O76A 3TKRA 2E2GA 4I5QA 3ZMLA 2WS2A 1TOFA 4IBPA 1SJ6A 19GSA 3UVTA 1W89A 2F3MA 4OFMA 1HD2A 4OWYA 1UVZA 4D73A 3EE2A 2V6OA 2C0FA 2KOKA 2YWOA 1U88A 3KJYA 2EC4A 2QKEA 1TI1A 4USSA 1ERWA 2CV4A 2K18A 3DMLA 1XIYA 3W6GA 1RQMA 3NIVA 4IJ3A 4GXZA 2FD3A 4ZB9A 2HFDA 3ERGA 3DIEA 4ISDA 4YQVA 1GLQA 2A2SA 5GZZB 1T3BA 1E6BA 1ZCPA 4MH3A 3ME7A 2GTUA 3CTGA 2VL2C 3BCKA 2H0IA 5B6MA 1K0CA 4PNGA 3FR6A 1EEMA 4O5RA 2O89A 1J0FA 1ACVA 1HNCA 1R7HA 2FCHA 2M46A 1JZDA 3GURA 3WT2A 1PL2A 3D4MA 4TR4A 4RQRA 2VD0A 5CRHA 1TTZA 5ECNB 3ZVJA 3QPMA 2IMKA 3O6TA 1MDIA 2HYXA 3QAGA 3TKQA 1C72A 1YJ6A 2GSQA 4MK3A 1OC8A 5IMVA 5JCWA 2CX4A 4L5LA 2H0HA 5JWOB 4XS4A 1A8YA 3F4TA 5A5KA 1BJXA 3IXRA 1ABAA 1CQGA 3EINA 3CXGA 1VF1A 2DSAA 4JEDA 2JZSA 2FWFA 1X9WB 1ILOA 2LKUA 5ID2A 2NTOA 1A2MA 3EVIA 1TP9A 4K2DA 4DSSA 3Q74A 1XW6A 1DE1A 1W4VA 4GQFA 4HOJA 1XPVA 5AIVA 2H72A 1GLPA 2CT6A 2L57A 3C71A 2KUCA 4O7HA 1XXUA 3F63A 1AXDA 3GTUB 2R6KA 2GGTA 4MABA 1BG5A 1DSBA 4KNDA 1ZYEA 2LS5A 3IK7A 1PX7A 1TRWA 3F4SA 4MPGA 4N10A 2R3XA 2F8AA 1JZOA 2RUEA 5EPFA 4IELA 4IP1A 3J7Yk 1AQWA 1M7TA 13GSA 2QSIA 1AW9A 2H6YA 3G7YA 2TIRA 3C1RA 2H1GA 4O32A 4K0GA 5D9WA 2WULA 5JWRB 4JBBA 2H1AA 3LJRA 2JADA 4G2EA 3KEBA 4PTSA 3EMPA 3GX8A 4HQZA 1V40A 5ECMB 6GSWA 3F6DA 3BBYA 3MWHA 1WPIA 2HXKA 1NHYA 3HVVA 3CMIA 3UBLA 1TK5B 5GAPD 2VCTA 5INYA 2IMDA 1O8WA 2X99A 2A2RA 3TRXA 2R37A 3QOUA 4ECJA 3A5WA 4XRDA 4HEA2 1WMJA 1BEDA 2B5YA 5ECOB 3LORA 4YAVA 3DVXA 4ULXA 3TKSC 3I6AA 1B48A 5JWQB 1G0TA 3TGZA 5GSSA 2GZYA 4BL7A 4XCSA 1NM3A 4KE3A 1QGVA 5J9BA 4N30A 4ILFA 3WGEA 2YZHA 3L9UA 2MBSA 1XFLA 3DGQA 2XBIA 4AJ8A 2IJYA 1M0UA 9GSSA 2FA8A 2VCXA 2C1YA 1Q4JA 2GSSA 1ZYQB 3KTLA 1YF1A 2G2QA 3D4TA 2GQLA 4FYBA 1PMTA 3TDGA 2XPDA 4PUFC 3FZ4A 5D73A 1TI3A 1GSUA 5ENUA 1K3OA 1B9XC 5EL8A 2GSTA 3WGDA 4I97A 2D2ZA 3R3EA 2JSYA 5AN1A 3M1GA 5DAKB 3RHCA 5ELGA 2L5LA 4E8EA 3GL3A 3KGKA 2IN3A 2GDRA 4IVFA 5KN1A 1M2DA 3MAKA 4IGJA 2MMNA 4XS6A 1OC3A 5D8IA 1URMA 1N2AA 4NMUA 4WF5A 4OFTA 4GCIA 4DSRA 1TXXA 2F51A 4ZL7A 1NW2A 2XHFA 2QGVA 2YV9A 3VPQA 5CRWA 4HJMA 5JCGA 2IIYA 5G1LA 1TKDB 3CBUA 1GSQA 5J41A 3RBTA 4FQUA 4TXOB 2HE3A 2HLSA 2MZCA 4MJAA 4V1Ag 3EWLA 3GYKA 5AGYA 3IPZA 4X43A 4I8BA 4MCUA 5COHA 3FHKA 2ZCTA 4BA7A 4G10A 5DDLA 2NPBA 3HHVA 1F9MA 2VLVA 4ZBAA 2DC5A 4G0LA 5CO3A 3FZAA 4JR6A 2I81A 3TKPA 1PA3A 1BQ7A 1XW9A 1FW1A 3ED3A 1GUKA 2IPAA 5FHIA 2MMAA 1A0FA 2CA8A 2WDUA 4V1Ap 3AY8A 1ST9A 4GQCA 4MDCA 5J4UA 2FGXA 3HD5A 2YWNA 3LSZA 2N5FA 1GSEA 3F6FA 3C1SA 3KH9A 5D9VA 3TRPA 3VURA 5AIXA 5ECQB 4ECBA 2DJ1A 2VCWA 1TDIA 2HNLA 2CAIA 5AISA 2B5XA 16GSA 4BVYB 4IW9A 4TN8A 2LRNA 5A4UA 3KM6A 2PBJA 3Q6OA 1EWXA 4GWRA 1WP0A 4I6XA 4ZILA 5D9TA 2XC2A 3P8WA 4WR5A 3GA4A 3VWWA 2MMZA 2PVOC 2C0EA 3HJPA 1K3LA 4F2IA 4AJ6A 4PX1A 1YKCA 1TRUA 3GKMA 4AGSA 3WD6A 1O81A 3LYKA 2H76A 4WF4A 3ERFA 1AUCA 4PNFA 2HRNA 2HRAA 1S3DA 3A2WA 3ZTLA 2OBIA 1H4OA 4OO4A 2LNSA 4MP4A 3ZITA 5LNKe 3SWLA 1O8XA 3ZLPA 6GSYA 3UVHA 2YCDA 2IMFA 1TJDA 1A2JA 5C04A 5ECLB 4K9ZA 2FA4A 5DVBA 2J9HA 1F3BA 3EURA 1T7PB 2HSNB 2P31A 5H5RA 2N5AA 5J5NA 5IMDA 5HR1A 4PQHA 2YV7A 5A4WA 2HRKA 3LEFA 1GRXA 1KNGA 5IOXA 2VL3A 1Z9HA 2CX3A 1MD4A 4GTUA 3BOAA 2H70A 4NV2A 3ERWA 4WETA 4ZBDA 2GS3A 2IFQA 5IM9A 3GH6A 3VLNA 4V2LA 5HFKA 1B9YC 3KH7A 1DBYA 2AYTA 3DRNA 3V1WA 6GSUA 2PWJA 3D21A 2H74A 1O85A 4IKHA 3IHQA 6GSTA 2KP2A 1G6YA 2HZFA 2AHEA 3PINA 3FK8A 6GSVA 5F07A 1IYHA 1F37A 2FY6A 1A23A 4KDUA 1A24A 5IQYA 3MSZA 3NZNA 3RPNA 2DIZA 4HI7A 1XVWA 1JHBA 2LUSA 1TU8A 5JCUA 1K0BA 2WZ9A 4NPBA 4MLYA 1S3AA 1JLVA 2XPEA 2R4VA 2X8GA 3H8QA 3ISOA 1F3AA 4L5OA 4Q5FA 3FR9A 3ZVJD 2HSYA 2OACA 1X5DA 4ECIA 1DE2A 5CREA 4EF0A 4YH2A 1SJIA 3KZQA 4KB3A 3CSIA 4LMVA 2G0FA 20GSA 2PPTA 4PQ1A 3TJGA 5L71A 5ABRA 4POBA 4V2MA 4ACSA 2MMOA 5F06A 2DMLA 3LFLA 4KGIA 4XTSA 4IHUA 1ZZYA 1PQNA 2M72A 1T8EB 2K8SA 3KMOA 3LYPA 5LD0A 4DEJA 3G7IA 1B4PA 2YANA 3E3EA 2GZPA 1GUMA 5E4WA 4JR4A 3BCIA 4MZCA 3GX0A 4BPYA 4OD7A 4PUAA 3DEXA 1BX9A 4LL1B 2E7PA 1UN2A 4POLA 1GSFA 3GFKA 1IYIA 5DALB 2F8FA 1XVQA 1SKRB 2VLUA 1MDJA 3GKKA 4IP6A 1FAAA 2IWTA 2VM2A 3WT1A 4KH7A 3D22A 22GSA 2O8VB 5BMUA 2K6VA 3FZ5A 2V32A 2RUFA 4L0WA 4ECCA 3JCML 1R4WA 1YEXA 2EIRA 4TR3A 2K9FA 3H79A 3K8NA 1R5AA 3VPTA 2C3QA 5IOWA 3DKSA 1V98A 5D93A 1M99A 2LJRA 2Z9SA 1SL0B 2VCVA 1ZGNA 2P5QA 4TVEA 1VF3A 5D96A 3W8JA 3I9V2 2LJKA 5J9CA 4MF5A 2DJ3A 3FZ9A 5HQPA 1U3IA 2ALBA 1GSYA 3IA1A 1GH2A 2AAWA 3VWVA 2VCZA 2H19A 4EDYA 2MBTA 1OAZA 4JU5A 4HU9A 2R2JA 4TR1B 3C73A 2IMIA 2VLTA 2OA7A 2DJJA 2YZUA 1G6WA 1ML6A 3DD3A 5G31A 1GTUA 4TW5A 1SU9A 2C3TA 3GL5A 4XS1A 2H66A 2WFCA 1PRXA 4BVXA 1Z6NA 1U6TA 2H1BA 3F3RA 2H1DA 1CQHA 5ECKB 2NBSA 3IBHA 1RW1A 1OC9B 1QFNA 2OE1A 5GAND 3D0ZA 1V9WA 1UC7A 1MTCA 5CAXA 1Z5YE 1PX6A 3EC3A 3IAM2 2XBQA 1I9DA 4JZQA 4XIHA 4G0IA 5J3RA 2OBKA 1XW5A 4MH2A 3TUEA 4POKA 4NV5A 4ZL9A 5DJMA 1BAYA 1S3CA 2I9HA 5IPGA 1T4ZA 2YWIA 2OADA 2J23A 3TCOA 1RK4A 3MNGA 1ERVA 3H93A 3PR8A 3GNJA 4GRFA 2I1UA 4MF7A 3CRTA 2WB9A 1ZOFA 1SD9A 2E0QA 3IV4A 4L0UA 1EP8A 2LEGA 1FB0A 4J2FA 4MMMA 4CDOA 3CTFA 4D73B 5IPHA 4F03A 2I4AA 3FR3A 1Y6EA 2CVKA 1GTBA 4CHSA 4FO5A 4MF6A
chains in the Genus database with same CATH superfamily
1H75A 2O7KA 1AAZA 2OE3A 5CNWA 4KDXA 10GSA 2HT9A 5ECHB 2PVQA 1Z6MA 4K7IA 3L9SA 4IQ1A 3TRQA 1GNWA 2YJHA 5B8BA 2B7KA 4CY8A 2H01A 1DUGA 1KTEA 5DQSA 1V2AA 3L78A 4EUYA 1BYEA 5A1NA 1I5GA 1X9SB 2H8LA 4Q5QA 2VL2A 1TK0B 3KD0A 12GSA 2FWGA 4AF2A 3FMWA 3LGCA 4ZBBA 4HUAA 11GSA 2L5OA 2VCQA 1E2YA 1TK8B 3GIXA 1PKWA 2MYGA 2JL4A 1GUHA 2KLXA 3EPTA 1HNBA 4DVCA 1WIKA 1G7OA 4IJIA 5FT3A 3GKNA 1TRSA 2L4CA 4KCEA 1VF2A 3M9KA 5CP1A 1SKWB 3ME8A 4KSMA 1FB6A 5G1KA 3GSSA 4XS4B 3F8UA 1VRSD 3P2AA 1GTAA 3U6VA 2VM1A 3C7MA 3QFBC 2EFHA 4ZB6A 3DXBA 4ML6A 2HRFA 2B1LA 2O87A 1PGTA 2LNTA 4G9HA 5ID2B 4Z7XA 2DMMA 2FUG2 2X8CA 4HU7A 4J57E 5IO2A 3LG6A 4DSSB 4PGTA 4EE0A 3BJ5A 5GSTA 1XCCA 1GTIA 3ZYWA 2HSHA 3APSA 3GTUA 2VUPA 4TKYA 1LU4A 4JRRA 3O3TA 4A5PA 4Z2TA 2B1KA 4DSQA 1UA5A 3QCPA 4IQAA 4K7NA 2IL3A 3CSJA 5IMFA 3G7JA 5IO0A 2WCIA 2DIYA 1MEKA 4MJEA 3HYPA 1T1VA 2ZUPA 1M9AA 4OMVA 3TJBA 1FHEA 1XWCA 4GSTA 4J56E 1G7EA 5CRGA 4O5QA 4POMA 1K3YA 4L8EA 3P90A 3US3A 4WKWA 1FOHA 3CRUA 3ZIJA 2E2MA 1GL8A 1SVMA 1TRVA 2GVPA 4PHZC 1YZXA 2H71A 1LBKA 1GP1A 1N8JA 3F0IA 4OCFA 4YQMA 2BTOT 1X5CA 4GF0A 4K5RA 4F9ZA 4ZL8A 1K0MA 1OKDA 4QL9A 4I2UA 4HQSA 3QFAC 5HR0A 1ZYPA 8GSSA 4K1FA 4P3YB 5A5HA 3GV1A 4QL7A 2VAFA 4AJ7A 3UBKA 1O6JA 2PUKC 2YWMA 3UAPA 1GULA 1USBA 3GKXA 4N3ZA 3VI5A 3EU4A 3QR6A 3HCZA 3IR4A 4FH8A 1MD3A 2BJXA 4XHMA 3DWVA 5DJLA 4KA0A 2LSTA 1SK1A 3UIWA 4EC0A 18GSA 1J08A 1PSQA 2WJUA 4TRXA 1QQ2A 2GZZA 2EFCA 3LXTA 1OE8A 1OVNA 2C0DA 4GSNA 2PGTA 2C4JA 4HDEA 4BL7B 5KEJA 2WVZA 2AUVA 2DJKA 4WXTA 2NVLA 3KTBA 3IC4A 3G9BA 2R0GA 1EZKA 5KN3A 4PXOA 2YJ7A 4ZIJA 3KCMA 1FVKA 2CVDA 4O92A 3LXZA 3WGXA 1YY7A 2A4HA 4EIQA 2TRXA 2JU5A 1K0OA 1KBNA 3ZRDA 3F4RA 5ECIB 3QAVA 1GNEA 5CRDA 2RM5A 2BMXA 2AB6A 1PN9A 2FWHA 5IMAA 5ECSA 4MZBA 4K0NA 4PI0C 4E8HA 1Z7PA 3D6IA 5DAKA 2L6CA 3GMFA 2V1MA 2REMA 4G01A 1Y25A 1SENA 1VF4A 3ZIVA 2LRCA 1SYXA 2H0GA 4ID0A 2WRTA 1JZWA 4FYUA 3RGBC 3RDWA 2PMTA 4NWYA 4WBRD 3IE3A 1ZMAA 4KSOA 4EVMA 5F05A 3M9JA 4BIKA 1PFOA 1XWKA 2FWEA 1QMVA 2V2GA 2NDOA 3PPUA 1GSSA 2HSMB 4TXOA 4N0VA 2KHPA 3N9JA 5ECRB 4OO5A 3RHBA 1FOVA 2EIOA 1YEWC 3KP8A 1EV9A 1ERTA 5D9XA 4F0BA 2DJ2A 2CZ2A 4YQUA 4H86A 3F3QA 4XRAA 4OFNA 5EY6A 4LLRA 1WRYA 3GRXA 2QA1A 1YQ1A 1X5EA 2N5BA 5EVOA 4EO3A 1OKTA 1YDKA 1AC1A 1K0AA 6GSSA 4EKZA 3IDVA 4ZB8A 4LL4B 1O7UA 1JZRA 4AKHA 3GH9A 2YP6A 4GLTA 3FKFA 3L4NA 2YNXA 1YKAA 4YKFA 2YPMA 2FNOA 4IS0A 2YN1A 1GWCA 2B3SA 4GSSA 5G5EA 3J7Yb 5F0GA 4RUVA 3IAS2 4RI7A 2A4VA 2B7JA 4MZWA 1QXHA 3M0FA 2TRCP 1GSDA 2WGRA 3BD2A 3HXSA 4BVYA 4MJCA 1ON4A 3APOA 3KMNA 4X0XA 2C8UA 3E0UA 4FIWA 2I3YA 1A8LA 2CVBA 3SBCA 2P5RA 1R5PA 3HJOA 1THXA 3Q19A 2ZNMA 3FYGA 3HDCA 3VI7A 3ZZXA 3UEMA 3ZFLA 4EL1A 2LV3A 2FLSA 1PKZA 1SL2B 3A2XA 3HY2A 2H75A 3HVXA 1V58A 4OCEA 2OT3A 2GSRA 4AI6A 3GSTA 1PD21 1T4YA 2LJAA 4HJ2A 4KF9A 6GSXA 1EV4A 3GHAA 3TKSE 1I1IP 4EXJA 4PURA 4Q5NA 4ML1A 3HJMA 3QAWA 1PL1A 2LTKA 1M2BA 1A0RP 1NHOA 3ZL5A 3FY7A 3EU3A 2H30A 3KP9A 1LJRA 5BRTA 3LQ7A 3HZ8A 3HKRA 2CAQA 4K7OA 4WR4A 1T00A 2HSNA 4HZ2A 3KXOA 3I69A 3GN3A 4RQXA 4QQ7A 2H6XA 2KP1A 4EIPA 2F9SA 1N25A 2P0GA 1EGOA 2HZEB 4F0CA 1MDKA 2HRKB 7GSSA 2HI7A 1YEPA 3LW9A 4LA1A 3L0HA 3D5JA 14GSA 1O73A 2LQQA 3P7XA 5B7CA 5HFGA 3A3TA 1AQXA 3U5RE 3DYRA 3EMXA 3PGTA 1TU7A 2DLXA 2IFQB 4IN0A 5DCGA 5J4VA 2WVYA 1M9BA 5A34A 3TJJA 2YOIA 3UJ1A 1WE0A 3A2VA 3UMAA 5KN2A 3FRCA 4N11A 2HQTA 5IMCA 1Z3EA 1FVJA 5B6NA 5IIZA 4YAPA 4BWSA 5HR3A 1B8XA 2QC7A 4FYCA 2R5GA 1WWJA 4K8MA 3UARA 5H5QA 1BF5A 2ON7A 4HZ4A 3VK9A 4KX4A 5J47A 3NOFA 1WJKA 3FW2A 3RPPA 2RM6A 4K5SA 2B6MA 1JLWA 2JZRA 1WOUA 4MA9A 2X8HA 4LMWA 3R2QA 4G0KA 3F9UA 4EDZA 3QDNA 4WBJA 3IOSA 1U87A 4JE1A 2UZ8A 2H73A 2V41A 1FO5A 2R0CA 3E9JB 3Q18A 2OE0A 1VGLA 2V6KA 4KCAA 1QUWA 1U3AA 3H4KA 4NXIA 4PQIA 2VIMA 4X1UA 4O5UA 3TJKA 4NHWA 3CYNA 2PN8A 2HSMA 5B8AA 1XOBA 3ZMKA 1XWBA 2GQKA 1YF0A 4G19A 1SK2A 2C0GA 2C80A 3QMXA 5H5SA 3UL3A 5HFIA 1KEBA 4Q5RA 