1XWDC

Crystal structure of human follicle stimulating hormone complexed with its receptor
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
242
structure length
242
Chain Sequence
b'CHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELRFVLTKLRVIQKGAFSGFGDLEKIEISQNDVLEVIEADVFSNLPKLHEIRIEKANNLLYINPEAFQNLPNLQYLLISNTGIKHLPDVHKIHSLQKVLLDIQDNINIHTIERNSFVGLSFESVILWLNKNGIQEIHNCAFNGTQLDELNLSDNNNLEELPNDVFHGASGPVILDISRTRIHSLPSYGLENLKKLRARSTYNLKKLPTLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycoprotein hormones alpha chain
publication title Structure of human follicle-stimulating hormone in complex with its receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone/growth factor
total genus 69
structure length 242
sequence length 242
chains with identical sequence F
ec nomenclature
pdb deposition date 2004-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01462 LRRNT Leucine rich repeat N-terminal domain
C PF13306 LRR_5 BspA type Leucine rich repeat region (6 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 1xwdC00
2Z7XB 4HQ1A 5IJBA 3E2JA 3GOZA 2BEXA 3A79B 3ZYIA 4EZGA 4P91A 1M10B 2P1PB 2P1NB 1DCEA 4AY9X 4ARRA 3O6NA 4QBZA 1FO1A 1ZIWA 1WWLA 3VQ1A 4NKGA 2Q4GW 3UN9A 3TSRE 4ECNA 3P72A 5AZ5A 4NKHA 3G39A 4Y61B 5IJCA 4AW4A 3ULAA 3DZEA 5AWBA 1XECA 2WFHA 4L3AA 2OMWA 3REZA 2O6QA 3G04C 1W8AA 2R9UA 3FXIA 3W3JA 2FT3A 1K5DC 2IFGA 4Z94G 2ASSB 4KT1A 5AWCA 4FDWA 3OGKB 4CC4C 4M7EC 1OTNA 5GS0A 4LXSA 4K17A 1FS2A 4GLPA 3WPIA 3WN4A 5CMPA 2OMZA 4H09A 1YRGA 4FMZA 4R5CA 2WQWA 4BSUA 2Z63A 4KXFB 4QXEA 2Z62A 3C6OB 5AWDA 1M9LA 3RJ0A 3G3AA 4Z79A 3ZYOA 1O6VA 3WPGA 3E4GA 1D0BA 4R0AA 5GMHA 1A9NA 4XGOA 2V70A 3W3KA 4MQWX 3WPEA 5AWAA 2ASTB 4TZHA 4FCGA 4V2CA 3CIYA 1FT8A 4R6JA 3M19A 2P1MB 5GMFA 3RFSA 2XWTC 4L3FA 1OGQA 1H6TA 3UL9A 4RCWA 4LSXA 3WPFA 4LSCA 2O6SA 3UL7A 4FD0A 5HZLB 1PGVA 1P8TA 4PEQB 1XWDC 2Z82A 4R6GA 3OJAA 4PQ8A 1O6SA 5FTTB 4QC0A 1K5GC 5B0TA 4R6FA 4LI2A 5LFNA 3RW7A 3E3ZA 3CIGA 1OTMA 