1XX1A

Structural basis for ion-coordination and the catalytic mechanism of sphingomyelinases d
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
285
structure length
285
Chain Sequence
ADNRRPIWNLAHMVNAVAQIPDFLDLGANALEADVTFKGSVPTYTYHGTPCDFGRDCIRWEYFNVFLKTLREYTTPGNAKYRDGFILFVLDLKTGSLSNDQVRPAGENVAKELLQNYWNNGNNGGRAYVVLSLPDIGHYEFVRGFKEVLKKEGHEDLLEKVGYDFSGPYLPSLPTLDATHEAYKKAGVDGHIWLSDGLTNFSPLGDMARLKEAIKSRDSANGFINKIYYWSVDKVSTTKAALDVGVDGIMTNYPNVLIGVLKESGYNDKYRLATYDDNPWETFKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sphingomyelinase I
publication title Structural basis for metal ion coordination and the catalytic mechanism of sphingomyelinases d
pubmed doi rcsb
source organism Loxosceles laeta
molecule tags Hydrolase
total genus 98
structure length 285
sequence length 285
chains with identical sequence B, C, D
ec nomenclature ec 3.1.4.4: Phospholipase D.
pdb deposition date 2004-11-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 1xx1A00
2OTDA 4GNKB 4I8YA 3QVQA 6PTDA 4PTDA 3EA3A 1XX1A 2P76A 4Q6XA 3MZ2A 3I10A 7PTDA 1DJWA 2PZ0A 3RLHA 3NO3A 4I9TA 2F9RA 3CH0A 1V8EA 1QASA 4RV3A 2ISDA 1DJGA 3EA2A 1DJXA 1QATA 2OOGA 3L12A 1PTDA 3OHMB 5T9BG 4RW3A 4I90A 4I9MA 3V16A 4F2BA 4OECA 4RW5A 1ZCCA 1VD6A 1DJYA 3KS6A 1AODA 1DJZA 5T9CE 3PTDA 3QR0A 3QR1A 2ZKMX 1GYMA 3H4WA 1T6MA 3V1HA 1T8QA 4QJ5B 4I9JA 1O1ZA 2FJUB 4QJ4B 3EA1A 4QJ3B 4F2TA 4R7OA 3RLGA 4F2UA 1DJIA 2PTDA 3KS5A 1PTGA 3V18A 5T91A 1YDYA 3H4XA 2PLCA 2O55A 5PTDA 1DJHA 4S3GA 2OR2A
chains in the Genus database with same CATH superfamily