2AJQB 1SJZA 1B4QA 1QK8A 2L6DA 5G5FA 17GSA 3WYWA 2VL9A 2PERA 3HVSA 5DALA 2JACA 5IMZA 5G2ZA 3ZFBA 4V2NA 3CSHA 1BG1A 1HQOA 1OE7A 3TOTA 2C3NA 4YKGA 2O36A 2OKAA 2GLRA 2L4QA 1HYUA 4BWQA 1A2LA 3HMJG 1ZL9A 1J9BA 2JSZA 2PU9C 2OJLA 4NHZA 5BMUB 4HS1A 1SYRA 3L9VA 2AV4A 1XZOA 3EYTA 1FG4A 1XBSA 5DBQA 1Q98A 1XOAA 4WEYA 5ELAA 2GQMA 4F82A 1HNAA 4KUNA 5DQYA 2RIIA 4CW9A 3MDKA 3IK9A 2VOCA 3DVWA 2FHEA 3TB2A 1X9MB 1TW9A 1Z7RA 3APQA 2IMEA 3KIJA 3FEUA 1SL1B 5CYYA 3M3MA 5G30A 4HSCX 4KW6A 3TOUA 5ECPB 2GT5A 4K6XA 1K0NA 3I43A 2VO4A 2LQOA 4TR1A 1ERUA 3H1NA 2VD1A 1JFUA 3CQFA 3VWUA 1NSWA 2JZTA 1V57A 5C00A 1AIUA 4ZXGA 3S9FA 1F6MC 1M2AA 1AQVA 1EOGA 2DKHA 2L59A 2DBCA 2ON5A 1EOHA 1XWGA 2K8VA 3IRAA 3PH9A 1EEJA 3VFIA 3W8SA 2X64A 4MJBA 3GUSA 2B5EA 5FWGA 3IC8A 3VWXA 2LRTA 4FXYP 4I2TA 3C8EA 5LCZA 1OC9A 4BVXB 3RAZA 5DCHA 3HZ4A 3M8NA 1SKSB 2WVXA 2CZ3A 2O85A 3QD9A 2HZEA 1THOA 4RI6A 5KN0A 2H6ZA 4MPFA 1SD8A 5A4VA 1EP7A 5E59A 4KDYA 2EIQA 2M80A 3HA9A 3OR5A 1K0DA 3TKSA 4TR0A 2ES7A 1EGRA 1R26A 4TOPA 1XWAA 4NAXA 1SK0A 3TJFA 5F8BA 4TXVA 2CQ9A 4KAEA 3N5OA 2RLIA 2DJ0A 4Z2UA 1F2EA 2GT6A 5HR2A 1OYJA 3LWAA 3UOMA 1X0RA 4N0ZA 3ZREA 3O76A 3TKRA 2E2GA 4I5QA 3ZMLA 2X4AA 2WS2A 3TU3B 1TOFA 4IBPA 1SJ6A 19GSA 3UVTA 1W89A 2F3MA 4OFMA 1SVOA 1HD2A 4OWYA 1UVZA 1S4BP 2A2PA 4D73A 3EE2A 2V6OA 2C0FA 2KOKA 2YWOA 1U88A 3KJYA 2EC4A 2QKEA 1TI1A 4USSA 1ERWA 2CV4A 2K18A 3DMLA 1XIYA 3W6GA 1RQMA 3NIVA 4IJ3A 1SVLA 4GXZA 2FD3A 4ZB9A 2HFDA 3ERGA 3DIEA 4ISDA 4YQVA 1GLQA 2A2SA 5GZZB 1T3BA 1E6BA 1ZCPA 4MH3A 3ME7A 3MIXA 2GTUA 3CTGA 2VL2C 4E68A 3BCKA 5A1NB 2H0IA 5B6MA 1K0CA 4PNGA 4X4JA 3FR6A 1EEMA 4O5RA 5J40A 2O89A 1J0FA 1ACVA 1HNCA 1R7HA 2FCHA 2M46A 1JZDA 3GURA 3WT2A 1PL2A 3D4MA 4TR4A 4RQRA 2VD0A 5CRHA 1TTZA 5ECNB 3ZVJA 3QPMA 2IMKA 3O6TA 1MDIA 2HYXA 3QAGA 3TKQA 1C72A 1YJ6A 2GSQA 4MK3A 1OC8A 5IMVA 5JCWA 2CX4A 4L5LA 2H0HA 5JWOB 4XS4A 1A8YA 3F4TA 5A5KA 1BJXA 3IXRA 1ABAA 1CQGA 3EINA 3CXGA 1VF1A 2DSAA 4JEDA 2JZSA 2FWFA 1X9WB 1ILOA 2LKUA 5ID2A 2NTOA 1A2MA 3EVIA 1TP9A 4K2DA 4DSSA 3Q74A 1XW6A 1DE1A 2EFDA 1W4VA 4GQFA 4HOJA 1XPVA 5AIVA 2H72A 1GLPA 2CT6A 2L57A 3C71A 2KUCA 4O7HA 1XXUA 3F63A 1AXDA 3GTUB 2R6KA 2GGTA 4MABA 1BG5A 1DSBA 4KNDA 1ZYEA 2LS5A 3IK7A 1PX7A 1TRWA 3F4SA 5J4YA 4MPGA 4N10A 2R3XA 2WW1A 2F8AA 1JZOA 2RUEA 5EPFA 4IELA 4IP1A 3J7Yk 1AQWA 1M7TA 13GSA 2QSIA 3CHXC 1AW9A 1M3IA 2H6YA 3G7YA 2TIRA 3C1RA 2H1GA 4O32A 4K0GA 5D9WA 2WULA 5JWRB 4JBBA 2H1AA 3LJRA 2JADA 4G2EA 3KEBA 4PTSA 3EMPA 3GX8A 4MNNA 4HQZA 1V40A 5ECMB 6GSWA 3F6DA 3BBYA 3MWHA 5KOWA 1WPIA 2HXKA 1NHYA 2WW3A 2H1LA 3HVVA 3CMIA 5A5HB 3UBLA 1TK5B 5GAPD 2VCTA 5INYA 2IMDA 1O8WA 2X99A 2A2RA 3TRXA 2R37A 3QOUA 4ECJA 3A5WA 4XRDA 4HEA2 1WMJA 1BEDA 2B5YA 5ECOB 3LORA 4YAVA 3DVXA 4ULXA 3TKSC 2QA2A 3I6AA 1B48A 5JWQB 1G0TA 3TGZA 5GSSA 2GZYA 4BL7A 4XCSA 1NM3A 4KE3A 1QGVA 5J9BA 4N30A 4ILFA 3WGEA 2YZHA 3L9UA 2MBSA 1XFLA 3DGQA 2XBIA 4AJ8A 2IJYA 1M0UA 9GSSA 2FA8A 2VCXA 2C1YA 1Q4JA 2GSSA 1ZYQB 3KTLA 1YF1A 2G2QA 3MYDA 3D4TA 4W66A 2GQLA 4FYBA 1PMTA 3TDGA 2XPDA 4PUFC 3FZ4A 2O5VA 1M3JA 5D73A 1TI3A 1GSUA 5ENUA 1K3OA 1B9XC 5EL8A 2GSTA 3WGDA 4I97A 2D2ZA 3R3EA 2JSYA 5AN1A 3M1GA 5DAKB 3RHCA 5ELGA 1PN0A 2L5LA 4E8EA 3GL3A 3KGKA 2IN3A 2GDRA 4IVFA 5KN1A 1M2DA 3MAKA 4IGJA 2MMNA 4XS6A 1OC3A 5D8IA 1URMA 1N2AA 4NMUA 4WF5A 4OFTA 4GCIA 4DSRA 1TXXA 2F51A 4ZL7A 1NW2A 2XHFA 2QGVA 2YV9A 3VPQA 5CRWA 4HJMA 5JCGA 2IIYA 5G1LA 1TKDB 3CBUA 1GSQA 5J41A 3RBTA 3IHGA 4FQUA 4TXOB 2HE3A 2HLSA 2MZCA 4MJAA 4V1Ag 3EWLA 3GYKA 5AGYA 3IPZA 4X43A 4I8BA 4MCUA 5COHA 3FHKA 2ZCTA 1ZYNA 2VKZG 4BA7A 4G10A 5DDLA 2NPBA 3HHVA 1F9MA 2VLVA 4ZBAA 2DC5A 4G0LA 5CO3A 4QMKA 3FZAA 4JR6A 4AKGA 2I81A 2WW2A 3TKPA 1PA3A 1BQ7A 1XW9A 1FW1A 3ED3A 1GUKA 2IPAA 5FHIA 2MMAA 1A0FA 2CA8A 2WDUA 4V1Ap 3AY8A 1ST9A 4GQCA 4MDCA 5J4UA 2FGXA 4PI2C 3HD5A 2YWNA 3LSZA 2N5FA 1GSEA 3F6FA 3C1SA 3KH9A 5D9VA 3TRPA 3VURA 5AIXA 5ECQB 4ECBA 2DJ1A 2VCWA 1TDIA 2HNLA 2CAIA 5AISA 2B5XA 16GSA 4BVYB 2EFEA 4IW9A 4TN8A 2LRNA 5A4UA 2WZSA 3KM6A 2PBJA 3Q6OA 1EWXA 4GWRA 1WP0A 4I6XA 4ZILA 5D9TA 2XC2A 3P8WA 4WR5A 3GA4A 3VWWA 2MMZA 2PVOC 2C0EA 3HJPA 1K3LA 4F2IA 4AJ6A 5KOXA 4PX1A 1YKCA 1TRUA 3GKMA 4AGSA 3WD6A 1O81A 3LYKA 2H76A 4WF4A 3ERFA 1AUCA 4PNFA 2HRNA 2HRAA 1S3DA 3A2WA 3ZTLA 2OBIA 1H4OA 4OO4A 2LNSA 4MP4A 3ZITA 5LNKe 4K2XA 3SWLA 1O8XA 3ZLPA 6GSYA 3UVHA 2YCDA 2IMFA 1TJDA 1A2JA 5C04A 5ECLB 4K9ZA 2FA4A 5DVBA 2J9HA 1F3BA 3EURA 1T7PB 2HSNB 2P31A 5H5RA 2N5AA 5J5NA 5IMDA 5HR1A 4PQHA 2YV7A 5A4WA 2HRKA 3LEFA 1GRXA 1KNGA 5IOXA 2VL3A 1Z9HA 2O3EA 1MD4A 2CX3A 1TXUA 4GTUA 4AKIA 3BOAA 2H70A 4NV2A 3ERWA 4WETA 4ZBDA 2GS3A 2IFQA 5IM9A 3GH6A 3VLNA 4V2LA 5HFKA 1B9YC 3KH7A 1DBYA 2AYTA 3DRNA 3V1WA 6GSUA 2PWJA 3D21A 2H74A 1O85A 5A34B 4ICYA 2WW0A 4IKHA 3IHQA 6GSTA 2KP2A 1G6YA 2HZFA 2AHEA 3PINA 3FK8A 6GSVA 5F07A 1IYHA 1F37A 1YVLA 2FY6A 1A23A 4KDUA 1A24A 5IQYA 3MSZA 3NZNA 3RPNA 2DIZA 4HI7A 1XVWA 1JHBA 2LUSA 1TU8A 5JCUA 1K0BA 4GDFA 2WZ9A 4NPBA 4MLYA 1S3AA 1JLVA 2XPEA 2R4VA 2X8GA 3H8QA 3ISOA 1F3AA 4L5OA 4Q5FA 3FR9A 3ZVJD 2HSYA 2OACA 1X5DA 4ECIA 1DE2A 5CREA 4EF0A 4YH2A 1SJIA 2DKIA 3KZQA 4KB3A 3CSIA 4LMVA 2G0FA 20GSA 2PPTA 4PQ1A 3TJGA 5L71A 5ABRA 4POBA 4V2MA 4ACSA 2MMOA 5F06A 2DMLA 3LFLA 4KGIA 4XTSA 4IHUA 1ZZYA 1PQNA 2M72A 1T8EB 2K8SA 3KMOA 3LYPA 5LD0A 4DEJA 3G7IA 1B4PA 2YANA 3E3EA 2GZPA 4ZB7A 1GUMA 5E4WA 4JR4A 3BCIA 4MZCA 2X49A 3GX0A 4BPYA 3CWGA 4OD7A 4PUAA 3DEXA 1BX9A 4LL1B 2E7PA 1UN2A 4POLA 1GSFA 3GFKA 1IYIA 5DALB 2F8FA 1XVQA 1SKRB 2VLUA 1MDJA 3GKKA 4IP6A 1FAAA 2IWTA 2VM2A 3WT1A 4KH7A 3D22A 22GSA 2O8VB 5BMUA 2K6VA 1XG8A 3FZ5A 2V32A 2RUFA 4L0WA 4ECCA 3JCML 1R4WA 1YEXA 2EIRA 3HVNA 4TR3A 2K9FA 3H79A 3K8NA 1R5AA 3VPTA 2C3QA 5IOWA 3DKSA 1V98A 5D93A 1M99A 2LJRA 2Z9SA 2R0PA 1SL0B 2VCVA 1ZGNA 2P5QA 2UV8G 4TVEA 1VF3A 5D96A 3RFRC 3W8JA 3I9V2 2LJKA 5J9CA 4MF5A 2DJ3A 3FZ9A 5HQPA 1U3IA 2ALBA 1GSYA 3IA1A 1GH2A 2AAWA 3VWVA 2VCZA 2H19A 4EDYA 2MBTA 1OAZA 4JU5A 4HU9A 2R2JA 4TR1B 3C73A 2IMIA 2VLTA 2OA7A 2DJJA 2YZUA 1G6WA 1ML6A 3A5IA 3DD3A 5G31A 1GTUA 4TW5A 4CY6A 1SU9A 2C3TA 3GL5A 4XS1A 2H66A 2WFCA 1PRXA 4BVXA 1Z6NA 1U6TA 2H1BA 3F3RA 2H1DA 1CQHA 5ECKB 2NBSA 3IBHA 1RW1A 1OC9B 1QFNA 2OE1A 5GAND 3D0ZA 1V9WA 1UC7A 2WVXB 1MTCA 1S3RA 5CAXA 1Z5YE 1PX6A 3EC3A 3IAM2 2XBQA 1I9DA 4JZQA 1Y1UA 4XIHA 4G0IA 5J3RA 2OBKA 1XW5A 4MH2A 3TUEA 4Z2RA 4POKA 4AKXB 4NV5A 4ZL9A 5DJMA 1BAYA 1S3CA 2I9HA 5IPGA 1T4ZA 2YWIA 2OADA 2J23A 3TCOA 1RK4A 3MNGA 1ERVA 3H93A 3PR8A 3GNJA 4GRFA 2I1UA 4MF7A 3CRTA 2WB9A 1ZOFA 1SD9A 2E0QA 3IV4A 4L0UA 1EP8A 2LEGA 1FB0A 4J2FA 4MMMA 4CDOA 3CTFA 4D73B 5IPHA 4F03A 2I4AA 3FR3A 1Y6EA 2CVKA 1GTBA 4CHSA 4FO5A 4MF6A
chains in the Genus database with same CATH topology
1H75A 2O7KA 1AAZA 2OE3A 5CNWA 4KDXA 10GSA 2HT9A 5ECHB 2PVQA 1Z6MA 4K7IA 3L9SA 4IQ1A 3TRQA 1GNWA 2YJHA 5B8BA 2B7KA 4CY8A 2H01A 1DUGA 1KTEA 5DQSA 1V2AA 3L78A 4EUYA 1BYEA 5A1NA 1I5GA 1X9SB 2H8LA 4Q5QA 2VL2A 1TK0B 3KD0A 12GSA 2FWGA 4AF2A 3FMWA 3LGCA 4ZBBA 4HUAA 11GSA 2L5OA 2VCQA 1E2YA 1TK8B 3GIXA 1PKWA 2MYGA 2JL4A 1GUHA 2KLXA 3EPTA 1HNBA 4DVCA 1WIKA 1G7OA 4IJIA 5FT3A 3GKNA 1TRSA 2L4CA 4KCEA 1VF2A 3M9KA 5CP1A 1SKWB 3ME8A 4KSMA 1FB6A 5G1KA 3GSSA 4XS4B 3F8UA 1VRSD 3P2AA 1GTAA 3U6VA 2VM1A 3C7MA 3QFBC 2EFHA 4ZB6A 3DXBA 4ML6A 2HRFA 2B1LA 2O87A 1PGTA 2LNTA 4G9HA 5ID2B 4Z7XA 2DMMA 2FUG2 2X8CA 4HU7A 4J57E 5IO2A 3LG6A 4DSSB 4PGTA 4EE0A 3BJ5A 5GSTA 1XCCA 1GTIA 3ZYWA 2HSHA 3APSA 3GTUA 2VUPA 4TKYA 1LU4A 4JRRA 3O3TA 4A5PA 4Z2TA 2B1KA 4DSQA 1UA5A 3QCPA 4IQAA 4K7NA 2IL3A 3CSJA 5IMFA 3G7JA 5IO0A 2WCIA 2DIYA 1MEKA 4MJEA 3HYPA 1T1VA 2ZUPA 1M9AA 4OMVA 3TJBA 1FHEA 1XWCA 4GSTA 4J56E 1G7EA 5CRGA 4O5QA 4POMA 1K3YA 4L8EA 3P90A 3US3A 4WKWA 1FOHA 3CRUA 3ZIJA 2E2MA 1GL8A 1SVMA 1TRVA 2GVPA 1YZXA 2H71A 1LBKA 1GP1A 1N8JA 3F0IA 4OCFA 4YQMA 2BTOT 1X5CA 4GF0A 4K5RA 4F9ZA 4ZL8A 1K0MA 1OKDA 4QL9A 4I2UA 4HQSA 3QFAC 5HR0A 1ZYPA 8GSSA 4K1FA 4P3YB 5A5HA 3GV1A 4QL7A 2VAFA 4AJ7A 3UBKA 1O6JA 2PUKC 2YWMA 3UAPA 1GULA 1USBA 3GKXA 4N3ZA 3VI5A 3EU4A 3QR6A 3HCZA 3IR4A 4FH8A 1MD3A 2BJXA 4XHMA 3DWVA 5DJLA 4KA0A 2LSTA 1SK1A 3UIWA 4EC0A 18GSA 1J08A 1PSQA 2WJUA 4TRXA 1QQ2A 2GZZA 2EFCA 3LXTA 1OE8A 1OVNA 2C0DA 4GSNA 2PGTA 2C4JA 4HDEA 4BL7B 5KEJA 2AUVA 2DJKA 4WXTA 2NVLA 3KTBA 3IC4A 3G9BA 2R0GA 1EZKA 5KN3A 4PXOA 2YJ7A 4ZIJA 3KCMA 1FVKA 2CVDA 4O92A 3LXZA 3WGXA 1YY7A 2A4HA 4EIQA 2TRXA 2JU5A 1K0OA 1KBNA 3ZRDA 3F4RA 5ECIB 3QAVA 1GNEA 5CRDA 2RM5A 2BMXA 2AB6A 1PN9A 2FWHA 5IMAA 5ECSA 4MZBA 4K0NA 4E8HA 1Z7PA 3D6IA 5DAKA 2L6CA 3GMFA 2V1MA 2REMA 4G01A 1Y25A 1SENA 1VF4A 3ZIVA 2LRCA 1SYXA 2H0GA 4ID0A 2WRTA 1JZWA 4FYUA 3RDWA 2PMTA 4NWYA 4WBRD 3IE3A 1ZMAA 4KSOA 4EVMA 5F05A 3M9JA 1XWKA 2FWEA 1QMVA 2V2GA 2NDOA 3PPUA 1GSSA 2HSMB 4TXOA 4N0VA 2KHPA 3N9JA 5ECRB 4OO5A 3RHBA 1FOVA 2EIOA 3KP8A 1EV9A 1ERTA 5D9XA 4F0BA 2DJ2A 2CZ2A 4YQUA 4H86A 3F3QA 4XRAA 4OFNA 5EY6A 4LLRA 1WRYA 3GRXA 2QA1A 1YQ1A 1X5EA 2N5BA 5EVOA 4EO3A 1OKTA 1YDKA 1AC1A 1K0AA 6GSSA 4EKZA 3IDVA 4ZB8A 4LL4B 1O7UA 1JZRA 4AKHA 3GH9A 2YP6A 4GLTA 3FKFA 3L4NA 2YNXA 1YKAA 4YKFA 2YPMA 2FNOA 