2ID5A 5B0NA 4BSRA 4GT6A 3W3GA 1DS9A 4Z8GA 3RFJA 4BV4R 1A4YA 3RGXA 1KOHA 4Q3GA 4WYKA 3W3LA 2P1QB 2OMUA 4ARNA 4FHOA 4CP6A 5GMGA 2Z7XA 5GQRK 1O6TA 1SQ0B 2OMYA 3OGMB 2P1OB 3ULUA 3UL8A 2XOTA 1M0ZA 3RFEA 3CVRA 4LI1A 3G06A 4LSAA 5HDHA 4UFRA 3RW6A 3SB4A 5IJDA 4R58A 4R07A 4LXRA 3PMHG 4ECOA 1XEUA 4V2DA 2JE0A 1M9SA 1P8VA 3WPBA 4Q62A 2OMXA 4R08A 1P9AG 4RWTC 2WQVA 3WPCA 1LTXA 3O53A 5CMNA 3ULVA 4CNMA 4Q3IA 4Z64C 4OQTA 2WQXA 4R5DA 4KNGA 1FQVA 2JE1A 4CC4A 4U06A 4U09A 4C2AB 1XKUA 2Z66A 4M7EA 3JB9j 1XCDA 3WPHA 1OTOA 4I6JB 1GWBA 1JL5A 3OGLB 4WP6A 2JQDA 5IYXC 4R09A 5D3IA 4BSSA 5B4PA 1Z7XW 2WQUA 4C2BB 3W3NA 1G9UA 3W3MA 1OZNA 1IO0A 3ZYJA 4CNCA 4PERA 4U08A 4B8CD 2V9SA 4P8SA 4U7LA 4MN8B 3VQ2A 1QYYA 3G3BA 2UZXA 4FS7A 2Y5QA 2BNHA 4IM6A 3ZYNA 3OJAB 4R6AA 4LSXC 2OMTA 4RCAB 1KOOA 2RR6A 3RGZA 1H6UA 4PKIG 5A5CA 2CA6A 3WPDA 1OOKG 1DFJI 3C6PB 2UZYA 3C6NB 3KJ4A 4XOSA 4Z61C 3BZ5A 2O6RA 2ELLA 4G8AA 2RA8A 4V2EA 2Z65A 3RIZA 4XSQA 2V9TB 2Z64A 5GS2B 4PSJA 4J4LA 1U0ND 2Z81A 4CILA 2A0ZA 4J0MA 3M18A 4YEBB 3E6JA 2OMVA
chains in the Genus database with same CATH superfamily
2Z7XB 4HQ1A 5IJBA 3E2JA 3GOZA 2BEXA 3A79B 3ZYIA 4EZGA 4P91A 1M10B 2P1PB 2P1NB 1DCEA 4AY9X 4ARRA 3O6NA 4QBZA 1FO1A 1ZIWA 1WWLA 3VQ1A 4NKGA 2Q4GW 3UN9A 3TSRE 4ECNA 3P72A 5AZ5A 4NKHA 3G39A 4Y61B 5IJCA 4AW4A 3ULAA 3DZEA 5AWBA 1XECA 2WFHA 4L3AA 2OMWA 3REZA 2O6QA 3G04C 1W8AA 2R9UA 3FXIA 3W3JA 2FT3A 1K5DC 2IFGA 4Z94G 2ASSB 4KT1A 5AWCA 4FDWA 3OGKB 4CC4C 4M7EC 1OTNA 5GS0A 4LXSA 4K17A 1FS2A 4GLPA 3WPIA 3WN4A 5CMPA 2OMZA 4H09A 1YRGA 4FMZA 4R5CA 2WQWA 4BSUA 2Z63A 4KXFB 4QXEA 2Z62A 3C6OB 5AWDA 1M9LA 3RJ0A 3G3AA 4Z79A 3ZYOA 1O6VA 3WPGA 3E4GA 1D0BA 4R0AA 5GMHA 1A9NA 4XGOA 2V70A 4NZRM 3W3KA 4MQWX 3WPEA 5AWAA 2ASTB 4TZHA 4FCGA 4V2CA 3CIYA 1FT8A 4R6JA 3M19A 2P1MB 5GMFA 3RFSA 2XWTC 4L3FA 1OGQA 1H6TA 3UL9A 4RCWA 4LSXA 3WPFA 4LSCA 2O6SA 3UL7A 4FD0A 5HZLB 1PGVA 1P8TA 4PEQB 1XWDC 2Z82A 4R6GA 3OJAA 4PQ8A 1O6SA 5FTTB 4QC0A 1K5GC 5B0TA 4R6FA 4LI2A 5LFNA 3RW7A 3E3ZA 3CIGA 1OTMA 