4ZB5A 3PVFA 3DUGA 1ZALA 1A5KC 4CNSA 2Z1VA 4ML9A 4AY8A 2ASHA 4GMEA 4TUFA 1CGWA 3QM3A 1F07A 2AOSA 4J3TA 3EOUA 3NTYA 2FGZA 2XZ7A 4N9CA 1ELSA 3RG6A 3VUSA 1OCJA 3W7RA 3COTA 4D6CA 3ENLA 2NLIA 1GOKA 4N0RA 1NDWA 4HJWA 3EGJA 3UR8A 3SCNA 3DHUA 4Y8EA 4FLQA 2A85A 2W27A 3DESA 3E0VA 1C8VA 3QLDA 1I2RA 5HBFA 2D3LA 3OO2A 3SURA 4M7TA 1PV8A 1UR9A 4HZ7A 1PCWA 1RHCA 2WVVB 4GKLA 2UV8G 1V3IA 4L6DA 2W66A 1KM0A 2AGTA 4KMQA 3VXGA 1M7JA 4U2ZA 3CIWA 4JY8A 5I2UA 4XBJA 2ZVRA 1I4NA 1UZ1A 2DT0A 4LQ1A 5CPLA 4D8ZA 1J2WA 1KM5A 4B5SA 3CTTA 4MZ1A 4NNBA 3OPSA 4ZZ9A 2ALRA 2Z6JA 4V2XA 4MY8A 3SW6A 4EE9A 2YX0A 3FN9A 2Q01A 1BFNA 3EDJA 3PJTA 5BOEA 1QI0A 4PMZA 4RE3A 2BP1A 4FF5A 3APYA 5FSEC 3O1NA 1HN1A 1IEXA 2ZZ6A 4MYAA 5JMUA 4DZ5A 4A22A 4IP4A 1EPXA 3OBKA 3VCNA 1E0UA 1MRAA 2XGZA 1JUEA 3AIEA 1W3KA 4A8NA 1W5MA 4GC4A 4HCLA 3DYPA 2WVUA 3T05A 4UTIA 2PE4A 3NSXA 4C65A 2DPEA 1QHPA 4J3VA 3PBUA 3V16A 1E6QM 4LRTA 5C7VA 1MYRA 2OLSA 3V75A 2GDQA 2GL5A 4LBUA 1GG0A 5EMLA 2ZZ3A 4NI3A 4G1KA 1S3TC 3VGBA 4O16A 2R9RA 3A3WA 4BJHA 2VQTA 2JFEX 3H4WA 3MMWA 1UZDA 2XVPA 1FRBA 3OQEA 4ZOCA 3IV3A 4MGGA 5K9CA 4Y7EA 3PHAA 3MWAA 1MQPA 3OIHA 1DJIA 2PTDA 2JGQA 4WXZA 1E71M 1E6NA 3PJXA 3MCNA 2E1DA 3LERA 1YNYA 1H41A 3BMWA 1W3JA 1OFPA 3EWBX 1ZS2A 3FEMA 1V6WA 3AMKA 1LUCB 1M7PA 4F0HA 2I9UA 4B4FA 1T99A 4O53A 5AVNA 1B1YA 2RGLA 4P8VA 3IVSA 1W5PA 3W82A 3AMDA 2W5FA 2OCZA 3NVTA 3WD3A 4ZCWA 2HSAA 3W6LA 5A6BD 3VABA 2NXGA 4O28A 1HG3A 5AYIA 3RMJA 3EDDA 3T8LA 2CZ5A 1LL7A 2DZTA 1U2YA 4XX6A 3N6HA 1CLKA 3QPZA 1FX6A 1KTNA 3RGTA 1NTHA 5FEWA 3T78A 1M03A 3W85A 3N25A 2XTKA 1EQPA 3BLKA 3EX1A 2PF8A 3GXTA 1W3NA 3CO4A 1B9BA 3I4KA 4X60A 1NSJA 4AZHA 2J6VA 4BQ4A 4RXGA 5F1VA 4LVBA 1HO4A 3XIMA 4AZ7A 2BOEX 1CB2A 3KZSA 1F8MA 3EA1A 4FAMA 2YKKA 2BY0A 3GDBA 4CKQA 1B3VA 3FAXA 4JHOA 3M0MA 4LUTA 5HQEA 3BARA 1VGAA 3TSMA 2CNCA 3HQ1A 4UTLA 3RMEA 3TAKA 3GRIA 4Y96A 2ZA1A 1DIKA 1JVNA 3TTQA 4GYPA 1UUMA 2OX4A 2X1UA 2BHZA 4IMEA 1UMYA 1ZLPA 3L2IA 4QS5A 4C6LA 4RDZA 2WLZA 1OCBA 3ANVA 4Q6JA 2WMHA 3UD6A 4DF1A 3BGJA 2NQLA 1XIGA 1V7YA 5D9PA 1JPIA 2C1GA 1V3LA 2XN1A 1WA3A 2X1SA 