4IS0A 2YN1A 1GWCA 2B3SA 4GSSA 5G5EA 3J7Yb 5F0GA 4RUVA 3IAS2 4RI7A 2A4VA 2B7JA 4MZWA 1QXHA 3M0FA 2TRCP 1GSDA 2WGRA 3BD2A 3HXSA 4BVYA 4MJCA 1ON4A 3APOA 3KMNA 4X0XA 2C8UA 3E0UA 4FIWA 2I3YA 1A8LA 2CVBA 3SBCA 2P5RA 1R5PA 3HJOA 1THXA 3Q19A 2ZNMA 3FYGA 3HDCA 3VI7A 3ZZXA 3UEMA 3ZFLA 4EL1A 2LV3A 2FLSA 1PKZA 1SL2B 3A2XA 3HY2A 2H75A 3HVXA 1V58A 4OCEA 2OT3A 2GSRA 4AI6A 3GSTA 1PD21 1T4YA 2LJAA 4HJ2A 4KF9A 6GSXA 1EV4A 3GHAA 3TKSE 4EXJA 4PURA 4Q5NA 4ML1A 3HJMA 3QAWA 1PL1A 2LTKA 1M2BA 1A0RP 1NHOA 3ZL5A 3FY7A 3EU3A 2H30A 3KP9A 1LJRA 5BRTA 3LQ7A 3HZ8A 3HKRA 2CAQA 4K7OA 4WR4A 1T00A 2HSNA 4HZ2A 3KXOA 3I69A 3GN3A 4RQXA 4QQ7A 2H6XA 2KP1A 4EIPA 2F9SA 1N25A 2P0GA 1EGOA 2HZEB 4F0CA 1MDKA 2HRKB 7GSSA 2HI7A 1YEPA 3LW9A 4LA1A 3L0HA 3D5JA 14GSA 1O73A 2LQQA 3P7XA 5B7CA 5HFGA 3A3TA 1AQXA 3U5RE 3DYRA 3EMXA 3PGTA 1TU7A 2DLXA 2IFQB 4IN0A 5DCGA 5J4VA 1M9BA 5A34A 3TJJA 2YOIA 3UJ1A 1WE0A 3A2VA 3UMAA 5KN2A 3FRCA 4N11A 2HQTA 5IMCA 1Z3EA 1FVJA 5B6NA 5IIZA 4YAPA 4BWSA 5HR3A 1B8XA 2QC7A 4FYCA 2R5GA 1WWJA 4K8MA 3UARA 5H5QA 1BF5A 2ON7A 4HZ4A 3VK9A 4KX4A 5J47A 3NOFA 1WJKA 3FW2A 3RPPA 2RM6A 4K5SA 2B6MA 1JLWA 2JZRA 1WOUA 4MA9A 2X8HA 4LMWA 3R2QA 4G0KA 3F9UA 4EDZA 3QDNA 4WBJA 3IOSA 1U87A 4JE1A 2UZ8A 2H73A 2V41A 1FO5A 2R0CA 3E9JB 3Q18A 2OE0A 1VGLA 2V6KA 4KCAA 1QUWA 1U3AA 3H4KA 4NXIA 4PQIA 2VIMA 4X1UA 4O5UA 3TJKA 4NHWA 3CYNA 2PN8A 2HSMA 5B8AA 1XOBA 3ZMKA 1XWBA 2GQKA 1YF0A 4G19A 1SK2A 2C0GA 2C80A 3QMXA 5H5SA 3UL3A 5HFIA 1KEBA 4Q5RA 2AJQB 1SJZA 1B4QA 1QK8A 2L6DA 5G5FA 17GSA 3WYWA 2VL9A 2PERA 3HVSA 5DALA 2JACA 5IMZA 5G2ZA 3ZFBA 4V2NA 3CSHA 1BG1A 1HQOA 1OE7A 3TOTA 2C3NA 4YKGA 2OKAA 2GLRA 2L4QA 1HYUA 4BWQA 1A2LA 3HMJG 1ZL9A 1J9BA 2JSZA 2PU9C 2OJLA 4NHZA 5BMUB 4HS1A 1SYRA 3L9VA 2AV4A 1XZOA 3EYTA 1FG4A 1XBSA 5DBQA 1Q98A 1XOAA 4WEYA 5ELAA 2GQMA 4F82A 1HNAA 4KUNA 5DQYA 2RIIA 4CW9A 3MDKA 3IK9A 2VOCA 3DVWA 2FHEA 3TB2A 1X9MB 1TW9A 1Z7RA 3APQA 2IMEA 3KIJA 3FEUA 1SL1B 5CYYA 3M3MA 5G30A 4KW6A 3TOUA 5ECPB 2GT5A 4K6XA 1K0NA 3I43A 2VO4A 2LQOA 4TR1A 1ERUA 3H1NA 2VD1A 1JFUA 3VWUA 1NSWA 2JZTA 1V57A 5C00A 1AIUA 4ZXGA 3S9FA 1F6MC 1M2AA 1AQVA 1EOGA 2DKHA 2L59A 2DBCA 2ON5A 1EOHA 1XWGA 2K8VA 3IRAA 3PH9A 1EEJA 3VFIA 3W8SA 2X64A 4MJBA 3GUSA 2B5EA 5FWGA 3IC8A 3VWXA 2LRTA 4I2TA 3C8EA 5LCZA 1OC9A 4BVXB 3RAZA 5DCHA 3HZ4A 3M8NA 1SKSB 2CZ3A 2O85A 3QD9A 2HZEA 1THOA 4RI6A 5KN0A 2H6ZA 4MPFA 1SD8A 5A4VA 1EP7A 5E59A 4KDYA 2EIQA 2M80A 3HA9A 3OR5A 1K0DA 3TKSA 4TR0A 2ES7A 1EGRA 1R26A 4TOPA 1XWAA 4NAXA 1SK0A 3TJFA 5F8BA 4TXVA 2CQ9A 4KAEA 3N5OA 2RLIA 2DJ0A 4Z2UA 1F2EA 2GT6A 5HR2A 1OYJA 3LWAA 3UOMA 1X0RA 4N0ZA 3ZREA 3O76A 3TKRA 2E2GA 4I5QA 3ZMLA 2X4AA 2WS2A 3TU3B 1TOFA 4IBPA 1SJ6A 19GSA 3UVTA 1W89A 2F3MA 4OFMA 1SVOA 1HD2A 4OWYA 1UVZA 2A2PA 4D73A 3EE2A 2V6OA 2C0FA 2KOKA 2YWOA 1U88A 3KJYA 2EC4A 2QKEA 1TI1A 4USSA 1ERWA 2CV4A 2K18A 3DMLA 1XIYA 3W6GA 1RQMA 3NIVA 4IJ3A 1SVLA 4GXZA 2FD3A 4ZB9A 2HFDA 3ERGA 3DIEA 4ISDA 4YQVA 1GLQA 2A2SA 5GZZB 1T3BA 1E6BA 1ZCPA 4MH3A 3ME7A 3MIXA 2GTUA 3CTGA 2VL2C 4E68A 3BCKA 5A1NB 2H0IA 5B6MA 1K0CA 4PNGA 4X4JA 3FR6A 1EEMA 4O5RA 5J40A 2O89A 1J0FA 1ACVA 1HNCA 1R7HA 2FCHA 2M46A 1JZDA 3GURA 3WT2A 1PL2A 3D4MA 4TR4A 4RQRA 2VD0A 5CRHA 1TTZA 5ECNB 3ZVJA 3QPMA 2IMKA 3O6TA 1MDIA 2HYXA 3QAGA 3TKQA 1C72A 1YJ6A 2GSQA 4MK3A 1OC8A 5IMVA 5JCWA 2CX4A 4L5LA 2H0HA 5JWOB 4XS4A 1A8YA 3F4TA 5A5KA 1BJXA 3IXRA 1ABAA 1CQGA 3EINA 3CXGA 1VF1A 2DSAA 4JEDA 2JZSA 2FWFA 1X9WB 1ILOA 2LKUA 5ID2A 2NTOA 1A2MA 3EVIA 1TP9A 4K2DA 4DSSA 3Q74A 1XW6A 1DE1A 2EFDA 1W4VA 4GQFA 4HOJA 1XPVA 5AIVA 2H72A 1GLPA 2CT6A 2L57A 3C71A 2KUCA 4O7HA 1XXUA 3F63A 1AXDA 3GTUB 2R6KA 2GGTA 4MABA 1BG5A 1DSBA 4KNDA 1ZYEA 2LS5A 3IK7A 1PX7A 1TRWA 3F4SA 5J4YA 4MPGA 4N10A 2R3XA 2F8AA 1JZOA 2RUEA 5EPFA 4IELA 4IP1A 3J7Yk 1AQWA 1M7TA 13GSA 2QSIA 1AW9A 2H6YA 3G7YA 2TIRA 3C1RA 2H1GA 4O32A 4K0GA 5D9WA 2WULA 5JWRB 4JBBA 2H1AA 3LJRA 2JADA 4G2EA 3KEBA 4PTSA 3EMPA 3GX8A 4MNNA 4HQZA 1V40A 5ECMB 6GSWA 3F6DA 3BBYA 3MWHA 5KOWA 1WPIA 2HXKA 1NHYA 2H1LA 3HVVA 3CMIA 5A5HB 3UBLA 1TK5B 5GAPD 2VCTA 5INYA 2IMDA 1O8WA 2X99A 2A2RA 3TRXA 2R37A 3QOUA 4ECJA 3A5WA 4XRDA 4HEA2 1WMJA 1BEDA 2B5YA 5ECOB 3LORA 4YAVA 3DVXA 4ULXA 3TKSC 2QA2A 3I6AA 1B48A 5JWQB 1G0TA 3TGZA 5GSSA 2GZYA 4BL7A 4XCSA 1NM3A 4KE3A 1QGVA 5J9BA 4N30A 4ILFA 3WGEA 2YZHA 3L9UA 2MBSA 1XFLA 3DGQA 2XBIA 4AJ8A 2IJYA 1M0UA 9GSSA 2FA8A 2VCXA 2C1YA 1Q4JA 2GSSA 1ZYQB 3KTLA 1YF1A 2G2QA 3MYDA 3D4TA 4W66A 2GQLA 4FYBA 1PMTA 3TDGA 2XPDA 4PUFC 3FZ4A 2O5VA 5D73A 1TI3A 1GSUA 5ENUA 1K3OA 1B9XC 5EL8A 2GSTA 3WGDA 4I97A 2D2ZA 3R3EA 2JSYA 5AN1A 3M1GA 5DAKB 3RHCA 5ELGA 1PN0A 2L5LA 4E8EA 3GL3A 3KGKA 2IN3A 2GDRA 4IVFA 5KN1A 1M2DA 3MAKA 4IGJA 2MMNA 4XS6A 1OC3A 5D8IA 1URMA 1N2AA 4NMUA 4WF5A 4OFTA 4GCIA 4DSRA 1TXXA 2F51A 4ZL7A 1NW2A 2XHFA 2QGVA 2YV9A 3VPQA 5CRWA 4HJMA 5JCGA 2IIYA 5G1LA 1TKDB 3CBUA 1GSQA 5J41A 3RBTA 3IHGA 4FQUA 4TXOB 2HE3A 2HLSA 2MZCA 4MJAA 4V1Ag 3EWLA 3GYKA 5AGYA 3IPZA 4X43A 4I8BA 4MCUA 5COHA 3FHKA 2ZCTA 1ZYNA 2VKZG 4BA7A 4G10A 5DDLA 2NPBA 3HHVA 1F9MA 2VLVA 4ZBAA 2DC5A 4G0LA 5CO3A 4QMKA 3FZAA 4JR6A 4AKGA 2I81A 3TKPA 1PA3A 1BQ7A 1XW9A 1FW1A 3ED3A 1GUKA 2IPAA 5FHIA 2MMAA 1A0FA 2CA8A 2WDUA 4V1Ap 3AY8A 1ST9A 4GQCA 4MDCA 5J4UA 2FGXA 3HD5A 2YWNA 3LSZA 2N5FA 1GSEA 3F6FA 3C1SA 3KH9A 5D9VA 3TRPA 3VURA 5AIXA 5ECQB 4ECBA 2DJ1A 2VCWA 1TDIA 2HNLA 2CAIA 5AISA 2B5XA 16GSA 4BVYB 2EFEA 4IW9A 4TN8A 2LRNA 5A4UA 3KM6A 2PBJA 3Q6OA 1EWXA 4GWRA 1WP0A 4I6XA 4ZILA 5D9TA 2XC2A 3P8WA 4WR5A 3GA4A 3VWWA 2MMZA 2PVOC 2C0EA 3HJPA 1K3LA 4F2IA 4AJ6A 5KOXA 4PX1A 1YKCA 1TRUA 3GKMA 4AGSA 3WD6A 1O81A 3LYKA 2H76A 4WF4A 3ERFA 1AUCA 4PNFA 2HRNA 2HRAA 1S3DA 3A2WA 3ZTLA 2OBIA 1H4OA 4OO4A 2LNSA 4MP4A 3ZITA 5LNKe 4K2XA 3SWLA 1O8XA 3ZLPA 6GSYA 3UVHA 2YCDA 2IMFA 1TJDA 1A2JA 5C04A 5ECLB 4K9ZA 2FA4A 5DVBA 2J9HA 1F3BA 3EURA 1T7PB 2HSNB 2P31A 5H5RA 2N5AA 5J5NA 5IMDA 5HR1A 4PQHA 2YV7A 5A4WA 2HRKA 3LEFA 1GRXA 1KNGA 5IOXA 2VL3A 1Z9HA 2CX3A 1MD4A 1TXUA 4GTUA 4AKIA 3BOAA 2H70A 4NV2A 3ERWA 4WETA 4ZBDA 2GS3A 2IFQA 5IM9A 3GH6A 3VLNA 4V2LA 5HFKA 1B9YC 3KH7A 1DBYA 2AYTA 3DRNA 3V1WA 6GSUA 2PWJA 3D21A 2H74A 1O85A 5A34B 4ICYA 4IKHA 3IHQA 6GSTA 2KP2A 1G6YA 2HZFA 2AHEA 3PINA 3FK8A 6GSVA 5F07A 1IYHA 1F37A 1YVLA 2FY6A 1A23A 4KDUA 1A24A 5IQYA 3MSZA 3NZNA 3RPNA 2DIZA 4HI7A 1XVWA 1JHBA 2LUSA 1TU8A 5JCUA 1K0BA 4GDFA 2WZ9A 4NPBA 4MLYA 1S3AA 1JLVA 2XPEA 2R4VA 2X8GA 3H8QA 3ISOA 1F3AA 4L5OA 4Q5FA 3FR9A 3ZVJD 2HSYA 2OACA 1X5DA 4ECIA 1DE2A 5CREA 4EF0A 4YH2A 1SJIA 2DKIA 3KZQA 4KB3A 3CSIA 4LMVA 2G0FA 20GSA 2PPTA 4PQ1A 3TJGA 5L71A 5ABRA 4POBA 4V2MA 4ACSA 2MMOA 5F06A 2DMLA 3LFLA 4KGIA 4XTSA 4IHUA 1ZZYA 1PQNA 2M72A 1T8EB 2K8SA 3KMOA 3LYPA 5LD0A 4DEJA 3G7IA 1B4PA 2YANA 3E3EA 2GZPA 4ZB7A 1GUMA 5E4WA 4JR4A 3BCIA 4MZCA 2X49A 3GX0A 4BPYA 3CWGA 4OD7A 4PUAA 3DEXA 1BX9A 4LL1B 2E7PA 1UN2A 4POLA 1GSFA 3GFKA 1IYIA 5DALB 2F8FA 1XVQA 1SKRB 2VLUA 1MDJA 3GKKA 4IP6A 1FAAA 2IWTA 2VM2A 3WT1A 4KH7A 3D22A 22GSA 2O8VB 5BMUA 2K6VA 3FZ5A 2V32A 2RUFA 4L0WA 4ECCA 3JCML 1R4WA 1YEXA 2EIRA 4TR3A 2K9FA 3H79A 3K8NA 1R5AA 3VPTA 2C3QA 5IOWA 3DKSA 1V98A 5D93A 1M99A 2LJRA 2Z9SA 2R0PA 1SL0B 2VCVA 1ZGNA 2P5QA 2UV8G 4TVEA 1VF3A 5D96A 3W8JA 3I9V2 2LJKA 5J9CA 4MF5A 2DJ3A 3FZ9A 5HQPA 1U3IA 2ALBA 1GSYA 3IA1A 1GH2A 2AAWA 3VWVA 2VCZA 2H19A 4EDYA 2MBTA 1OAZA 4JU5A 4HU9A 2R2JA 4TR1B 3C73A 2IMIA 2VLTA 2OA7A 2DJJA 2YZUA 1G6WA 1ML6A 3A5IA 3DD3A 5G31A 1GTUA 4TW5A 4CY6A 1SU9A 2C3TA 3GL5A 4XS1A 2H66A 2WFCA 1PRXA 4BVXA 1Z6NA 1U6TA 2H1BA 3F3RA 2H1DA 1CQHA 5ECKB 2NBSA 3IBHA 1RW1A 1OC9B 1QFNA 2OE1A 5GAND 3D0ZA 1V9WA 1UC7A 1MTCA 5CAXA 1Z5YE 1PX6A 3EC3A 3IAM2 2XBQA 1I9DA 4JZQA 1Y1UA 4XIHA 4G0IA 5J3RA 2OBKA 1XW5A 4MH2A 3TUEA 4Z2RA 4POKA 4AKXB 4NV5A 4ZL9A 5DJMA 1BAYA 1S3CA 2I9HA 5IPGA 1T4ZA 2YWIA 2OADA 2J23A 3TCOA 1RK4A 3MNGA 1ERVA 3H93A 3PR8A 3GNJA 4GRFA 2I1UA 4MF7A 3CRTA 2WB9A 1ZOFA 1SD9A 2E0QA 3IV4A 4L0UA 1EP8A 2LEGA 1FB0A 4J2FA 4MMMA 4CDOA 3CTFA 4D73B 5IPHA 4F03A 2I4AA 3FR3A 1Y6EA 2CVKA 1GTBA 4CHSA 4FO5A 4MF6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H75 A;  2O7K A;  1AAZ A;  2OE3 A;  5CNW A;  4KDX A;  10GS A;  2HT9 A;  5ECH B;  2PVQ A;  1Z6M A;  4K7I A;  3L9S A;  4IQ1 A;  3TRQ A;  1GNW A;  2YJH A;  5B8B A;  2B7K A;  2H01 A;  1DUG A;  1KTE A;  5DQS A;  1V2A A;  3L78 A;  4EUY A;  1BYE A;  1I5G A;  1X9S B;  2H8L A;  4Q5Q A;  2VL2 A;  1TK0 B;  3KD0 A;  12GS A;  2FWG A;  4AF2 A;  3LGC A;  4ZBB A;  4HUA A;  11GS A;  2L5O A;  2VCQ A;  1E2Y A;  1TK8 B;  3GIX A;  1PKW A;  2MYG A;  2JL4 A;  1GUH A;  2KLX A;  1HNB A;  4DVC A;  1WIK A;  1G7O A;  4IJI A;  5FT3 A;  3GKN A;  1TRS A;  2L4C A;  4KCE A;  1VF2 A;  3M9K A;  5CP1 A;  1SKW B;  3ME8 A;  4KSM A;  1FB6 A;  5G1K A;  3GSS A;  4XS4 B;  3F8U A;  1VRS D;  3P2A A;  1GTA A;  3U6V A;  2VM1 A;  3C7M A;  3QFB C;  4ZB6 A;  3DXB A;  4ML6 A;  2HRF A;  2B1L A;  2O87 A;  1PGT A;  2LNT A;  4G9H A;  5ID2 B;  4Z7X A;  2DMM A;  2FUG 2;  2X8C A;  4HU7 A;  4J57 E;  5IO2 A;  3LG6 A;  4DSS B;  4PGT A;  4EE0 A;  3BJ5 A;  5GST A;  1XCC