2ID5A 5B0NA 4BSRA 4GT6A 3W3GA 1DS9A 4Z8GA 3RFJA 4BV4R 1A4YA 4NZTM 3RGXA 1KOHA 4Q3GA 4WYKA 3W3LA 2P1QB 2OMUA 4ARNA 4FHOA 4CP6A 5GMGA 2Z7XA 5GQRK 1O6TA 1SQ0B 2OMYA 3OGMB 2P1OB 3ULUA 3UL8A 2XOTA 1M0ZA 3RFEA 3CVRA 4LI1A 3G06A 4LSAA 5HDHA 4UFRA 3RW6A 3SB4A 5IJDA 4R58A 4R07A 4LXRA 3PMHG 4ECOA 1XEUA 4V2DA 2JE0A 1M9SA 1P8VA 3WPBA 4Q62A 2OMXA 4R08A 1P9AG 4RWTC 2WQVA 3WPCA 1LTXA 3O53A 5CMNA 3ULVA 4CNMA 4Q3IA 4Z64C 4OQTA 2WQXA 4R5DA 4KNGA 1FQVA 2JE1A 4CC4A 4U06A 4U09A 4C2AB 1XKUA 2Z66A 4M7EA 3JB9j 1XCDA 3WPHA 1OTOA 4I6JB 1GWBA 1JL5A 3OGLB 4WP6A 2JQDA 5IYXC 4R09A 5D3IA 4BSSA 5B4PA 1Z7XW 2WQUA 4C2BB 3W3NA 1G9UA 3W3MA 1OZNA 1IO0A 3ZYJA 4CNCA 4PERA 4U08A 4B8CD 2V9SA 4P8SA 4U7LA 4MN8B 3VQ2A 1QYYA 3G3BA 2UZXA 4FS7A 2Y5QA 2BNHA 4IM6A 3ZYNA 3OJAB 4R6AA 4LSXC 2OMTA 4RCAB 1KOOA 2RR6A 3RGZA 1H6UA 4PKIG 5A5CA 2CA6A 3WPDA 1OOKG 1DFJI 3C6PB 2UZYA 3C6NB 3KJ4A 4XOSA 4Z61C 3BZ5A 2O6RA 2ELLA 4G8AA 2RA8A 4V2EA 2Z65A 3RIZA 4XSQA 2V9TB 2Z64A 5GS2B 4PSJA 4J4LA 1U0ND 2Z81A 4CILA 2A0ZA 4J0MA 3M18A 4YEBB 3E6JA 2OMVA
chains in the Genus database with same CATH topology
2Z7XB 4HQ1A 5IJBA 3E2JA 3GOZA 2BEXA 3A79B 3ZYIA 4EZGA 4P91A 1M10B 2P1PB 2P1NB 1DCEA 4AY9X 4ARRA 3O6NA 4QBZA 1FO1A 1ZIWA 1WWLA 3VQ1A 4NKGA 2Q4GW 3UN9A 3TSRE 4ECNA 3P72A 5AZ5A 4NKHA 3G39A 4Y61B 5IJCA 4AW4A 3ULAA 3DZEA 5AWBA 1XECA 2WFHA 4L3AA 2OMWA 3REZA 2O6QA 3G04C 1W8AA 2R9UA 3FXIA 3W3JA 2FT3A 1K5DC 2IFGA 4Z94G 2ASSB 4KT1A 5AWCA 4FDWA 3OGKB 4CC4C 4M7EC 1OTNA 5GS0A 4LXSA 4K17A 1FS2A 4GLPA 3WPIA 3WN4A 5CMPA 2OMZA 4H09A 1YRGA 4FMZA 4R5CA 2WQWA 4BSUA 2Z63A 4KXFB 4QXEA 2Z62A 3C6OB 5AWDA 1M9LA 3RJ0A 3G3AA 4Z79A 3ZYOA 1O6VA 3WPGA 3E4GA 1D0BA 4R0AA 5GMHA 1A9NA 4XGOA 2V70A 3W3KA 4MQWX 3WPEA 5AWAA 2ASTB 4TZHA 4FCGA 4V2CA 3CIYA 1FT8A 4R6JA 3M19A 2P1MB 5GMFA 3RFSA 2XWTC 4L3FA 1OGQA 1H6TA 3UL9A 4RCWA 4LSXA 3WPFA 4LSCA 2O6SA 3UL7A 4FD0A 5HZLB 1PGVA 1P8TA 4PEQB 1XWDC 2Z82A 4R6GA 3OJAA 4PQ8A 1O6SA 5FTTB 4QC0A 1K5GC 5B0TA 4R6FA 4LI2A 5LFNA 3RW7A 3E3ZA 3CIGA 1OTMA 