3NIYA 3UY8A 2WSQA 3IARA 2FGBA 3C86A 2WC4A 1H49A 3ZS4A 1E4MM 2OG9A 1S38A 3M9YA 2Y1HA 3UNTA 3APGA 3A5FA 2F2KA 3C4UA 3U7BA 4TX9A 3K8LA 1NP2A 2ZUTA 4ECLA 1G9HA 1I1WA 4ZSTA 4JTAA 1Y5XA 3TFCA 4RCXA 1X38A 4LALA 1T8QA 2IS7A 2MUCA 4LPCA 3ZQ9A 3EDKA 3GW0A 3BGGA 1EJWC 1XH1A 1SFSA 4RXFA 4XG1A 3W86A 1TMHA 1W3TA 3ABRA 4O50A 2VEPA 3GDRA 3VX1A 4NIRA 1DORA 3BSHA 3H70A 3VKBA 2WB5A 1OFEA 4GYJA 5BW6A 1RBAA 3G8EA 3ZVHB 4XZNX 3II1A 1LL6A 3PTKA 3UPMA 2PDWA 1M5WA 1KCXA 5C71A 3WG6A 3PUGA 4U28A 2PP0A 3N13A 1UASA 4DYJA 3T1GA 2WMIB 2X1RA 4Z1BA 2VR5A 3DI1A 4J27A 2CKSA 2VGIA 1R3SA 3ARZA 3CL7A 2ZX9A 3V36A 4L1GA 1FA2A 1M01A 5G2IA 3SSZA 2HEJA 4HVXA 1AK5A 3WUBA 5JUVA 1LRQA 2Z4GA 2QUMA 2WNQA 3GKAA 3H2OA 3CUHA 2PBGA 1RA5A 1KBJA 4G7FA 4GYPC 3ERPA 1IXPA 1L8PA 1L6FA 1P6WA 3QZAA 3IK4A 2G5WA 1LLWA 3EYPA 4AX7A 1NH6A 2C79A 3CMGA 5EBUA 3PWGA 3FIGA 3T0DA 2R94A 3TAOA 2QCCA 1EYEA 1RCOB 4JY9A 3BLEA 1DQXA 3GFYA 1PTGA 5CC7A 3LXBA 4ADTA 1MNSA 4RV8A 2V6AA 3MUAA 8RUCA 4TV5A 4JFSA 3MKCA 5PTDA 4TIMA 4LVGA 3WLKX 3JZEA 1HZYA 3SN1A 3AAMA 3GXNA 2AMXA 3QVQA 1EJUC 1O5XA 3SAZA 3TONA 4NF7A 3NFUA 3TOPA 4BI7A 1P0EA 2V8ZA 3T2PA 3VD9A 1IXNA 4PRTA 1GJUA 3K4WA 2QCGA 2RDUA 3OBAA 1Y0EA 2IQ0A 1EJ7L 5G5IA 5H8UA 3REQB 1A50A 3UCCA 4YNGA 3O2LA 4PZVA 1OG0A 3V3WA 4Q8WA 3TXZA 4NI8A 3AHYA 1BTCA 2ZTKA 3NQEA 4O1AA 1FUYA 4JZ5A 1N8IA 1DE5A 1TZ9A 1PTDA 3QV6A 3OB8A 4PULA 3OHMB 2TODA 3CT7A 8XIAA 2HRWA 3B8UA 5CC3A 4ZQMA 3DECA 3PB2A 1FOBA 1ECQA 2XN0A 1RY8A 4DWSA 5A6KA 3DDMA 1Z9AA 2NQHA 4MPQA 5A8GA 1HUVA 2BGNE 2YFNA 3U7VA 1J0KA 4H19A 1MI3A 3PY2A 5FAGA 3EWDA 6A3HA 4WVXA 1B3YA 1B4KA 1FXQA 5HWNA 1RPXA 1W9PA 4DJFD 4RK8A 4DWDA 1P7TB 4J9JA 2HCVA 3FCPA 1GPFA 2Y89A 3PPFA 1FWAC 4JYDA 3CMJA 3U2CA 3CV1A 4ERIA 5T91A 5GJNA 4ICMA 1QPRA 4FF7A 4JHZA 4DF2A 1UKSA 2RDXA 4I7UA 3C2RA 4Z2IA 1EUAA 3BZJA 2NUWA 3G0SA 2WHLA 