A;  1GTI A;  3ZYW A;  2HSH A;  3APS A;  3GTU A;  2VUP A;  4TKY A;  1LU4 A;  4JRR A;  3O3T A;  2B1K A;  4DSQ A;  1UA5 A;  3QCP A;  4IQA A;  4K7N A;  2IL3 A;  3CSJ A;  5IMF A;  3G7J A;  5IO0 A;  2WCI A;  2DIY A;  1MEK A;  4MJE A;  3HYP A;  1T1V A;  2ZUP A;  1M9A A;  4OMV A;  3TJB A;  1FHE A;  1XWC A;  4GST A;  4J56 E;  1G7E A;  5CRG A;  4POM A;  1K3Y A;  4L8E A;  3P90 A;  3US3 A;  4WKW A;  3CRU A;  3ZIJ A;  2E2M A;  1GL8 A;  1TRV A;  2GVP A;  1YZX A;  2H71 A;  1LBK A;  1GP1 A;  1N8J A;  3F0I A;  4OCF A;  4YQM A;  2BTO T;  1X5C A;  4GF0 A;  4F9Z A;  4ZL8 A;  1K0M A;  1OKD A;  4QL9 A;  4I2U A;  4HQS A;  3QFA C;  5HR0 A;  8GSS A;  4K1F A;  4P3Y B;  3GV1 A;  4QL7 A;  2VAF A;  4AJ7 A;  3UBK A;  1O6J A;  2PUK C;  2YWM A;  3UAP A;  1GUL A;  1USB A;  3GKX A;  3VI5 A;  3EU4 A;  3QR6 A;  3HCZ A;  3IR4 A;  4FH8 A;  1MD3 A;  2BJX A;  4XHM A;  3DWV A;  5DJL A;  4KA0 A;  2LST A;  1SK1 A;  3UIW A;  4EC0 A;  18GS A;  1J08 A;  1PSQ A;  2WJU A;  4TRX A;  1QQ2 A;  2GZZ A;  3LXT A;  1OE8 A;  1OVN A;  2C0D A;  4GSN A;  2PGT A;  2C4J A;  4HDE A;  4BL7 B;  5KEJ A;  2AUV A;  2DJK A;  4WXT A;  2NVL A;  3KTB A;  3IC4 A;  3G9B A;  1EZK A;  5KN3 A;  4PXO A;  2YJ7 A;  4ZIJ A;  3KCM A;  1FVK A;  2CVD A;  4O92 A;  3LXZ A;  3WGX A;  1YY7 A;  2TRX A;  2JU5 A;  1K0O A;  1KBN A;  3ZRD A;  3F4R A;  5ECI B;  3QAV A;  1GNE A;  5CRD A;  2RM5 A;  2BMX A;  2AB6 A;  1PN9 A;  2FWH A;  5IMA A;  5ECS A;  4MZB A;  4K0N A;  4E8H A;  1Z7P A;  3D6I A;  5DAK A;  2L6C A;  3GMF A;  2V1M A;  2REM A;  1Y25 A;  1SEN A;  1VF4 A;  3ZIV A;  2LRC A;  1SYX A;  2H0G A;  4ID0 A;  2WRT A;  1JZW A;  4FYU A;  3RDW A;  2PMT A;  4NWY A;  4WBR D;  3IE3 A;  1ZMA A;  4KSO A;  4EVM A;  5F05 A;  3M9J A;  1XWK A;  2FWE A;  1QMV A;  2V2G A;  2NDO A;  3PPU A;  1GSS A;  2HSM B;  4TXO A;  4N0V A;  2KHP A;  3N9J A;  5ECR B;  4OO5 A;  3RHB A;  1FOV A;  2EIO A;  3KP8 A;  1EV9 A;  1ERT A;  5D9X A;  4F0B A;  2DJ2 A;  2CZ2 A;  4YQU A;  4H86 A;  3F3Q A;  4XRA A;  4OFN A;  5EY6 A;  4LLR A;  1WRY A;  3GRX A;  1YQ1 A;  1X5E A;  2N5B A;  5EVO A;  4EO3 A;  1OKT A;  1YDK A;  1AC1 A;  1K0A A;  6GSS A;  4EKZ A;  3IDV A;  4ZB8 A;  4LL4 B;  1O7U A;  1JZR A;  3GH9 A;  2YP6 A;  4GLT A;  3FKF A;  3L4N A;  2YNX A;  1YKA A;  2YPM A;  2FNO A;  4IS0 A;  2YN1 A;  1GWC A;  2B3S A;  4GSS A;  5G5E A;  3J7Y b;  5F0G A;  4RUV A;  3IAS 2;  4RI7 A;  2A4V A;  2B7J A;  4MZW A;  1QXH A;  3M0F A;  2TRC P;  1GSD A;  2WGR A;  3BD2 A;  3HXS A;  4BVY A;  4MJC A;  1ON4 A;  3APO A;  3KMN A;  4X0X A;  2C8U A;  3E0U A;  4FIW A;  2I3Y A;  1A8L A;  2CVB A;  3SBC A;  2P5R A;  1R5P A;  3HJO A;  1THX A;  3Q19 A;  2ZNM A;  3FYG A;  3HDC A;  3VI7 A;  3ZZX A;  3UEM A;  3ZFL A;  4EL1 A;  2LV3 A;  2FLS A;  1PKZ A;  1SL2 B;  3A2X A;  3HY2 A;  2H75 A;  3HVX A;  1V58 A;  4OCE A;  2GSR A;  3GST A;  1PD2 1;  1T4Y A;  2LJA A;  4HJ2 A;  4KF9 A;  6GSX A;  1EV4 A;  3GHA A;  3TKS E;  4EXJ A;  4PUR A;  4Q5N A;  4ML1 A;  3HJM A;  3QAW A;  1PL1 A;  2LTK A;  1M2B A;  1A0R P;  1NHO A;  3ZL5 A;  3FY7 A;  3EU3 A;  2H30 A;  3KP9 A;  1LJR A;  3LQ7 A;  3HZ8 A;  3HKR A;  2CAQ A;  4K7O A;  4WR4 A;  1T00 A;  4HZ2 A;  3KXO A;  3I69 A;  3GN3 A;  4RQX A;  4QQ7 A;  2H6X A;  2KP1 A;  2F9S A;  2P0G A;  1EGO A;  2HZE B;  4F0C A;  1MDK A;  2HRK B;  7GSS A;  2HI7 A;  1YEP A;  4LA1 A;  3L0H A;  3D5J A;  14GS A;  1O73 A;  2LQQ A;  3P7X A;  5B7C A;  5HFG A;  3A3T A;  1AQX A;  3U5R E;  3DYR A;  3EMX A;  3PGT A;  1TU7 A;  2DLX A;  2IFQ B;  4IN0 A;  5DCG A;  1M9B A;  3TJJ A;  2YOI A;  3UJ1 A;  1WE0 A;  3A2V A;  3UMA A;  5KN2 A;  3FRC A;  4N11 A;  2HQT A;  5IMC A;  1Z3E A;  1FVJ A;  5B6N A;  5IIZ A;  4YAP A;  4BWS A;  5HR3 A;  1B8X A;  2QC7 A;  4FYC A;  2R5G A;  1WWJ A;  4K8M A;  3UAR A;  5H5Q A;  2ON7 A;  4HZ4 A;  3VK9 A;  4KX4 A;  3NOF A;  1WJK A;  3FW2 A;  3RPP A;  2RM6 A;  2B6M A;  1JLW A;  2JZR A;  1WOU A;  4MA9 A;  2X8H A;  4LMW A;  3R2Q A;  4G0K A;  3F9U A;  4EDZ A;  3QDN A;  4WBJ A;  3IOS A;  1U87 A;  4JE1 A;  2UZ8 A;  2H73 A;  2V41 A;  1FO5 A;  3E9J B;  3Q18 A;  2OE0 A;  1VGL A;  2V6K A;  4KCA A;  1QUW A;  1U3A A;  3H4K A;  4NXI A;  4PQI A;  2VIM A;  4X1U A;  3TJK A;  4NHW A;  3CYN A;  2PN8 A;  2HSM A;  5B8A A;  1XOB A;  3ZMK A;  1XWB A;  2GQK A;  1YF0 A;  4G19 A;  1SK2 A;  2C0G A;  2C80 A;  3QMX A;  5H5S A;  3UL3 A;  5HFI A;  1KEB A;  4Q5R A;  2AJQ B;  1SJZ A;  1B4Q A;  1QK8 A;  2L6D A;  5G5F A;  17GS A;  3WYW A;  2VL9 A;  2PER A;  3HVS A;  5DAL A;  2JAC A;  5IMZ A;  5G2Z A;  3ZFB A;  4V2N A;  3CSH A;  1HQO A;  1OE7 A;  3TOT A;  2C3N A;  2OKA A;  2GLR A;  2L4Q A;  1HYU A;  4BWQ A;  1A2L A;  1ZL9 A;  1J9B A;  2JSZ A;  2PU9 C;  2OJL A;  4NHZ A;  4HS1 A;  1SYR A;  3L9V A;  2AV4 A;  1XZO A;  3EYT A;  1FG4 A;  1XBS A;  5DBQ A;  1Q98 A;  1XOA A;  4WEY A;  5ELA A;  2GQM A;  4F82 A;  1HNA A;  4KUN A;  5DQY A;  2RII A;  4CW9 A;  3MDK A;  3IK9 A;  2VOC A;  3DVW A;  2FHE A;  3TB2 A;  1X9M B;  1TW9 A;  1Z7R A;  3APQ A;  2IME A;  3KIJ A;  3FEU A;  1SL1 B;  5CYY A;  3M3M A;  5G30 A;  4KW6 A;  3TOU A;  5ECP B;  2GT5 A;  4K6X A;  1K0N A;  3I43 A;  2VO4 A;  2LQO A;  4TR1 A;  1ERU A;  3H1N A;  2VD1 A;  1JFU A;  3VWU A;  1NSW A;  2JZT A;  1V57 A;  5C00 A;  1AIU A;  4ZXG A;  3S9F A;  1F6M C;  1M2A A;  1AQV A;  1EOG A;  2L59 A;  2DBC A;  2ON5 A;  1EOH A;  1XWG A;  2K8V A;  3IRA A;  3PH9 A;  1EEJ A;  3VFI A;  3W8S A;  2X64 A;  4MJB A;  3GUS A;  2B5E A;  5FWG A;  3IC8 A;  3VWX A;  2LRT A;  4I2T A;  3C8E A;  5LCZ A;  1OC9 A;  4BVX B;  3RAZ A;  5DCH A;  3HZ4 A;  3M8N A;  1SKS B;  2CZ3 A;  2O85 A;  3QD9 A;  2HZE A;  1THO A;  4RI6 A;  5KN0 A;  2H6Z A;  4MPF A;  1SD8 A;  5A4V A;  1EP7 A;  5E59 A;  4KDY A;  2EIQ A;  2M80 A;  3HA9 A;  3OR5 A;  1K0D A;  3TKS A;  4TR0 A;  2ES7 A;  1EGR A;  1R26 A;  4TOP A;  1XWA A;  4NAX A;  1SK0 A;  3TJF A;  5F8B A;  4TXV A;  2CQ9 A;  4KAE A;  3N5O A;  2RLI A;  2DJ0 A;  1F2E A;  2GT6 A;  5HR2 A;  1OYJ A;  3LWA A;  3UOM A;  1X0R A;  4N0Z A;  3ZRE A;  3O76 A;  3TKR A;  2E2G A;  4I5Q A;  3ZML A;  2WS2 A;  1TOF A;  4IBP A;  1SJ6 A;  19GS A;  3UVT A;  1W89 A;  2F3M A;  4OFM A;  1HD2 A;  4OWY A;  1UVZ A;  4D73 A;  3EE2 A;  2V6O A;  2C0F A;  2KOK A;  2YWO A;  1U88 A;  3KJY A;  2EC4 A;  2QKE A;  1TI1 A;  4USS A;  1ERW A;  2CV4 A;  2K18 A;  3DML A;  1XIY A;  3W6G A;  1RQM A;  3NIV A;  4IJ3 A;  4GXZ A;  2FD3 A;  4ZB9 A;  2HFD A;  3ERG A;  3DIE A;  4ISD A;  4YQV A;  1GLQ A;  2A2S A;  5GZZ B;  1T3B A;  1E6B A;  1ZCP A;  4MH3 A;  3ME7 A;  2GTU A;  3CTG A;  2VL2 C;  3BCK A;  2H0I A;  5B6M A;  1K0C A;  4PNG A;  3FR6 A;  1EEM A;  4O5R A;  2O89 A;  1J0F A;  1ACV A;  1HNC A;  1R7H A;  2FCH A;  2M46 A;  1JZD A;  3GUR A;  3WT2 A;  1PL2 A;  3D4M A;  4TR4 A;  4RQR A;  2VD0 A;  5CRH A;  1TTZ A;  5ECN B;  3ZVJ A;  3QPM A;  2IMK A;  3O6T A;  1MDI A;  2HYX A;  3QAG A;  3TKQ A;  1C72 A;  1YJ6 A;  2GSQ A;  4MK3 A;  1OC8 A;  5IMV A;  5JCW A;  2CX4 A;  4L5L A;  2H0H A;  5JWO B;  4XS4 A;  1A8Y A;  3F4T A;  5A5K A;  1BJX A;  3IXR A;  1ABA A;  1CQG A;  3EIN A;  3CXG A;  1VF1 A;  2DSA A;  4JED A;  2JZS A;  2FWF A;  1X9W B;  1ILO A;  2LKU A;  5ID2 A;  2NTO A;  1A2M A;  3EVI A;  1TP9 A;  4K2D A;  4DSS A;  3Q74 A;  1XW6 A;  1DE1 A;  1W4V A;  4GQF A;  4HOJ A;  1XPV A;  5AIV A;  2H72 A;  1GLP A;  2CT6 A;  2L57 A;  3C71 A;  2KUC A;  4O7H A;  1XXU A;  3F63 A;  1AXD A;  3GTU B;  2R6K A;  2GGT A;  4MAB A;  1BG5 A;  1DSB A;  4KND A;  1ZYE A;  2LS5 A;  3IK7 A;  1PX7 A;  1TRW A;  3F4S A;  4MPG A;  4N10 A;  2R3X A;  2F8A A;  1JZO A;  2RUE A;  5EPF A;  4IEL A;  4IP1 A;  3J7Y k;  1AQW A;  1M7T A;  13GS A;  2QSI A;  1AW9 A;  2H6Y A;  3G7Y A;  2TIR A;  3C1R A;  2H1G A;  4O32 A;  4K0G A;  5D9W A;  2WUL A;  5JWR B;  4JBB A;  2H1A A;  3LJR A;  2JAD A;  4G2E A;  3KEB A;  4PTS A;  3EMP A;  3GX8 A;  4HQZ A;  1V40 A;  5ECM B;  6GSW A;  3F6D A;  3BBY A;  3MWH A;  1WPI A;  2HXK A;  1NHY A;  3HVV A;  3CMI A;  3UBL A;  1TK5 B;  5GAP D;  2VCT A;  5INY A;  2IMD A;  1O8W A;  2X99 A;  2A2R A;  3TRX A;  2R37 A;  3QOU A;  4ECJ A;  3A5W A;  4XRD A;  4HEA 2;  1WMJ A;  1BED A;  2B5Y A;  5ECO B;  3LOR A;  4YAV A;  3DVX A;  4ULX A;  3TKS C;  3I6A A;  1B48 A;  5JWQ B;  1G0T A;  3TGZ A;  5GSS A;  2GZY A;  4BL7 A;  4XCS A;  1NM3 A;  4KE3 A;  1QGV A;  5J9B A;  4N30 A;  4ILF A;  3WGE A;  2YZH A;  3L9U A;  2MBS A;  1XFL A;  3DGQ A;  2XBI A;  4AJ8 A;  2IJY A;  1M0U A;  9GSS A;  2FA8 A;  2VCX A;  2C1Y A;  1Q4J A;  2GSS A;  1ZYQ B;  3KTL A;  1YF1 A;  2G2Q A;  3D4T A;  2GQL A;  4FYB A;  1PMT A;  3TDG A;  2XPD A;  4PUF C;  3FZ4 A;  5D73 A;  1TI3 A;  1GSU A;  5ENU A;  1K3O A;  1B9X C;  5EL8 A;  2GST A;  3WGD A;  4I97 A;  2D2Z A;  3R3E A;  2JSY A;  5AN1 A;  3M1G A;  5DAK B;  3RHC A;  5ELG A;  2L5L A;  4E8E A;  3GL3 A;  3KGK A;  2IN3 A;  2GDR A;  4IVF A;  5KN1 A;  1M2D A;  3MAK A;  4IGJ A;  2MMN A;  4XS6 A;  1OC3 A;  5D8I A;  1URM A;  1N2A A;  4NMU A;  4WF5 A;  