2ID5A 5B0NA 4BSRA 4GT6A 3W3GA 1DS9A 4Z8GA 3RFJA 4BV4R 1A4YA 3RGXA 1KOHA 4Q3GA 4WYKA 3W3LA 2P1QB 2OMUA 4ARNA 4FHOA 4CP6A 5GMGA 2Z7XA 5GQRK 1O6TA 1SQ0B 2OMYA 3OGMB 2P1OB 3ULUA 3UL8A 2XOTA 1M0ZA 3RFEA 3CVRA 4LI1A 3G06A 4LSAA 5HDHA 4UFRA 3RW6A 3SB4A 5IJDA 4R58A 4R07A 4LXRA 3PMHG 4ECOA 1XEUA 4V2DA 2JE0A 1M9SA 1P8VA 3WPBA 4Q62A 2OMXA 4R08A 1P9AG 4RWTC 2WQVA 3WPCA 1LTXA 3O53A 5CMNA 3ULVA 4CNMA 4Q3IA 4Z64C 4OQTA 2WQXA 4R5DA 4KNGA 1FQVA 2JE1A 4CC4A 4U06A 4U09A 4C2AB 1XKUA 2Z66A 4M7EA 3JB9j 1XCDA 3WPHA 1OTOA 4I6JB 1GWBA 1JL5A 3OGLB 4WP6A 2JQDA 5IYXC 4R09A 5D3IA 4BSSA 5B4PA 1Z7XW 2WQUA 4C2BB 3W3NA 1G9UA 3W3MA 1OZNA 1IO0A 3ZYJA 4CNCA 4PERA 4U08A 4B8CD 2V9SA 4P8SA 4U7LA 4MN8B 3VQ2A 1QYYA 3G3BA 2UZXA 4FS7A 2Y5QA 2BNHA 4IM6A 3ZYNA 3OJAB 4R6AA 4LSXC 2OMTA 4RCAB 1KOOA 2RR6A 3RGZA 1H6UA 4PKIG 5A5CA 2CA6A 3WPDA 1OOKG 1DFJI 3C6PB 2UZYA 3C6NB 3KJ4A 4XOSA 4Z61C 3BZ5A 2O6RA 2ELLA 4G8AA 2RA8A 4V2EA 2Z65A 3RIZA 4XSQA 2V9TB 2Z64A 5GS2B 4PSJA 4J4LA 1U0ND 2Z81A 4CILA 2A0ZA 4J0MA 3M18A 4YEBB 3E6JA 2OMVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z7X B;  4HQ1 A;  5IJB A;  3E2J A;  3GOZ A;  2BEX A;  3A79 B;  3ZYI A;  4EZG A;  4P91 A;  1M10 B;  2P1P B;  2P1N B;  1DCE A;  4AY9 X;  4ARR A;  3O6N A;  4QBZ A;  1FO1 A;  1ZIW A;  1WWL A;  3VQ1 A;  4NKG A;  2Q4G W;  3UN9 A;  3TSR E;  4ECN A;  3P72 A;  5AZ5 A;  4NKH A;  3G39 A;  4Y61 B;  5IJC A;  4AW4 A;  3ULA A;  3DZE A;  5AWB A;  1XEC A;  2WFH A;  4L3A A;  2OMW A;  3REZ A;  2O6Q A;  3G04 C;  1W8A A;  2R9U A;  3FXI A;  3W3J A;  2FT3 A;  1K5D C;  2IFG A;  4Z94 G;  2ASS B;  4KT1 A;  5AWC A;  4FDW A;  3OGK B;  4CC4 C;  4M7E C;  1OTN A;  5GS0 A;  4LXS A;  4K17 A;  1FS2 A;  4GLP A;  3WPI A;  3WN4 A;  5CMP A;  2OMZ A;  4H09 A;  1YRG A;  4FMZ A;  4R5C A;  2WQW A;  4BSU A;  2Z63 A;  4KXF B;  4QXE A;  2Z62 A;  3C6O B;  5AWD A;  1M9L A;  3RJ0 A;  3G3A A;  4Z79 A;  3ZYO A;  1O6V A;  3WPG A;  3E4G A;  1D0B A;  4R0A A;  5GMH A;  1A9N A;  4XGO A;  2V70 A;  3W3K A;  