1BAGA 4A6GA 2PB1A 1SFTA 4E6MA 1CNVA 2PURA 1H2JA 3IGUA 3GTIA 3HG2A 5F2GA 5A69A 1SVDA 4KQNA 2PZ0A 4AW7A 2XJ7A 3UT0A 3WL0A 1K03A 4AY7A 3S5SA 6CGTA 2FMNA 3AS3A 3WLOA 4UTWA 3NDOA 2VZSA 1KFEA 3CHDA 4K8EA 3OIXA 5C7HA 4FR1A 4M5PA 1E0TA 1K4HA 3RO8A 2POZA 4CNOA 3W1UA 3CGTA 1LBMA 3MU7A 4TVDA 3O63A 1OIMA 4PFHA 2D20A 1G4PA 1HKWA 2WZTA 3W22A 3NQVA 2XIIA 4NJHA 5HATA 3GG0A 3WF4A 5K9DA 3AO0A 1PAMA 1X6LA 4P8XA 3NQ8A 5K9XA 1K7XA 2CBVA 3W7LA 3NURA 1E4NA 4DO7A 2B4GA 4DF0A 3BAIA 1PB0A 1JZ7A 1KB3A 5A8QA 3LB0A 1U30A 5C2CA 1Q13A 3H26A 4QE5A 4H2CA 1AMKA 2HVMA 4GINA 1H0IA 3IJDA 1MSSA 2HE5A 3M44A 3VNKA 4ERGA 2J7HA 1W9DM 2C13A 4DB7A 4IG2B 3MUZ1 1B9ZA 1TB3A 2BNJA 2UZ9A 2DIJA 4HK6A 1W3LA 1E9LA 4JTKA 2BXVA 4PUDA 4Q3MA 1ITQA 3RPTA 3PB0A 2GGJA 1OSEA 4FMVA 4XTDA 1F4HA 1VP5A 3L4TA 1MQRA 1QI3A 2BHYA 4OVXA 3BAWA 4MSSA 3QR3A 4W7UA 1GOWA 1T5AA 1JZ3A 3WF1A 3VDGA 3VA8A 2Y63A 5LHFA 3TYEA 3VNDA 4HMDA 3VIKA 3U8GA 1THFD 1AFSA 4H2HA 2A6NA 4HHLA 1EOMA 2WCSA 1ZCCA 3AC0A 4PMUA 2D23A 4RL3A 1DJYA 2FPTA 5C8BB 3N11A 5GNXA 4LCSA 1VBHA 2ZIDA 1AODA 3NYZA 4NILA 1XG4A 4GIYA 2RUSA 2VGGA 2GUUA 3G1AA 3P7YA 3FGCA 3TNBA 4AFYA 4CD7A 1LM1A 1TREA 4IP7A 3T2OA 1XINA 4IX0A 2W79A 3LCGA 1XIEA 3H24A 4Q4KA 4LV9A 2VZVA 1JNEA 1F3XA 1TWDA 2F8QA 2Q09A 4DUXA 2CLEA 3M5YA 3FY1A 1YX1A 3N2OA 4W93A 4XKYA 5EU9A 4GVIA 1CGTA 4UR9A 1GVOA 3C2VA 4UTWC 2E09A 4S3FA 2NXIA 2O4MA 2ZCGA 4WX2A 2YDSA 1KGUA 1BRLB 1EKOA 9XIAA 1TFVA 2OVLA 3B0XA 3B0UX 1WP6A 3H7UA 4JBRA 4W7VA 4ZO9A 1KFWA 1S39A 2C1HA 4E2VA 3HJEA 2VUYA 4OFCA 1AQHA 3GR8A 4H7VA 5D9OA 1IWPA 3AIWA 4X9SA 3VMPA 2NLYA 4UMBA 1KLZA 5IDIA 3UA4A 1QCWA 1KFLA 1OFBA 2BODX 1IEQA 4HOZA 1I0BA 4ZMGA 4PSRA 5DMLA 1CPUA 1SO3A 3W0KA 1A3HA 3L5MA 1LG2A 3CBWA 3QY6A 4YHEA 4QG6A 5CPOA 4DAFA 4Q8OA 4DUWA 1IT8A 3I3BA 5FF7A 1Z3NA 4P2VA 2VCCA 4QEEA 1D7KA 3W07A 3N6JA 1PXGA 4H04A 