4OFT A;  4GCI A;  4DSR A;  1TXX A;  2F51 A;  4ZL7 A;  1NW2 A;  2XHF A;  2QGV A;  2YV9 A;  3VPQ A;  5CRW A;  4HJM A;  5JCG A;  2IIY A;  5G1L A;  1TKD B;  3CBU A;  1GSQ A;  5J41 A;  3RBT A;  4FQU A;  4TXO B;  2HE3 A;  2HLS A;  2MZC A;  4MJA A;  4V1A g;  3EWL A;  3GYK A;  5AGY A;  3IPZ A;  4X43 A;  4I8B A;  4MCU A;  5COH A;  3FHK A;  2ZCT A;  4BA7 A;  4G10 A;  5DDL A;  2NPB A;  3HHV A;  1F9M A;  2VLV A;  4ZBA A;  2DC5 A;  4G0L A;  5CO3 A;  3FZA A;  4JR6 A;  2I81 A;  3TKP A;  1PA3 A;  1BQ7 A;  1XW9 A;  1FW1 A;  3ED3 A;  1GUK A;  2IPA A;  5FHI A;  2MMA A;  1A0F A;  2CA8 A;  2WDU A;  4V1A p;  3AY8 A;  1ST9 A;  4GQC A;  4MDC A;  5J4U A;  2FGX A;  3HD5 A;  2YWN A;  3LSZ A;  2N5F A;  1GSE A;  3F6F A;  3C1S A;  3KH9 A;  5D9V A;  3TRP A;  3VUR A;  5AIX A;  5ECQ B;  4ECB A;  2DJ1 A;  2VCW A;  1TDI A;  2HNL A;  2CAI A;  5AIS A;  2B5X A;  16GS A;  4BVY B;  4IW9 A;  4TN8 A;  2LRN A;  5A4U A;  3KM6 A;  2PBJ A;  3Q6O A;  1EWX A;  4GWR A;  1WP0 A;  4I6X A;  4ZIL A;  5D9T A;  2XC2 A;  3P8W A;  4WR5 A;  3GA4 A;  3VWW A;  2MMZ A;  2PVO C;  2C0E A;  3HJP A;  1K3L A;  4F2I A;  4AJ6 A;  4PX1 A;  1YKC A;  1TRU A;  3GKM A;  4AGS A;  3WD6 A;  1O81 A;  3LYK A;  2H76 A;  4WF4 A;  3ERF A;  1AUC A;  4PNF A;  2HRN A;  2HRA A;  1S3D A;  3A2W A;  3ZTL A;  2OBI A;  1H4O A;  4OO4 A;  2LNS A;  4MP4 A;  3ZIT A;  5LNK e;  3SWL A;  1O8X A;  3ZLP A;  6GSY A;  3UVH A;  2YCD A;  2IMF A;  1TJD A;  1A2J A;  5C04 A;  5ECL B;  4K9Z A;  2FA4 A;  5DVB A;  2J9H A;  1F3B A;  3EUR A;  1T7P B;  2HSN B;  2P31 A;  5H5R A;  2N5A A;  5J5N A;  5IMD A;  5HR1 A;  4PQH A;  2YV7 A;  5A4W A;  2HRK A;  3LEF A;  1GRX A;  1KNG A;  5IOX A;  2VL3 A;  1Z9H A;  2CX3 A;  1MD4 A;  4GTU A;  3BOA A;  2H70 A;  4NV2 A;  3ERW A;  4WET A;  4ZBD A;  2GS3 A;  2IFQ A;  5IM9 A;  3GH6 A;  3VLN A;  4V2L A;  5HFK A;  1B9Y C;  3KH7 A;  1DBY A;  2AYT A;  3DRN A;  3V1W A;  6GSU A;  2PWJ A;  3D21 A;  2H74 A;  1O85 A;  4IKH A;  3IHQ A;  6GST A;  2KP2 A;  1G6Y A;  2HZF A;  2AHE A;  3PIN A;  3FK8 A;  6GSV A;  5F07 A;  1IYH A;  1F37 A;  2FY6 A;  1A23 A;  4KDU A;  1A24 A;  5IQY A;  3MSZ A;  3NZN A;  3RPN A;  2DIZ A;  4HI7 A;  1XVW A;  1JHB A;  2LUS A;  1TU8 A;  5JCU A;  1K0B A;  2WZ9 A;  4NPB A;  4MLY A;  1S3A A;  1JLV A;  2XPE A;  2R4V A;  2X8G A;  3H8Q A;  3ISO A;  1F3A A;  4L5O A;  4Q5F A;  3FR9 A;  3ZVJ D;  2HSY A;  2OAC A;  1X5D A;  4ECI A;  1DE2 A;  5CRE A;  4EF0 A;  4YH2 A;  1SJI A;  3KZQ A;  4KB3 A;  3CSI A;  4LMV A;  2G0F A;  20GS A;  2PPT A;  4PQ1 A;  3TJG A;  5L71 A;  5ABR A;  4POB A;  4V2M A;  4ACS A;  2MMO A;  5F06 A;  2DML A;  3LFL A;  4KGI A;  4XTS A;  4IHU A;  1ZZY A;  1PQN A;  2M72 A;  1T8E B;  2K8S A;  3KMO A;  3LYP A;  5LD0 A;  4DEJ A;  3G7I A;  1B4P A;  2YAN A;  3E3E A;  2GZP A;  1GUM A;  5E4W A;  4JR4 A;  3BCI A;  4MZC A;  3GX0 A;  4BPY A;  4OD7 A;  4PUA A;  3DEX A;  1BX9 A;  4LL1 B;  2E7P A;  1UN2 A;  4POL A;  1GSF A;  3GFK A;  1IYI A;  5DAL B;  2F8F A;  1XVQ A;  1SKR B;  2VLU A;  1MDJ A;  3GKK A;  4IP6 A;  1FAA A;  2IWT A;  2VM2 A;  3WT1 A;  4KH7 A;  3D22 A;  22GS A;  2O8V B;  5BMU A;  2K6V A;  3FZ5 A;  2V32 A;  2RUF A;  4L0W A;  4ECC A;  3JCM L;  1R4W A;  1YEX A;  2EIR A;  4TR3 A;  2K9F A;  3H79 A;  3K8N A;  1R5A A;  3VPT A;  2C3Q A;  5IOW A;  3DKS A;  1V98 A;  5D93 A;  1M99 A;  2LJR A;  2Z9S A;  1SL0 B;  2VCV A;  1ZGN A;  2P5Q A;  4TVE A;  1VF3 A;  5D96 A;  3W8J A;  3I9V 2;  2LJK A;  5J9C A;  4MF5 A;  2DJ3 A;  3FZ9 A;  5HQP A;  1U3I A;  2ALB A;  1GSY A;  3IA1 A;  1GH2 A;  2AAW A;  3VWV A;  2VCZ A;  2H19 A;  4EDY A;  2MBT A;  1OAZ A;  4JU5 A;  4HU9 A;  2R2J A;  4TR1 B;  3C73 A;  2IMI A;  2VLT A;  2OA7 A;  2DJJ A;  2YZU A;  1G6W A;  1ML6 A;  3DD3 A;  5G31 A;  1GTU A;  4TW5 A;  1SU9 A;  2C3T A;  3GL5 A;  4XS1 A;  2H66 A;  2WFC A;  1PRX A;  4BVX A;  1Z6N A;  1U6T A;  2H1B A;  3F3R A;  2H1D A;  1CQH A;  5ECK B;  2NBS A;  3IBH A;  1RW1 A;  1OC9 B;  1QFN A;  2OE1 A;  5GAN D;  3D0Z A;  1V9W A;  1UC7 A;  1MTC A;  5CAX A;  1Z5Y E;  1PX6 A;  3EC3 A;  3IAM 2;  2XBQ A;  1I9D A;  4JZQ A;  4XIH A;  4G0I A;  5J3R A;  2OBK A;  1XW5 A;  4MH2 A;  3TUE A;  4POK A;  4NV5 A;  4ZL9 A;  5DJM A;  1BAY A;  1S3C A;  2I9H A;  5IPG A;  1T4Z A;  2YWI A;  2OAD A;  2J23 A;  3TCO A;  1RK4 A;  3MNG A;  1ERV A;  3H93 A;  3PR8 A;  3GNJ A;  4GRF A;  2I1U A;  4MF7 A;  3CRT A;  2WB9 A;  1ZOF A;  1SD9 A;  2E0Q A;  3IV4 A;  4L0U A;  1EP8 A;  2LEG A;  1FB0 A;  4J2F A;  4MMM A;  4CDO A;  3CTF A;  4D73 B;  5IPH A;  4F03 A;  2I4A A;  3FR3 A;  1Y6E A;  2CVK A;  1GTB A;  4CHS A;  4FO5 A;  4MF6 A; 
#chains in the Genus database with same CATH topology
 1H75 A;  2O7K A;  1AAZ A;  2OE3 A;  5CNW A;  4KDX A;  10GS A;  2HT9 A;  5ECH B;  2PVQ A;  1Z6M A;  4K7I A;  3L9S A;  4IQ1 A;  3TRQ A;  1GNW A;  2YJH A;  5B8B A;  2B7K A;  4CY8 A;  2H01 A;  1DUG A;  1KTE A;  5DQS A;  1V2A A;  3L78 A;  4EUY A;  1BYE A;  5A1N A;  1I5G A;  1X9S B;  2H8L A;  4Q5Q A;  2VL2 A;  1TK0 B;  3KD0 A;  12GS A;  2FWG A;  4AF2 A;  3FMW A;  3LGC A;  4ZBB A;  4HUA A;  11GS A;  2L5O A;  2VCQ A;  1E2Y A;  1TK8 B;  3GIX A;  1PKW A;  2MYG A;  2JL4 A;  1GUH A;  2KLX A;  3EPT A;  1HNB A;  4DVC A;  1WIK A;  1G7O A;  4IJI A;  5FT3 A;  3GKN A;  1TRS A;  2L4C A;  4KCE A;  1VF2 A;  3M9K A;  5CP1 A;  1SKW B;  3ME8 A;  4KSM A;  1FB6 A;  5G1K A;  3GSS A;  4XS4 B;  3F8U A;  1VRS D;  3P2A A;  1GTA A;  3U6V A;  2VM1 A;  3C7M A;  3QFB C;  2EFH A;  4ZB6 A;  3DXB A;  4ML6 A;  2HRF A;  2B1L A;  2O87 A;  1PGT A;  2LNT A;  4G9H A;  5ID2 B;  4Z7X A;  2DMM A;  2FUG 2;  2X8C A;  4HU7 A;  4J57 E;  5IO2 A;  3LG6 A;  4DSS B;  4PGT A;  4EE0 A;  3BJ5 A;  5GST A;  1XCC A;  1GTI A;  3ZYW A;  2HSH A;  3APS A;  3GTU A;  2VUP A;  4TKY A;  1LU4 A;  4JRR A;  3O3T A;  4A5P A;  4Z2T A;  2B1K A;  4DSQ A;  1UA5 A;  3QCP A;  4IQA A;  4K7N A;  2IL3 A;  3CSJ A;  5IMF A;  3G7J A;  5IO0 A;  2WCI A;  2DIY A;  1MEK A;  4MJE A;  3HYP A;  1T1V A;  2ZUP A;  1M9A A;  4OMV A;  3TJB A;  1FHE A;  1XWC A;  4GST A;  4J56 E;  1G7E A;  5CRG A;  4O5Q A;  4POM A;  1K3Y A;  4L8E A;  3P90 A;  3US3 A;  4WKW A;  1FOH A;  3CRU A;  3ZIJ A;  2E2M A;  1GL8 A;  1SVM A;  1TRV A;  2GVP A;  4PHZ C;  1YZX A;  2H71 A;  1LBK A;  1GP1 A;  1N8J A;  3F0I A;  4OCF A;  4YQM A;  2BTO T;  1X5C A;  4GF0 A;  4K5R A;  4F9Z A;  4ZL8 A;  1K0M A;  1OKD A;  4QL9 A;  4I2U A;  4HQS A;  3QFA C;  5HR0 A;  1ZYP A;  8GSS A;  4K1F A;  4P3Y B;  5A5H A;  3GV1 A;  4QL7 A;  2VAF A;  4AJ7 A;  3UBK A;  1O6J A;  2PUK C;  2YWM A;  3UAP A;  1GUL A;  1USB A;  3GKX A;  4N3Z A;  3VI5 A;  3EU4 A;  3QR6 A;  3HCZ A;  3IR4 A;  4FH8 A;  1MD3 A;  2BJX A;  4XHM A;  3DWV A;  5DJL A;  4KA0 A;  2LST A;  1SK1 A;  3UIW A;  4EC0 A;  18GS A;  1J08 A;  1PSQ A;  2WJU A;  4TRX A;  1QQ2 A;  2GZZ A;  2EFC A;  3LXT A;  1OE8 A;  1OVN A;  2C0D A;  4GSN A;  2PGT A;  2C4J A;  4HDE A;  4BL7 B;  5KEJ A;  2WVZ A;  2AUV A;  2DJK A;  4WXT A;  2NVL A;  3KTB A;  3IC4 A;  3G9B A;  2R0G A;  1EZK A;  5KN3 A;  4PXO A;  2YJ7 A;  4ZIJ A;  3KCM A;  1FVK A;  2CVD A;  4O92 A;  3LXZ A;  3WGX A;  1YY7 A;  2A4H A;  4EIQ A;  2TRX A;  2JU5 A;  1K0O A;  1KBN A;  3ZRD A;  3F4R A;  5ECI B;  3QAV A;  1GNE A;  5CRD A;  2RM5 A;  2BMX A;  2AB6 A;  1PN9 A;  2FWH A;  5IMA A;  5ECS A;  4MZB A;  4K0N A;  4PI0 C;  4E8H A;  1Z7P A;  3D6I A;  5DAK A;  2L6C A;  3GMF A;  2V1M A;  2REM A;  4G01 A;  1Y25 A;  1SEN A;  1VF4 A;  3ZIV A;  2LRC A;  1SYX A;  2H0G A;  4ID0 A;  2WRT A;  1JZW A;  4FYU A;  3RGB C;  3RDW A;  2PMT A;  4NWY A;  4WBR D;  3IE3 A;  1ZMA A;  4KSO A;  4EVM A;  5F05 A;  3M9J A;  4BIK A;  1PFO A;  1XWK A;  2FWE A;  1QMV A;  2V2G A;  2NDO A;  3PPU A;  1GSS A;  2HSM B;  4TXO A;  4N0V A;  2KHP A;  3N9J A;  5ECR B;  4OO5 A;  3RHB A;  1FOV A;  2EIO A;  1YEW C;  3KP8 A;  1EV9 A;  1ERT A;  5D9X A;  4F0B A;  2DJ2 A;  2CZ2 A;  4YQU A;  4H86 A;  3F3Q A;  4XRA A;  4OFN A;  5EY6 A;  4LLR A;  1WRY A;  3GRX A;  2QA1 A;  1YQ1 A;  1X5E A;  2N5B A;  5EVO A;  4EO3 A;  1OKT A;  1YDK A;  1AC1 A;  1K0A A;  6GSS A;  4EKZ A;  3IDV A;  4ZB8 A;  4LL4 B;  1O7U A;  1JZR A;  4AKH A;  3GH9 A;  2YP6 A;  4GLT A;  3FKF A;  3L4N A;  2YNX A;  1YKA A;  4YKF A;  2YPM A;  2FNO A;  4IS0 A;  2YN1 A;  1GWC A;  2B3S A;  4GSS A;  5G5E A;  3J7Y b;  5F0G A;  4RUV A;  3IAS 2;  4RI7 A;  2A4V A;  2B7J A;  4MZW A;  1QXH A;  3M0F A;  2TRC P;  1GSD A;  2WGR A;  3BD2 A;  3HXS A;  4BVY A;  4MJC A;  1ON4 A;  3APO A;  3KMN A;  4X0X A;  2C8U A;  3E0U A;  4FIW A;  2I3Y A;  1A8L A;  2CVB A;  3SBC A;  2P5R A;  1R5P A;  3HJO A;  1THX A;  3Q19 A;  2ZNM A;  3FYG A;  3HDC A;  3VI7 A;  3ZZX A;  3UEM A;  3ZFL A;  4EL1 A;  2LV3 A;  2FLS A;  1PKZ A;  1SL2 B;  3A2X A;  3HY2 A;  2H75 A;  3HVX A;  1V58 A;  4OCE A;  2OT3 A;  2GSR A;  4AI6 A;  3GST A;  1PD2 1;  1T4Y A;  2LJA A;  4HJ2 A;  4KF9 A;  6GSX A;  1EV4 A;  3GHA A;  3TKS E;  1I1I P;  4EXJ A;  4PUR A;  4Q5N A;  4ML1 A;  3HJM A;  3QAW A;  