4MQW X;  3WPE A;  5AWA A;  2AST B;  4TZH A;  4FCG A;  4V2C A;  3CIY A;  1FT8 A;  4R6J A;  3M19 A;  2P1M B;  5GMF A;  3RFS A;  2XWT C;  4L3F A;  1OGQ A;  1H6T A;  3UL9 A;  4RCW A;  4LSX A;  3WPF A;  4LSC A;  2O6S A;  3UL7 A;  4FD0 A;  5HZL B;  1PGV A;  1P8T A;  4PEQ B;  1XWD C;  2Z82 A;  4R6G A;  3OJA A;  4PQ8 A;  1O6S A;  5FTT B;  4QC0 A;  1K5G C;  5B0T A;  4R6F A;  4LI2 A;  5LFN A;  3RW7 A;  3E3Z A;  3CIG A;  1OTM A;  2ID5 A;  5B0N A;  4BSR A;  4GT6 A;  3W3G A;  1DS9 A;  4Z8G A;  3RFJ A;  4BV4 R;  1A4Y A;  3RGX A;  1KOH A;  4Q3G A;  4WYK A;  3W3L A;  2P1Q B;  2OMU A;  4ARN A;  4FHO A;  4CP6 A;  5GMG A;  2Z7X A;  5GQR K;  1O6T A;  1SQ0 B;  2OMY A;  3OGM B;  2P1O B;  3ULU A;  3UL8 A;  2XOT A;  1M0Z A;  3RFE A;  3CVR A;  4LI1 A;  3G06 A;  4LSA A;  5HDH A;  4UFR A;  3RW6 A;  3SB4 A;  5IJD A;  4R58 A;  4R07 A;  4LXR A;  3PMH G;  4ECO A;  1XEU A;  4V2D A;  2JE0 A;  1M9S A;  1P8V A;  3WPB A;  4Q62 A;  2OMX A;  4R08 A;  1P9A G;  4RWT C;  2WQV A;  3WPC A;  1LTX A;  3O53 A;  5CMN A;  3ULV A;  4CNM A;  4Q3I A;  4Z64 C;  4OQT A;  2WQX A;  4R5D A;  4KNG A;  1FQV A;  2JE1 A;  4CC4 A;  4U06 A;  4U09 A;  4C2A B;  1XKU A;  2Z66 A;  4M7E A;  3JB9 j;  1XCD A;  3WPH A;  1OTO A;  4I6J B;  1GWB A;  1JL5 A;  3OGL B;  4WP6 A;  2JQD A;  5IYX C;  4R09 A;  5D3I A;  4BSS A;  5B4P A;  1Z7X W;  2WQU A;  4C2B B;  3W3N A;  1G9U A;  3W3M A;  1OZN A;  1IO0 A;  3ZYJ A;  4CNC A;  4PER A;  4U08 A;  4B8C D;  2V9S A;  4P8S A;  4U7L A;  4MN8 B;  3VQ2 A;  1QYY A;  3G3B A;  2UZX A;  4FS7 A;  2Y5Q A;  2BNH A;  4IM6 A;  3ZYN A;  3OJA B;  4R6A A;  4LSX C;  2OMT A;  4RCA B;  1KOO A;  2RR6 A;  3RGZ A;  1H6U A;  4PKI G;  5A5C A;  2CA6 A;  3WPD A;  1OOK G;  1DFJ I;  3C6P B;  2UZY A;  3C6N B;  3KJ4 A;  4XOS A;  4Z61 C;  3BZ5 A;  2O6R A;  2ELL A;  4G8A A;  2RA8 A;  4V2E A;  2Z65 A;  3RIZ A;  4XSQ A;  2V9T B;  2Z64 A;  5GS2 B;  4PSJ A;  4J4L A;  1U0N D;  2Z81 A;  4CIL A;  2A0Z A;  4J0M A;  3M18 A;  4YEB B;  3E6J A;  2OMV A; 
#chains in the Genus database with same CATH topology
 2Z7X B;  4HQ1 A;  5IJB A;  3E2J A;  3GOZ A;  2BEX A;  3A79 B;  3ZYI A;  4EZG A;  4P91 A;  1M10 B;  2P1P B;  2P1N B;  1DCE A;  4AY9 X;  4ARR A;  3O6N A;  4QBZ A;  1FO1 A;  1ZIW A;  1WWL A;  3VQ1 A;  4NKG A;  2Q4G W;  3UN9 A;  3TSR E;  4ECN A;  3P72 A;  5AZ5 A;  4NKH A;  3G39 A;  4Y61 B;  5IJC A;  4AW4 A;  3ULA A;  3DZE A;  5AWB A;  1XEC A;  2WFH A;  4L3A A;  2OMW A;  3REZ A;  2O6Q A;  3G04 C;  1W8A A;  2R9U A;  3FXI A;  3W3J A;  2FT3 A;  1K5D C;  2IFG A;  4Z94 G;  2ASS B;  4KT1 A;  5AWC A;  4FDW A;  3OGK B;  4CC4 C;  4M7E C;  1OTN A;  5GS0 A;  4LXS A;  4K17 A;  1FS2 A;  4GLP A;  3WPI A;  3WN4 A;  5CMP A;  2OMZ A;  4H09 A;  1YRG A;  4FMZ A;  4R5C A;  2WQW A;  4BSU A;  2Z63 A;  4KXF B;  4QXE A;  2Z62 A;  3C6O B;  5AWD A;  1M9L A;  3RJ0 A;  3G3A A;  4Z79 A;  3ZYO A;  1O6V A;  3WPG A;  3E4G A;  1D0B A;  4R0A A;  5GMH A;  1A9N A;  4XGO A;  2V70 A;  4NZR M;  3W3K A;  4MQW X;  3WPE A;  5AWA A;  2AST B;  4TZH A;  4FCG A;  4V2C A;  3CIY A;  1FT8 A;  4R6J A;  3M19 A;  2P1M B;  5GMF A;  3RFS A;  2XWT C;  4L3F A;  1OGQ A;  1H6T A;  3UL9 A;  4RCW A;  4LSX A;  3WPF A;  4LSC A;  2O6S A;  3UL7 A;  4FD0 A;  5HZL B;  1PGV A;  1P8T A;  4PEQ B;  1XWD C;  2Z82 A;  4R6G A;  3OJA A;  4PQ8 A;  1O6S A;  5FTT B;  4QC0 A;  1K5G C;  5B0T A;  4R6F A;  4LI2 A;  5LFN A;  3RW7 A;  3E3Z A;  3CIG A;  1OTM A;  2ID5 A;  5B0N A;  4BSR A;  4GT6 A;  3W3G A;  1DS9 A;  4Z8G A;  3RFJ A;  4BV4 R;  1A4Y A;  4NZT M;  3RGX A;  1KOH A;  4Q3G A;  4WYK A;  3W3L A;  2P1Q B;  2OMU A;  4ARN A;  4FHO A;  4CP6 A;  5GMG A;  2Z7X A;  5GQR K;  1O6T A;  1SQ0 B;  2OMY A;  3OGM B;  2P1O B;  3ULU A;  3UL8 A;  2XOT A;  1M0Z A;  3RFE A;  3CVR A;  4LI1 A;  3G06 A;  4LSA A;  5HDH A;  4UFR A;  3RW6 A;  3SB4 A;  5IJD A;  4R58 A;  4R07 A;  4LXR A;  3PMH G;  4ECO A;  1XEU A;  4V2D A;  2JE0 A;  1M9S A;  1P8V A;  3WPB A;  4Q62 A;  2OMX A;  4R08 A;  1P9A G;  4RWT C;  2WQV A;  3WPC A;  1LTX A;  