1PL1 A;  2LTK A;  1M2B A;  1A0R P;  1NHO A;  3ZL5 A;  3FY7 A;  3EU3 A;  2H30 A;  3KP9 A;  1LJR A;  5BRT A;  3LQ7 A;  3HZ8 A;  3HKR A;  2CAQ A;  4K7O A;  4WR4 A;  1T00 A;  2HSN A;  4HZ2 A;  3KXO A;  3I69 A;  3GN3 A;  4RQX A;  4QQ7 A;  2H6X A;  2KP1 A;  4EIP A;  2F9S A;  1N25 A;  2P0G A;  1EGO A;  2HZE B;  4F0C A;  1MDK A;  2HRK B;  7GSS A;  2HI7 A;  1YEP A;  3LW9 A;  4LA1 A;  3L0H A;  3D5J A;  14GS A;  1O73 A;  2LQQ A;  3P7X A;  5B7C A;  5HFG A;  3A3T A;  1AQX A;  3U5R E;  3DYR A;  3EMX A;  3PGT A;  1TU7 A;  2DLX A;  2IFQ B;  4IN0 A;  5DCG A;  5J4V A;  2WVY A;  1M9B A;  5A34 A;  3TJJ A;  2YOI A;  3UJ1 A;  1WE0 A;  3A2V A;  3UMA A;  5KN2 A;  3FRC A;  4N11 A;  2HQT A;  5IMC A;  1Z3E A;  1FVJ A;  5B6N A;  5IIZ A;  4YAP A;  4BWS A;  5HR3 A;  1B8X A;  2QC7 A;  4FYC A;  2R5G A;  1WWJ A;  4K8M A;  3UAR A;  5H5Q A;  1BF5 A;  2ON7 A;  4HZ4 A;  3VK9 A;  4KX4 A;  5J47 A;  3NOF A;  1WJK A;  3FW2 A;  3RPP A;  2RM6 A;  4K5S A;  2B6M A;  1JLW A;  2JZR A;  1WOU A;  4MA9 A;  2X8H A;  4LMW A;  3R2Q A;  4G0K A;  3F9U A;  4EDZ A;  3QDN A;  4WBJ A;  3IOS A;  1U87 A;  4JE1 A;  2UZ8 A;  2H73 A;  2V41 A;  1FO5 A;  2R0C A;  3E9J B;  3Q18 A;  2OE0 A;  1VGL A;  2V6K A;  4KCA A;  1QUW A;  1U3A A;  3H4K A;  4NXI A;  4PQI A;  2VIM A;  4X1U A;  4O5U A;  3TJK A;  4NHW A;  3CYN A;  2PN8 A;  2HSM A;  5B8A A;  1XOB A;  3ZMK A;  1XWB A;  2GQK A;  1YF0 A;  4G19 A;  1SK2 A;  2C0G A;  2C80 A;  3QMX A;  5H5S A;  3UL3 A;  5HFI A;  1KEB A;  4Q5R A;  2AJQ B;  1SJZ A;  1B4Q A;  1QK8 A;  2L6D A;  5G5F A;  17GS A;  3WYW A;  2VL9 A;  2PER A;  3HVS A;  5DAL A;  2JAC A;  5IMZ A;  5G2Z A;  3ZFB A;  4V2N A;  3CSH A;  1BG1 A;  1HQO A;  1OE7 A;  3TOT A;  2C3N A;  4YKG A;  2O36 A;  2OKA A;  2GLR A;  2L4Q A;  1HYU A;  4BWQ A;  1A2L A;  3HMJ G;  1ZL9 A;  1J9B A;  2JSZ A;  2PU9 C;  2OJL A;  4NHZ A;  5BMU B;  4HS1 A;  1SYR A;  3L9V A;  2AV4 A;  1XZO A;  3EYT A;  1FG4 A;  1XBS A;  5DBQ A;  1Q98 A;  1XOA A;  4WEY A;  5ELA A;  2GQM A;  4F82 A;  1HNA A;  4KUN A;  5DQY A;  2RII A;  4CW9 A;  3MDK A;  3IK9 A;  2VOC A;  3DVW A;  2FHE A;  3TB2 A;  1X9M B;  1TW9 A;  1Z7R A;  3APQ A;  2IME A;  3KIJ A;  3FEU A;  1SL1 B;  5CYY A;  3M3M A;  5G30 A;  4HSC X;  4KW6 A;  3TOU A;  5ECP B;  2GT5 A;  4K6X A;  1K0N A;  3I43 A;  2VO4 A;  2LQO A;  4TR1 A;  1ERU A;  3H1N A;  2VD1 A;  1JFU A;  3CQF A;  3VWU A;  1NSW A;  2JZT A;  1V57 A;  5C00 A;  1AIU A;  4ZXG A;  3S9F A;  1F6M C;  1M2A A;  1AQV A;  1EOG A;  2DKH A;  2L59 A;  2DBC A;  2ON5 A;  1EOH A;  1XWG A;  2K8V A;  3IRA A;  3PH9 A;  1EEJ A;  3VFI A;  3W8S A;  2X64 A;  4MJB A;  3GUS A;  2B5E A;  5FWG A;  3IC8 A;  3VWX A;  2LRT A;  4FXY P;  4I2T A;  3C8E A;  5LCZ A;  1OC9 A;  4BVX B;  3RAZ A;  5DCH A;  3HZ4 A;  3M8N A;  1SKS B;  2WVX A;  2CZ3 A;  2O85 A;  3QD9 A;  2HZE A;  1THO A;  4RI6 A;  5KN0 A;  2H6Z A;  4MPF A;  1SD8 A;  5A4V A;  1EP7 A;  5E59 A;  4KDY A;  2EIQ A;  2M80 A;  3HA9 A;  3OR5 A;  1K0D A;  3TKS A;  4TR0 A;  2ES7 A;  1EGR A;  1R26 A;  4TOP A;  1XWA A;  4NAX A;  1SK0 A;  3TJF A;  5F8B A;  4TXV A;  2CQ9 A;  4KAE A;  3N5O A;  2RLI A;  2DJ0 A;  4Z2U A;  1F2E A;  2GT6 A;  5HR2 A;  1OYJ A;  3LWA A;  3UOM A;  1X0R A;  4N0Z A;  3ZRE A;  3O76 A;  3TKR A;  2E2G A;  4I5Q A;  3ZML A;  2X4A A;  2WS2 A;  3TU3 B;  1TOF A;  4IBP A;  1SJ6 A;  19GS A;  3UVT A;  1W89 A;  2F3M A;  4OFM A;  1SVO A;  1HD2 A;  4OWY A;  1UVZ A;  1S4B P;  2A2P A;  4D73 A;  3EE2 A;  2V6O A;  2C0F A;  2KOK A;  2YWO A;  1U88 A;  3KJY A;  2EC4 A;  2QKE A;  1TI1 A;  4USS A;  1ERW A;  2CV4 A;  2K18 A;  3DML A;  1XIY A;  3W6G A;  1RQM A;  3NIV A;  4IJ3 A;  1SVL A;  4GXZ A;  2FD3 A;  4ZB9 A;  2HFD A;  3ERG A;  3DIE A;  4ISD A;  4YQV A;  1GLQ A;  2A2S A;  5GZZ B;  1T3B A;  1E6B A;  1ZCP A;  4MH3 A;  3ME7 A;  3MIX A;  2GTU A;  3CTG A;  2VL2 C;  4E68 A;  3BCK A;  5A1N B;  2H0I A;  5B6M A;  1K0C A;  4PNG A;  4X4J A;  3FR6 A;  1EEM A;  4O5R A;  5J40 A;  2O89 A;  1J0F A;  1ACV A;  1HNC A;  1R7H A;  2FCH A;  2M46 A;  1JZD A;  3GUR A;  3WT2 A;  1PL2 A;  3D4M A;  4TR4 A;  4RQR A;  2VD0 A;  5CRH A;  1TTZ A;  5ECN B;  3ZVJ A;  3QPM A;  2IMK A;  3O6T A;  1MDI A;  2HYX A;  3QAG A;  3TKQ A;  1C72 A;  1YJ6 A;  2GSQ A;  4MK3 A;  1OC8 A;  5IMV A;  5JCW A;  2CX4 A;  4L5L A;  2H0H A;  5JWO B;  4XS4 A;  1A8Y A;  3F4T A;  5A5K A;  1BJX A;  3IXR A;  1ABA A;  1CQG A;  3EIN A;  3CXG A;  1VF1 A;  2DSA A;  4JED A;  2JZS A;  2FWF A;  1X9W B;  1ILO A;  2LKU A;  5ID2 A;  2NTO A;  1A2M A;  3EVI A;  1TP9 A;  4K2D A;  4DSS A;  3Q74 A;  1XW6 A;  1DE1 A;  2EFD A;  1W4V A;  4GQF A;  4HOJ A;  1XPV A;  5AIV A;  2H72 A;  1GLP A;  2CT6 A;  2L57 A;  3C71 A;  2KUC A;  4O7H A;  1XXU A;  3F63 A;  1AXD A;  3GTU B;  2R6K A;  2GGT A;  4MAB A;  1BG5 A;  1DSB A;  4KND A;  1ZYE A;  2LS5 A;  3IK7 A;  1PX7 A;  1TRW A;  3F4S A;  5J4Y A;  4MPG A;  4N10 A;  2R3X A;  2WW1 A;  2F8A A;  1JZO A;  2RUE A;  5EPF A;  4IEL A;  4IP1 A;  3J7Y k;  1AQW A;  1M7T A;  13GS A;  2QSI A;  3CHX C;  1AW9 A;  1M3I A;  2H6Y A;  3G7Y A;  2TIR A;  3C1R A;  2H1G A;  4O32 A;  4K0G A;  5D9W A;  2WUL A;  5JWR B;  4JBB A;  2H1A A;  3LJR A;  2JAD A;  4G2E A;  3KEB A;  4PTS A;  3EMP A;  3GX8 A;  4MNN A;  4HQZ A;  1V40 A;  5ECM B;  6GSW A;  3F6D A;  3BBY A;  3MWH A;  5KOW A;  1WPI A;  2HXK A;  1NHY A;  2WW3 A;  2H1L A;  3HVV A;  3CMI A;  5A5H B;  3UBL A;  1TK5 B;  5GAP D;  2VCT A;  5INY A;  2IMD A;  1O8W A;  2X99 A;  2A2R A;  3TRX A;  2R37 A;  3QOU A;  4ECJ A;  3A5W A;  4XRD A;  4HEA 2;  1WMJ A;  1BED A;  2B5Y A;  5ECO B;  3LOR A;  4YAV A;  3DVX A;  4ULX A;  3TKS C;  2QA2 A;  3I6A A;  1B48 A;  5JWQ B;  1G0T A;  3TGZ A;  5GSS A;  2GZY A;  4BL7 A;  4XCS A;  1NM3 A;  4KE3 A;  1QGV A;  5J9B A;  4N30 A;  4ILF A;  3WGE A;  2YZH A;  3L9U A;  2MBS A;  1XFL A;  3DGQ A;  2XBI A;  4AJ8 A;  2IJY A;  1M0U A;  9GSS A;  2FA8 A;  2VCX A;  2C1Y A;  1Q4J A;  2GSS A;  1ZYQ B;  3KTL A;  1YF1 A;  2G2Q A;  3MYD A;  3D4T A;  4W66 A;  2GQL A;  4FYB A;  1PMT A;  3TDG A;  2XPD A;  4PUF C;  3FZ4 A;  2O5V A;  1M3J A;  5D73 A;  1TI3 A;  1GSU A;  5ENU A;  1K3O A;  1B9X C;  5EL8 A;  2GST A;  3WGD A;  4I97 A;  2D2Z A;  3R3E A;  2JSY A;  5AN1 A;  3M1G A;  5DAK B;  3RHC A;  5ELG A;  1PN0 A;  2L5L A;  4E8E A;  3GL3 A;  3KGK A;  2IN3 A;  2GDR A;  4IVF A;  5KN1 A;  1M2D A;  3MAK A;  4IGJ A;  2MMN A;  4XS6 A;  1OC3 A;  5D8I A;  1URM A;  1N2A A;  4NMU A;  4WF5 A;  4OFT A;  4GCI A;  4DSR A;  1TXX A;  2F51 A;  4ZL7 A;  1NW2 A;  2XHF A;  2QGV A;  2YV9 A;  3VPQ A;  5CRW A;  4HJM A;  5JCG A;  2IIY A;  5G1L A;  1TKD B;  3CBU A;  1GSQ A;  5J41 A;  3RBT A;  3IHG A;  4FQU A;  4TXO B;  2HE3 A;  2HLS A;  2MZC A;  4MJA A;  4V1A g;  3EWL A;  3GYK A;  5AGY A;  3IPZ A;  4X43 A;  4I8B A;  4MCU A;  5COH A;  3FHK A;  2ZCT A;  1ZYN A;  2VKZ G;  4BA7 A;  4G10 A;  5DDL A;  2NPB A;  3HHV A;  1F9M A;  2VLV A;  4ZBA A;  2DC5 A;  4G0L A;  5CO3 A;  4QMK A;  3FZA A;  4JR6 A;  4AKG A;  2I81 A;  2WW2 A;  3TKP A;  1PA3 A;  1BQ7 A;  1XW9 A;  1FW1 A;  3ED3 A;  1GUK A;  2IPA A;  5FHI A;  2MMA A;  1A0F A;  2CA8 A;  2WDU A;  4V1A p;  3AY8 A;  1ST9 A;  4GQC A;  4MDC A;  5J4U A;  2FGX A;  4PI2 C;  3HD5 A;  2YWN A;  3LSZ A;  2N5F A;  1GSE A;  3F6F A;  3C1S A;  3KH9 A;  5D9V A;  3TRP A;  3VUR A;  5AIX A;  5ECQ B;  4ECB A;  2DJ1 A;  2VCW A;  1TDI A;  2HNL A;  2CAI A;  5AIS A;  2B5X A;  16GS A;  4BVY B;  2EFE A;  4IW9 A;  4TN8 A;  2LRN A;  5A4U A;  2WZS A;  3KM6 A;  2PBJ A;  3Q6O A;  1EWX A;  4GWR A;  1WP0 A;  4I6X A;  4ZIL A;  5D9T A;  2XC2 A;  3P8W A;  4WR5 A;  3GA4 A;  3VWW A;  2MMZ A;  2PVO C;  2C0E A;  3HJP A;  1K3L A;  4F2I A;  4AJ6 A;  5KOX A;  4PX1 A;  1YKC A;  1TRU A;  3GKM A;  4AGS A;  3WD6 A;  1O81 A;  3LYK A;  2H76 A;  4WF4 A;  3ERF A;  1AUC A;  4PNF A;  2HRN A;  2HRA A;  1S3D A;  3A2W A;  3ZTL A;  2OBI A;  1H4O A;  4OO4 A;  2LNS A;  4MP4 A;  3ZIT A;  5LNK e;  4K2X A;  3SWL A;  1O8X A;  3ZLP A;  6GSY A;  3UVH A;  2YCD A;  2IMF A;  1TJD A;  1A2J A;  5C04 A;  5ECL B;  4K9Z A;  2FA4 A;  5DVB A;  2J9H A;  1F3B A;  3EUR A;  1T7P B;  2HSN B;  2P31 A;  5H5R A;  2N5A A;  5J5N A;  5IMD A;  5HR1 A;  4PQH A;  2YV7 A;  5A4W A;  2HRK A;  3LEF A;  1GRX A;  1KNG A;  5IOX A;  2VL3 A;  1Z9H A;  2O3E A;  1MD4 A;  2CX3 A;  1TXU A;  4GTU A;  4AKI A;  3BOA A;  2H70 A;  4NV2 A;  3ERW A;  4WET A;  4ZBD A;  2GS3 A;  2IFQ A;  5IM9 A;  3GH6 A;  3VLN A;  4V2L A;  5HFK A;  1B9Y C;  3KH7 A;  1DBY A;  2AYT A;  3DRN A;  3V1W A;  6GSU A;  2PWJ A;  3D21 A;  2H74 A;  1O85 A;  5A34 B;  4ICY A;  2WW0 A;  4IKH A;  3IHQ A;  6GST A;  2KP2 A;  1G6Y A;  2HZF A;  2AHE A;  3PIN A;  3FK8 A;  6GSV A;  5F07 A;  1IYH A;  1F37 A;  1YVL A;  2FY6 A;  1A23 A;  4KDU A;  1A24 A;  5IQY A;  3MSZ A;  3NZN A;  3RPN A;  2DIZ A;  4HI7 A;  1XVW A;  1JHB A;  2LUS A;  1TU8 A;  5JCU A;  1K0B A;  4GDF A;  2WZ9 A;  4NPB A;  4MLY A;  1S3A A;  1JLV A;  2XPE A;  2R4V A;  2X8G A;  3H8Q A;  3ISO A;  