3O53 A;  5CMN A;  3ULV A;  4CNM A;  4Q3I A;  4Z64 C;  4OQT A;  2WQX A;  4R5D A;  4KNG A;  1FQV A;  2JE1 A;  4CC4 A;  4U06 A;  4U09 A;  4C2A B;  1XKU A;  2Z66 A;  4M7E A;  3JB9 j;  1XCD A;  3WPH A;  1OTO A;  4I6J B;  1GWB A;  1JL5 A;  3OGL B;  4WP6 A;  2JQD A;  5IYX C;  4R09 A;  5D3I A;  4BSS A;  5B4P A;  1Z7X W;  2WQU A;  4C2B B;  3W3N A;  1G9U A;  3W3M A;  1OZN A;  1IO0 A;  3ZYJ A;  4CNC A;  4PER A;  4U08 A;  4B8C D;  2V9S A;  4P8S A;  4U7L A;  4MN8 B;  3VQ2 A;  1QYY A;  3G3B A;  2UZX A;  4FS7 A;  2Y5Q A;  2BNH A;  4IM6 A;  3ZYN A;  3OJA B;  4R6A A;  4LSX C;  2OMT A;  4RCA B;  1KOO A;  2RR6 A;  3RGZ A;  1H6U A;  4PKI G;  5A5C A;  2CA6 A;  3WPD A;  1OOK G;  1DFJ I;  3C6P B;  2UZY A;  3C6N B;  3KJ4 A;  4XOS A;  4Z61 C;  3BZ5 A;  2O6R A;  2ELL A;  4G8A A;  2RA8 A;  4V2E A;  2Z65 A;  3RIZ A;  4XSQ A;  2V9T B;  2Z64 A;  5GS2 B;  4PSJ A;  4J4L A;  1U0N D;  2Z81 A;  4CIL A;  2A0Z A;  4J0M A;  3M18 A;  4YEB B;  3E6J A;  2OMV A; 
#chains in the Genus database with same CATH homology
 2Z7X B;  4HQ1 A;  5IJB A;  3E2J A;  3GOZ A;  2BEX A;  3A79 B;  3ZYI A;  4EZG A;  4P91 A;  1M10 B;  2P1P B;  2P1N B;  1DCE A;  4AY9 X;  4ARR A;  3O6N A;  4QBZ A;  1FO1 A;  1ZIW A;  1WWL A;  3VQ1 A;  4NKG A;  2Q4G W;  3UN9 A;  3TSR E;  4ECN A;  3P72 A;  5AZ5 A;  4NKH A;  3G39 A;  4Y61 B;  5IJC A;  4AW4 A;  3ULA A;  3DZE A;  5AWB A;  1XEC A;  2WFH A;  4L3A A;  2OMW A;  3REZ A;  2O6Q A;  3G04 C;  1W8A A;  2R9U A;  3FXI A;  3W3J A;  2FT3 A;  1K5D C;  2IFG A;  4Z94 G;  2ASS B;  4KT1 A;  5AWC A;  4FDW A;  3OGK B;  4CC4 C;  4M7E C;  1OTN A;  5GS0 A;  4LXS A;  4K17 A;  1FS2 A;  4GLP A;  3WPI A;  3WN4 A;  5CMP A;  2OMZ A;  4H09 A;  1YRG A;  4FMZ A;  4R5C A;  2WQW A;  4BSU A;  2Z63 A;  4KXF B;  4QXE A;  2Z62 A;  3C6O B;  5AWD A;  1M9L A;  3RJ0 A;  3G3A A;  4Z79 A;  3ZYO A;  1O6V A;  3WPG A;  3E4G A;  1D0B A;  4R0A A;  5GMH A;  1A9N A;  4XGO A;  2V70 A;  3W3K A;  4MQW X;  3WPE A;  5AWA A;  2AST B;  4TZH A;  4FCG A;  4V2C A;  3CIY A;  1FT8 A;  4R6J A;  3M19 A;  2P1M B;  5GMF A;  3RFS A;  2XWT C;  4L3F A;  1OGQ A;  1H6T A;  3UL9 A;  4RCW A;  4LSX A;  3WPF A;  4LSC A;  2O6S A;  3UL7 A;  4FD0 A;  5HZL B;  1PGV A;  1P8T A;  4PEQ B;  1XWD C;  2Z82 A;  4R6G A;  3OJA A;  4PQ8 A;  1O6S A;  5FTT B;  4QC0 A;  1K5G C;  5B0T A;  4R6F A;  4LI2 A;  5LFN A;  3RW7 A;  3E3Z A;  3CIG A;  1OTM A;  2ID5 A;  5B0N A;  4BSR A;  4GT6 A;  3W3G A;  1DS9 A;  4Z8G A;  3RFJ A;  4BV4 R;  1A4Y A;  3RGX A;  1KOH A;  4Q3G A;  4WYK A;  3W3L A;  2P1Q B;  2OMU A;  4ARN A;  4FHO A;  4CP6 A;  5GMG A;  2Z7X A;  5GQR K;  1O6T A;  1SQ0 B;  2OMY A;  3OGM B;  2P1O B;  3ULU A;  3UL8 A;  2XOT A;  1M0Z A;  3RFE A;  3CVR A;  4LI1 A;  3G06 A;  4LSA A;  5HDH A;  4UFR A;  3RW6 A;  3SB4 A;  5IJD A;  4R58 A;  4R07 A;  4LXR A;  3PMH G;  4ECO A;  1XEU A;  4V2D A;  2JE0 A;  1M9S A;  1P8V A;  3WPB A;  4Q62 A;  2OMX A;  4R08 A;  1P9A G;  4RWT C;  2WQV A;  3WPC A;  1LTX A;  3O53 A;  5CMN A;  3ULV A;  4CNM A;  4Q3I A;  4Z64 C;  4OQT A;  2WQX A;  4R5D A;  4KNG A;  1FQV A;  2JE1 A;  4CC4 A;  4U06 A;  4U09 A;  4C2A B;  1XKU A;  2Z66 A;  4M7E A;  3JB9 j;  1XCD A;  3WPH A;  1OTO A;  4I6J B;  1GWB A;  1JL5 A;  3OGL B;  4WP6 A;  2JQD A;  5IYX C;  4R09 A;  5D3I A;  4BSS A;  5B4P A;  1Z7X W;  2WQU A;  4C2B B;  3W3N A;  1G9U A;  3W3M A;  1OZN A;  1IO0 A;  3ZYJ A;  4CNC A;  4PER A;  4U08 A;  4B8C D;  2V9S A;  4P8S A;  4U7L A;  4MN8 B;  3VQ2 A;  1QYY A;  3G3B A;  2UZX A;  4FS7 A;  2Y5Q A;  2BNH A;  4IM6 A;  3ZYN A;  3OJA B;  4R6A A;  4LSX C;  2OMT A;  4RCA B;  1KOO A;  2RR6 A;  3RGZ A;  1H6U A;  4PKI G;  5A5C A;  2CA6 A;  3WPD A;  1OOK G;  1DFJ I;  3C6P B;  2UZY A;  3C6N B;  3KJ4 A;  4XOS A;  4Z61 C;  3BZ5 A;  2O6R A;  2ELL A;  4G8A A;  2RA8 A;  4V2E A;  2Z65 A;  3RIZ A;  4XSQ A;  2V9T B;  2Z64 A;  5GS2 B;  4PSJ A;  4J4L A;  1U0N D;  2Z81 A;  4CIL A;  2A0Z A;  4J0M A;  3M18 A;  4YEB B;  3E6J A;  2OMV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...