1F3A A;  4L5O A;  4Q5F A;  3FR9 A;  3ZVJ D;  2HSY A;  2OAC A;  1X5D A;  4ECI A;  1DE2 A;  5CRE A;  4EF0 A;  4YH2 A;  1SJI A;  2DKI A;  3KZQ A;  4KB3 A;  3CSI A;  4LMV A;  2G0F A;  20GS A;  2PPT A;  4PQ1 A;  3TJG A;  5L71 A;  5ABR A;  4POB A;  4V2M A;  4ACS A;  2MMO A;  5F06 A;  2DML A;  3LFL A;  4KGI A;  4XTS A;  4IHU A;  1ZZY A;  1PQN A;  2M72 A;  1T8E B;  2K8S A;  3KMO A;  3LYP A;  5LD0 A;  4DEJ A;  3G7I A;  1B4P A;  2YAN A;  3E3E A;  2GZP A;  4ZB7 A;  1GUM A;  5E4W A;  4JR4 A;  3BCI A;  4MZC A;  2X49 A;  3GX0 A;  4BPY A;  3CWG A;  4OD7 A;  4PUA A;  3DEX A;  1BX9 A;  4LL1 B;  2E7P A;  1UN2 A;  4POL A;  1GSF A;  3GFK A;  1IYI A;  5DAL B;  2F8F A;  1XVQ A;  1SKR B;  2VLU A;  1MDJ A;  3GKK A;  4IP6 A;  1FAA A;  2IWT A;  2VM2 A;  3WT1 A;  4KH7 A;  3D22 A;  22GS A;  2O8V B;  5BMU A;  2K6V A;  1XG8 A;  3FZ5 A;  2V32 A;  2RUF A;  4L0W A;  4ECC A;  3JCM L;  1R4W A;  1YEX A;  2EIR A;  3HVN A;  4TR3 A;  2K9F A;  3H79 A;  3K8N A;  1R5A A;  3VPT A;  2C3Q A;  5IOW A;  3DKS A;  1V98 A;  5D93 A;  1M99 A;  2LJR A;  2Z9S A;  2R0P A;  1SL0 B;  2VCV A;  1ZGN A;  2P5Q A;  2UV8 G;  4TVE A;  1VF3 A;  5D96 A;  3RFR C;  3W8J A;  3I9V 2;  2LJK A;  5J9C A;  4MF5 A;  2DJ3 A;  3FZ9 A;  5HQP A;  1U3I A;  2ALB A;  1GSY A;  3IA1 A;  1GH2 A;  2AAW A;  3VWV A;  2VCZ A;  2H19 A;  4EDY A;  2MBT A;  1OAZ A;  4JU5 A;  4HU9 A;  2R2J A;  4TR1 B;  3C73 A;  2IMI A;  2VLT A;  2OA7 A;  2DJJ A;  2YZU A;  1G6W A;  1ML6 A;  3A5I A;  3DD3 A;  5G31 A;  1GTU A;  4TW5 A;  4CY6 A;  1SU9 A;  2C3T A;  3GL5 A;  4XS1 A;  2H66 A;  2WFC A;  1PRX A;  4BVX A;  1Z6N A;  1U6T A;  2H1B A;  3F3R A;  2H1D A;  1CQH A;  5ECK B;  2NBS A;  3IBH A;  1RW1 A;  1OC9 B;  1QFN A;  2OE1 A;  5GAN D;  3D0Z A;  1V9W A;  1UC7 A;  2WVX B;  1MTC A;  1S3R A;  5CAX A;  1Z5Y E;  1PX6 A;  3EC3 A;  3IAM 2;  2XBQ A;  1I9D A;  4JZQ A;  1Y1U A;  4XIH A;  4G0I A;  5J3R A;  2OBK A;  1XW5 A;  4MH2 A;  3TUE A;  4Z2R A;  4POK A;  4AKX B;  4NV5 A;  4ZL9 A;  5DJM A;  1BAY A;  1S3C A;  2I9H A;  5IPG A;  1T4Z A;  2YWI A;  2OAD A;  2J23 A;  3TCO A;  1RK4 A;  3MNG A;  1ERV A;  3H93 A;  3PR8 A;  3GNJ A;  4GRF A;  2I1U A;  4MF7 A;  3CRT A;  2WB9 A;  1ZOF A;  1SD9 A;  2E0Q A;  3IV4 A;  4L0U A;  1EP8 A;  2LEG A;  1FB0 A;  4J2F A;  4MMM A;  4CDO A;  3CTF A;  4D73 B;  5IPH A;  4F03 A;  2I4A A;  3FR3 A;  1Y6E A;  2CVK A;  1GTB A;  4CHS A;  4FO5 A;  4MF6 A; 
#chains in the Genus database with same CATH homology
 1H75 A;  2O7K A;  1AAZ A;  2OE3 A;  5CNW A;  4KDX A;  10GS A;  2HT9 A;  5ECH B;  2PVQ A;  1Z6M A;  4K7I A;  3L9S A;  4IQ1 A;  3TRQ A;  1GNW A;  2YJH A;  5B8B A;  2B7K A;  4CY8 A;  2H01 A;  1DUG A;  1KTE A;  5DQS A;  1V2A A;  3L78 A;  4EUY A;  1BYE A;  5A1N A;  1I5G A;  1X9S B;  2H8L A;  4Q5Q A;  2VL2 A;  1TK0 B;  3KD0 A;  12GS A;  2FWG A;  4AF2 A;  3FMW A;  3LGC A;  4ZBB A;  4HUA A;  11GS A;  2L5O A;  2VCQ A;  1E2Y A;  1TK8 B;  3GIX A;  1PKW A;  2MYG A;  2JL4 A;  1GUH A;  2KLX A;  3EPT A;  1HNB A;  4DVC A;  1WIK A;  1G7O A;  4IJI A;  5FT3 A;  3GKN A;  1TRS A;  2L4C A;  4KCE A;  1VF2 A;  3M9K A;  5CP1 A;  1SKW B;  3ME8 A;  4KSM A;  1FB6 A;  5G1K A;  3GSS A;  4XS4 B;  3F8U A;  1VRS D;  3P2A A;  1GTA A;  3U6V A;  2VM1 A;  3C7M A;  3QFB C;  2EFH A;  4ZB6 A;  3DXB A;  4ML6 A;  2HRF A;  2B1L A;  2O87 A;  1PGT A;  2LNT A;  4G9H A;  5ID2 B;  4Z7X A;  2DMM A;  2FUG 2;  2X8C A;  4HU7 A;  4J57 E;  5IO2 A;  3LG6 A;  4DSS B;  4PGT A;  4EE0 A;  3BJ5 A;  5GST A;  1XCC A;  1GTI A;  3ZYW A;  2HSH A;  3APS A;  3GTU A;  2VUP A;  4TKY A;  1LU4 A;  4JRR A;  3O3T A;  4A5P A;  4Z2T A;  2B1K A;  4DSQ A;  1UA5 A;  3QCP A;  4IQA A;  4K7N A;  2IL3 A;  3CSJ A;  5IMF A;  3G7J A;  5IO0 A;  2WCI A;  2DIY A;  1MEK A;  4MJE A;  3HYP A;  1T1V A;  2ZUP A;  1M9A A;  4OMV A;  3TJB A;  1FHE A;  1XWC A;  4GST A;  4J56 E;  1G7E A;  5CRG A;  4O5Q A;  4POM A;  1K3Y A;  4L8E A;  3P90 A;  3US3 A;  4WKW A;  1FOH A;  3CRU A;  3ZIJ A;  2E2M A;  1GL8 A;  1SVM A;  1TRV A;  2GVP A;  1YZX A;  2H71 A;  1LBK A;  1GP1 A;  1N8J A;  3F0I A;  4OCF A;  4YQM A;  2BTO T;  1X5C A;  4GF0 A;  4K5R A;  4F9Z A;  4ZL8 A;  1K0M A;  1OKD A;  4QL9 A;  4I2U A;  4HQS A;  3QFA C;  5HR0 A;  1ZYP A;  8GSS A;  4K1F A;  4P3Y B;  5A5H A;  3GV1 A;  4QL7 A;  2VAF A;  4AJ7 A;  3UBK A;  1O6J A;  2PUK C;  2YWM A;  3UAP A;  1GUL A;  1USB A;  3GKX A;  4N3Z A;  3VI5 A;  3EU4 A;  3QR6 A;  3HCZ A;  3IR4 A;  4FH8 A;  1MD3 A;  2BJX A;  4XHM A;  3DWV A;  5DJL A;  4KA0 A;  2LST A;  1SK1 A;  3UIW A;  4EC0 A;  18GS A;  1J08 A;  1PSQ A;  2WJU A;  4TRX A;  1QQ2 A;  2GZZ A;  2EFC A;  3LXT A;  1OE8 A;  1OVN A;  2C0D A;  4GSN A;  2PGT A;  2C4J A;  4HDE A;  4BL7 B;  5KEJ A;  2AUV A;  2DJK A;  4WXT A;  2NVL A;  3KTB A;  3IC4 A;  3G9B A;  2R0G A;  1EZK A;  5KN3 A;  4PXO A;  2YJ7 A;  4ZIJ A;  3KCM A;  1FVK A;  2CVD A;  4O92 A;  3LXZ A;  3WGX A;  1YY7 A;  2A4H A;  4EIQ A;  2TRX A;  2JU5 A;  1K0O A;  1KBN A;  3ZRD A;  3F4R A;  5ECI B;  3QAV A;  1GNE A;  5CRD A;  2RM5 A;  2BMX A;  2AB6 A;  1PN9 A;  2FWH A;  5IMA A;  5ECS A;  4MZB A;  4K0N A;  4E8H A;  1Z7P A;  3D6I A;  5DAK A;  2L6C A;  3GMF A;  2V1M A;  2REM A;  4G01 A;  1Y25 A;  1SEN A;  1VF4 A;  3ZIV A;  2LRC A;  1SYX A;  2H0G A;  4ID0 A;  2WRT A;  1JZW A;  4FYU A;  3RDW A;  2PMT A;  4NWY A;  4WBR D;  3IE3 A;  1ZMA A;  4KSO A;  4EVM A;  5F05 A;  3M9J A;  1XWK A;  2FWE A;  1QMV A;  2V2G A;  2NDO A;  3PPU A;  1GSS A;  2HSM B;  4TXO A;  4N0V A;  2KHP A;  3N9J A;  5ECR B;  4OO5 A;  3RHB A;  1FOV A;  2EIO A;  3KP8 A;  1EV9 A;  1ERT A;  5D9X A;  4F0B A;  2DJ2 A;  2CZ2 A;  4YQU A;  4H86 A;  3F3Q A;  4XRA A;  4OFN A;  5EY6 A;  4LLR A;  1WRY A;  3GRX A;  2QA1 A;  1YQ1 A;  1X5E A;  2N5B A;  5EVO A;  4EO3 A;  1OKT A;  1YDK A;  1AC1 A;  1K0A A;  6GSS A;  4EKZ A;  3IDV A;  4ZB8 A;  4LL4 B;  1O7U A;  1JZR A;  4AKH A;  3GH9 A;  2YP6 A;  4GLT A;  3FKF A;  3L4N A;  2YNX A;  1YKA A;  4YKF A;  2YPM A;  2FNO A;  4IS0 A;  2YN1 A;  1GWC A;  2B3S A;  4GSS A;  5G5E A;  3J7Y b;  5F0G A;  4RUV A;  3IAS 2;  4RI7 A;  2A4V A;  2B7J A;  4MZW A;  1QXH A;  3M0F A;  2TRC P;  1GSD A;  2WGR A;  3BD2 A;  3HXS A;  4BVY A;  4MJC A;  1ON4 A;  3APO A;  3KMN A;  4X0X A;  2C8U A;  3E0U A;  4FIW A;  2I3Y A;  1A8L A;  2CVB A;  3SBC A;  2P5R A;  1R5P A;  3HJO A;  1THX A;  3Q19 A;  2ZNM A;  3FYG A;  3HDC A;  3VI7 A;  3ZZX A;  3UEM A;  3ZFL A;  4EL1 A;  2LV3 A;  2FLS A;  1PKZ A;  1SL2 B;  3A2X A;  3HY2 A;  2H75 A;  3HVX A;  1V58 A;  4OCE A;  2OT3 A;  2GSR A;  4AI6 A;  3GST A;  1PD2 1;  1T4Y A;  2LJA A;  4HJ2 A;  4KF9 A;  6GSX A;  1EV4 A;  3GHA A;  3TKS E;  4EXJ A;  4PUR A;  4Q5N A;  4ML1 A;  3HJM A;  3QAW A;  1PL1 A;  2LTK A;  1M2B A;  1A0R P;  1NHO A;  3ZL5 A;  3FY7 A;  3EU3 A;  2H30 A;  3KP9 A;  1LJR A;  5BRT A;  3LQ7 A;  3HZ8 A;  3HKR A;  2CAQ A;  4K7O A;  4WR4 A;  1T00 A;  2HSN A;  4HZ2 A;  3KXO A;  3I69 A;  3GN3 A;  4RQX A;  4QQ7 A;  2H6X A;  2KP1 A;  4EIP A;  2F9S A;  1N25 A;  2P0G A;  1EGO A;  2HZE B;  4F0C A;  1MDK A;  2HRK B;  7GSS A;  2HI7 A;  1YEP A;  3LW9 A;  4LA1 A;  3L0H A;  3D5J A;  14GS A;  1O73 A;  2LQQ A;  3P7X A;  5B7C A;  5HFG A;  3A3T A;  1AQX A;  3U5R E;  3DYR A;  3EMX A;  3PGT A;  1TU7 A;  2DLX A;  2IFQ B;  4IN0 A;  5DCG A;  5J4V A;  1M9B A;  5A34 A;  3TJJ A;  2YOI A;  3UJ1 A;  1WE0 A;  3A2V A;  3UMA A;  5KN2 A;  3FRC A;  4N11 A;  2HQT A;  5IMC A;  1Z3E A;  1FVJ A;  5B6N A;  5IIZ A;  4YAP A;  4BWS A;  5HR3 A;  1B8X A;  2QC7 A;  4FYC A;  2R5G A;  1WWJ A;  4K8M A;  3UAR A;  5H5Q A;  1BF5 A;  2ON7 A;  4HZ4 A;  3VK9 A;  4KX4 A;  5J47 A;  3NOF A;  1WJK A;  3FW2 A;  3RPP A;  2RM6 A;  4K5S A;  2B6M A;  1JLW A;  2JZR A;  1WOU A;  4MA9 A;  2X8H A;  4LMW A;  3R2Q A;  4G0K A;  3F9U A;  4EDZ A;  3QDN A;  4WBJ A;  3IOS A;  1U87 A;  4JE1 A;  2UZ8 A;  2H73 A;  2V41 A;  1FO5 A;  2R0C A;  3E9J B;  3Q18 A;  2OE0 A;  1VGL A;  2V6K A;  4KCA A;  1QUW A;  1U3A A;  3H4K A;  4NXI A;  4PQI A;  2VIM A;  4X1U A;  4O5U A;  3TJK A;  4NHW A;  3CYN A;  2PN8 A;  2HSM A;  5B8A A;  1XOB A;  3ZMK A;  1XWB A;  2GQK A;  1YF0 A;  4G19 A;  1SK2 A;  2C0G A;  2C80 A;  3QMX A;  5H5S A;  3UL3 A;  5HFI A;  1KEB A;  4Q5R A;  2AJQ B;  1SJZ A;  1B4Q A;  1QK8 A;  2L6D A;  5G5F A;  17GS A;  3WYW A;  2VL9 A;  2PER A;  3HVS A;  5DAL A;  2JAC A;  5IMZ A;  5G2Z A;  3ZFB A;  4V2N A;  3CSH A;  1BG1 A;  1HQO A;  1OE7 A;  3TOT A;  2C3N A;  4YKG A;  2OKA A;  2GLR A;  2L4Q A;  1HYU A;  4BWQ A;  1A2L A;  3HMJ G;  1ZL9 A;  1J9B A;  2JSZ A;  2PU9 C;  2OJL A;  4NHZ A;  5BMU B;  4HS1 A;  1SYR A;  3L9V A;  2AV4 A;  1XZO A;  3EYT A;  1FG4 A;  1XBS A;  5DBQ A;  1Q98 A;  1XOA A;  4WEY A;  5ELA A;  2GQM A;  4F82 A;  1HNA A;  4KUN A;  5DQY A;  2RII A;  4CW9 A;  3MDK A;  3IK9 A;  2VOC A;  3DVW A;  2FHE A;  3TB2 A;  1X9M B;  1TW9 A;  1Z7R A;  3APQ A;  2IME A;  3KIJ A;  3FEU A;  1SL1 B;  5CYY A;  3M3M A;  5G30 A;  4KW6 A;  3TOU A;  5ECP B;  2GT5 A;  4K6X A;  1K0N A;  3I43 A;  2VO4 A;  2LQO A;  4TR1 A;  1ERU A;  3H1N A;  2VD1 A;  1JFU A;  3VWU A;  1NSW A;  2JZT A;  1V57 A;  5C00 A;  1AIU A;  4ZXG A;  3S9F A;  1F6M C;  1M2A A;  1AQV A;  1EOG A;  2DKH A;  2L59 A;  2DBC A;  2ON5 A;  1EOH A;  1XWG A;  2K8V A;  3IRA A;  3PH9 A;  1EEJ A;  3VFI A;  3W8S A;  2X64 A;  4MJB A;  3GUS A;  2B5E A;  5FWG A;  3IC8 A;  3VWX A;  2LRT A;  4I2T A;  3C8E A;  5LCZ A;  1OC9 A;  4BVX B;  3RAZ A;  5DCH A;  3HZ4 A;  3M8N A;  1SKS B;  2CZ3 A;  2O85 A;  3QD9 A;  2HZE A;  1THO A;  4RI6 A;  5KN0 A;  2H6Z A;  4MPF A;  1SD8 A;  5A4V A;  1EP7 A;  5E59 A;  4KDY A;  2EIQ A;  2M80 A;  3HA9 A;  3OR5 A;  1K0D A;  3TKS A;  4TR0 A;  2ES7 A;  1EGR A;  1R26 A;  4TOP A;  1XWA A;  4NAX A;  1SK0 A;  3TJF A;  5F8B A;  4TXV A;  2CQ9 A;  4KAE A;  3N5O A;  2RLI A;  2DJ0 A;  4Z2U A;  1F2E A;  2GT6 A;  5HR2 A;  1OYJ A;  3LWA A;  3UOM A;  1X0R A;  4N0Z A;  3ZRE A;  3O76 A;  3TKR A;  2E2G A;  4I5Q A;  3ZML A;  2X4A A;  2WS2 A;  3TU3 B;  1TOF A;  4IBP A;  1SJ6 A;  19GS A;  3UVT A;  1W89 A;  2F3M A;  4OFM A;  1SVO A;  1HD2 A;  4OWY A;  1UVZ A;  2A2P A;  4D73 A;  3EE2 A;  2V6O A;  2C0F A;  2KOK A;  2YWO A;  1U88 A;  3KJY A;  2EC4 A;  2QKE A;  1TI1 A;  4USS A;  1ERW A;  2CV4 A;  2K18 A;  3DML A;  1XIY A;  3W6G A;  1RQM A;  3NIV A;  4IJ3 A;  1SVL A;  4GXZ A;  2FD3 A;  4ZB9 A;  2HFD A;  3ERG A;  3DIE A;  4ISD A;  4YQV A;  1GLQ A;  2A2S A;  5GZZ B;  1T3B A;  1E6B A;  1ZCP A;  4MH3 A;  3ME7 A;  3MIX A;  2GTU A;  3CTG A;  2VL2 C;  4E68 A;  3BCK A;  5A1N B;  2H0I A;  5B6M A;  1K0C A;  4PNG A;  4X4J A;  3FR6 A;  1EEM A;  4O5R A;  5J40 A;  2O89 A;  1J0F A;  1ACV A;  1HNC A;  1R7H A;  2FCH A;  2M46 A;  1JZD A;  3GUR A;  3WT2 A;  1PL2 A;  3D4M A;  4TR4 A;  4RQR A;  2VD0 A;  5CRH A;  1TTZ A;  5ECN B;  3ZVJ A;  3QPM A;  2IMK A;  3O6T A;  1MDI A;  2HYX A;  3QAG A;  3TKQ A;  1C72 A;  1YJ6 A;  2GSQ A;  4MK3 A;  1OC8 A;  5IMV A;  5JCW A;  2CX4 A;  4L5L A;  2H0H A;  5JWO B;  4XS4 A;  1A8Y A;  3F4T A;  5A5K A;  1BJX A;  3IXR A;  1ABA A;  1CQG A;  3EIN A;  3CXG A;  1VF1 A;  2DSA A;  4JED A;  2JZS A;  2FWF A;  1X9W B;  1ILO A;  2LKU A;  5ID2 A;  2NTO A;  1A2M A;  3EVI A;  1TP9 A;  4K2D A;  4DSS A;  3Q74 A;  1XW6 A;  1DE1 A;  2EFD A;  1W4V A;  4GQF A;  4HOJ A;  1XPV A;  5AIV A;  2H72 A;  1GLP A;  2CT6 A;  2L57 A;  3C71 A;  2KUC A;  4O7H A;  1XXU A;  3F63 A;  1AXD A;  3GTU B;  2R6K A;  2GGT A;  4MAB A;  1BG5 A;  1DSB A;  4KND A;  1ZYE A;  2LS5 A;  3IK7 A;  1PX7 A;  1TRW A;  3F4S A;  5J4Y A;  4MPG A;  4N10 A;  2R3X A;  2F8A A;  1JZO A;  2RUE A;  5EPF A;  4IEL A;  4IP1 A;  3J7Y k;  1AQW A;  1M7T A;  13GS A;  2QSI A;  1AW9 A;  2H6Y A;  3G7Y A;  2TIR A;  3C1R A;  2H1G A;  4O32 A;  4K0G A;  5D9W A;  2WUL A;  5JWR B;  4JBB A;  2H1A A;  3LJR A;  2JAD A;  4G2E A;  3KEB A;  4PTS A;  3EMP A;  3GX8 A;  4MNN A;  4HQZ A;  1V40 A;  5ECM B;  6GSW A;  3F6D A;  3BBY A;  3MWH A;  5KOW A;  1WPI A;  2HXK A;  1NHY A;  2H1L A;  3HVV A;  3CMI A;  5A5H B;  3UBL A;  1TK5 B;  5GAP D;  2VCT A;  5INY A;  2IMD A;  1O8W A;  2X99 A;  2A2R A;  3TRX A;  2R37 A;  3QOU A;  4ECJ A;  3A5W A;  4XRD A;  4HEA 2;  1WMJ A;  1BED A;  2B5Y A;  5ECO B;  3LOR A;  4YAV A;  3DVX A;  4ULX A;  3TKS C;  2QA2 A;  3I6A A;  1B48 A;  5JWQ B;  1G0T A;  3TGZ A;  5GSS A;  2GZY A;  4BL7 A;  4XCS A;  1NM3 A;  4KE3 A;  1QGV A;  5J9B A;  4N30 A;  4ILF A;  3WGE A;  2YZH A;  3L9U A;  2MBS A;  1XFL A;  3DGQ A;  2XBI A;  4AJ8 A;  2IJY A;  1M0U A;  9GSS A;  2FA8 A;  2VCX A;  2C1Y A;  1Q4J A;  2GSS A;  1ZYQ B;  3KTL A;  1YF1 A;  2G2Q A;  3MYD A;  3D4T A;  4W66 A;  2GQL A;  4FYB A;  1PMT A;  3TDG A;  2XPD A;  4PUF C;  3FZ4 A;  2O5V A;  5D73 A;  1TI3 A;  1GSU A;  5ENU A;  1K3O A;  1B9X C;  5EL8 A;  2GST A;  3WGD A;  4I97 A;  2D2Z A;  3R3E A;  2JSY A;  5AN1 A;  3M1G A;  5DAK B;  3RHC A;  5ELG A;  1PN0 A;  2L5L A;  4E8E A;  3GL3 A;  3KGK A;  2IN3 A;  2GDR A;  4IVF A;  5KN1 A;  1M2D A;  3MAK A;  4IGJ A;  2MMN A;  4XS6 A;  1OC3 A;  5D8I A;  1URM A;  1N2A A;  4NMU A;  4WF5 A;  4OFT A;  4GCI A;  4DSR A;  1TXX A;  2F51 A;  4ZL7 A;  1NW2 A;  2XHF A;  2QGV A;  2YV9 A;  3VPQ A;  5CRW A;  4HJM A;  5JCG A;  2IIY A;  5G1L A;  1TKD B;  3CBU A;  1GSQ A;  5J41 A;  3RBT A;  3IHG A;  4FQU A;  4TXO B;  2HE3 A;  2HLS A;  2MZC A;  4MJA A;  4V1A g;  3EWL A;  3GYK A;  5AGY A;  3IPZ A;  4X43 A;  4I8B A;  4MCU A;  5COH A;  3FHK A;  2ZCT A;  1ZYN A;  2VKZ G;  4BA7 A;  4G10 A;  5DDL A;  2NPB A;  3HHV A;  1F9M A;  2VLV A;  4ZBA A;  2DC5 A;  4G0L A;  5CO3 A;  4QMK A;  3FZA A;  4JR6 A;  4AKG A;  2I81 A;  3TKP A;  1PA3 A;  1BQ7 A;  1XW9 A;  1FW1 A;  3ED3 A;  1GUK A;  2IPA A;  5FHI A;  2MMA A;  1A0F A;  2CA8 A;  2WDU A;  4V1A p;  3AY8 A;  1ST9 A;  4GQC A;  4MDC A;  5J4U A;  2FGX A;  3HD5 A;  2YWN A;  3LSZ A;  2N5F A;  1GSE A;  3F6F A;  3C1S A;  3KH9 A;  5D9V A;  3TRP A;  3VUR A;  5AIX A;  5ECQ B;  4ECB A;  2DJ1 A;  2VCW A;  1TDI A;  2HNL A;  2CAI A;  5AIS A;  2B5X A;  16GS A;  4BVY B;  2EFE A;  4IW9 A;  4TN8 A;  2LRN A;  5A4U A;  3KM6 A;  2PBJ A;  3Q6O A;  1EWX A;  4GWR A;  1WP0 A;  4I6X A;  4ZIL A;  5D9T A;  2XC2 A;  3P8W A;  4WR5 A;  3GA4 A;  3VWW A;  2MMZ A;  2PVO C;  2C0E A;  3HJP A;  1K3L A;  4F2I A;  4AJ6 A;  5KOX A;  4PX1 A;  1YKC A;  1TRU A;  3GKM A;  4AGS A;  3WD6 A;  1O81 A;  3LYK A;  2H76 A;  4WF4 A;  3ERF A;  1AUC A;  4PNF A;  2HRN A;  2HRA A;  1S3D A;  3A2W A;  3ZTL A;  2OBI A;  1H4O A;  4OO4 A;  2LNS A;  4MP4 A;  3ZIT A;  5LNK e;  4K2X A;  3SWL A;  1O8X A;  3ZLP A;  6GSY A;  3UVH A;  2YCD A;  2IMF A;  1TJD A;  1A2J A;  5C04 A;  5ECL B;  4K9Z A;  2FA4 A;  5DVB A;  2J9H A;  1F3B A;  3EUR A;  1T7P B;  2HSN B;  2P31 A;  5H5R A;  2N5A A;  5J5N A;  5IMD A;  5HR1 A;  4PQH A;  2YV7 A;  5A4W A;  2HRK A;  3LEF A;  1GRX A;  1KNG A;  5IOX A;  2VL3 A;  1Z9H A;  2CX3 A;  1MD4 A;  1TXU A;  4GTU A;  4AKI A;  3BOA A;  2H70 A;  4NV2 A;  3ERW A;  4WET A;  4ZBD A;  2GS3 A;  2IFQ A;  5IM9 A;  3GH6 A;  3VLN A;  4V2L A;  5HFK A;  1B9Y C;  3KH7 A;  1DBY A;  2AYT A;  3DRN A;  3V1W A;  6GSU A;  2PWJ A;  3D21 A;  2H74 A;  1O85 A;  5A34 B;  4ICY A;  4IKH A;  3IHQ A;  6GST A;  2KP2 A;  1G6Y A;  2HZF A;  2AHE A;  3PIN A;  3FK8 A;  6GSV A;  5F07 A;  1IYH A;  1F37 A;  1YVL A;  2FY6 A;  1A23 A;  4KDU A;  1A24 A;  5IQY A;  3MSZ A;  3NZN A;  3RPN A;  2DIZ A;  4HI7 A;  1XVW A;  1JHB A;  2LUS A;  1TU8 A;  5JCU A;  1K0B A;  4GDF A;  2WZ9 A;  4NPB A;  4MLY A;  1S3A A;  1JLV A;  2XPE A;  2R4V A;  2X8G A;  3H8Q A;  3ISO A;  1F3A A;  4L5O A;  4Q5F A;  3FR9 A;  3ZVJ D;  2HSY A;  2OAC A;  1X5D A;  4ECI A;  1DE2 A;  5CRE A;  4EF0 A;  4YH2 A;  1SJI A;  2DKI A;  3KZQ A;  4KB3 A;  3CSI A;  4LMV A;  2G0F A;  20GS A;  2PPT A;  4PQ1 A;  3TJG A;  5L71 A;  5ABR A;  4POB A;  4V2M A;  4ACS A;  2MMO A;  5F06 A;  2DML A;  3LFL A;  4KGI A;  4XTS A;  4IHU A;  1ZZY A;  1PQN A;  2M72 A;  1T8E B;  2K8S A;  3KMO A;  3LYP A;  5LD0 A;  4DEJ A;  3G7I A;  1B4P A;  2YAN A;  3E3E A;  2GZP A;  4ZB7 A;  1GUM A;  5E4W A;  4JR4 A;  3BCI A;  4MZC A;  2X49 A;  3GX0 A;  4BPY A;  3CWG A;  4OD7 A;  4PUA A;  3DEX A;  1BX9 A;  4LL1 B;  2E7P A;  1UN2 A;  4POL A;  1GSF A;  3GFK A;  1IYI A;  5DAL B;  2F8F A;  1XVQ A;  1SKR B;  2VLU A;  1MDJ A;  3GKK A;  4IP6 A;  1FAA A;  2IWT A;  2VM2 A;  3WT1 A;  4KH7 A;  3D22 A;  22GS A;  2O8V B;  5BMU A;  2K6V A;  3FZ5 A;  2V32 A;  2RUF A;  4L0W A;  4ECC A;  3JCM L;  1R4W A;  1YEX A;  2EIR A;  4TR3 A;  2K9F A;  3H79 A;  3K8N A;  1R5A A;  3VPT A;  2C3Q A;  5IOW A;  3DKS A;  1V98 A;  5D93 A;  1M99 A;  2LJR A;  2Z9S A;  2R0P A;  1SL0 B;  2VCV A;  1ZGN A;  2P5Q A;  2UV8 G;  4TVE A;  1VF3 A;  5D96 A;  3W8J A;  3I9V 2;  2LJK A;  5J9C A;  4MF5 A;  2DJ3 A;  3FZ9 A;  5HQP A;  1U3I A;  2ALB A;  1GSY A;  3IA1 A;  1GH2 A;  2AAW A;  3VWV A;  2VCZ A;  2H19 A;  4EDY A;  2MBT A;  1OAZ A;  4JU5 A;  4HU9 A;  2R2J A;  4TR1 B;  3C73 A;  2IMI A;  2VLT A;  2OA7 A;  2DJJ A;  2YZU A;  1G6W A;  1ML6 A;  3A5I A;  3DD3 A;  5G31 A;  1GTU A;  4TW5 A;  4CY6 A;  1SU9 A;  2C3T A;  3GL5 A;  4XS1 A;  2H66 A;  2WFC A;  1PRX A;  4BVX A;  1Z6N A;  1U6T A;  2H1B A;  3F3R A;  2H1D A;  1CQH A;  5ECK B;  2NBS A;  3IBH A;  1RW1 A;  1OC9 B;  1QFN A;  2OE1 A;  5GAN D;  3D0Z A;  1V9W A;  1UC7 A;  1MTC A;  5CAX A;  1Z5Y E;  1PX6 A;  3EC3 A;  3IAM 2;  2XBQ A;  1I9D A;  4JZQ A;  1Y1U A;  4XIH A;  4G0I A;  5J3R A;  2OBK A;  1XW5 A;  4MH2 A;  3TUE A;  4Z2R A;  4POK A;  4AKX B;  4NV5 A;  4ZL9 A;  5DJM A;  1BAY A;  1S3C A;  2I9H A;  5IPG A;  1T4Z A;  2YWI A;  2OAD A;  2J23 A;  3TCO A;  1RK4 A;  3MNG A;  1ERV A;  3H93 A;  3PR8 A;  3GNJ A;  4GRF A;  2I1U A;  4MF7 A;  3CRT A;  2WB9 A;  1ZOF A;  1SD9 A;  2E0Q A;  3IV4 A;  4L0U A;  1EP8 A;  2LEG A;  1FB0 A;  4J2F A;  4MMM A;  4CDO A;  3CTF A;  4D73 B;  5IPH A;  4F03 A;  2I4A A;  3FR3 A;  1Y6E A;  2CVK A;  1GTB A;  4CHS A;  4FO5 A;  4MF6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...