4R7OA 2JEPA 4PCPA 4E4FA 4DN1A 3DFTA 2CXEA 4IPNB 3S42A 3O8AA 1D2KA 1IIGA 3F4VA 4JIEA 4NAFB 4LUYA 5HK4A 1E0VA 1AQMA 1Q8JA 2HNHA 2WPGA 3ZLFA 4MJ2A 5KZMA 3AIUA 1H5YA 3OHIA 4F8XA 2VC9A 1F9CA 2VCAA 4KEVA 1WE5A 3ID7A 1SO6A 3FXGA 4GA8A 3NSNA 4JTUA 4YS1A 1YBQB 4DLMA 3L4ZA 3WDHA 1H7XA 2E9BA 3P81A 1WDSA 4G7EA 3SIMA 1G4EA 2QCMA 1SU5A 3L23A 3QV8A 3S6TA 4GY0A 3QTGA 4H8VA 2Y7FA 4GUJA 3RCYA 3I7RA 4LUIA 4X9YA 3ANUA 4X0NA 3Q4DA 4FOKA 4S2CA 2DW6A 1R38A 3VI2A 4R7WA 1OFQA 1R6WA 3M5VA 3WMCA 3BZGA 4OT7A 1MUMA 3ECQA 1C8YA 5HPCA 1VFLA 1QAPA 2V2CA 3GG7A 3HG4A 4O14A 4UFKA 1XR2A 2QGYA 1IE7C 1S1RA 1XDMA 1BKHA 3NQGA 2FB2A 4HPGA 1MW3A 3GVWA 3I3DA 3JRKA 5TIMA 3B8SA 2QR6A 3P0WA 2P10A 1GVSA 4YVXA 4F2UA 1RBOB 5BCAA 1VFUA 1ZNNA 5H1WA 3E74A 3GVRA 2B7PA 4DQWA 4ATLA 4KCVA 4KS0A 5GPRA 4I7WA 5HNNA 4AIOA 3PBYA 4AD1A 5F7UA 2OODA 2Y4SA 4FSAA 1WXZA 2VM8A 3A4JA 2OZ0A 1VCGA 3N18A 3GTHA 1VQTA 4CN1A 3FS2A 4B5VA 4GIRA 2PRLA 5FEZA 4GE8A 1JULA 3SSJA 4DJDA 2V5CA 4NNAA 1EDTA 4JFTA 3HTWA 4DY1A 3UF9A 4P7QA 1PO9A 3V0TA 4FX7A 1MDLA 2J4GA 3DX5A 3T08A 4HKPA 3LK6A 3DGBA 4O18A 1B3XA 3W7NA 2NV9A 3LU2A 4GC3A 3GTFA 3T8QA 1BYAA 1RV8A 2PWGA 2QJHA 4CNUA 1GONA 5T9BG 1UOZA 4PCNA 3T07A 4HU4A 3NZGA 2XM1A 2F6KA 3JZUA 3W28A 1UMLA 4J5NA 3NM3A 5E93A 2OYMA 4WLCA 1YDOA 4QSHA 3GNOA 4J2PA 3DOPA 3E02A 1KTCA 2YSWA 5I23A 1ML1A 4B16A 2GUBA 2WMGA 3TW6A 1D3GA 3W83A 1ZBKA 5IXEA 3L0NA 1W6TA 2QCEA 4XD4A 2Z7GA 4JTSA 3QBUA 4O11A 5DMYA 3N17A 3H4GA 3PNUA 4LFYA 4C6CA 3ZZ1A 1NOFA 1FWBC 1LYXA 1RH9A 1VBJA 2C19A 4OOUA 4KEUA 2J9XA 1VYRA 4EK7A 1Z8AA 4DYEA 4HZMA 4GJ1A 4EWJA 1BTMA 2E5BA 2ZDSA 4L4MA 2FVKA 1QW7A 1REQB 4C1LA 1YXYA 2C16A 1C93A 4AMCA 2VGBA 4J35A 3QHNA 1TIMA 3NCOA 1ZL1A 1UB3A 2P0OA 1UR2A 2VT0A 3WDIA 2V5DA 1BLIA 1UIOA 3T55A 3O0FA 3CQHA 1V5XA 4LW7A 1L2QA 4A3RA 2A1YA 1Y5WA 4U3AA 4IJRA 1I2PA 3QQWA 1V3JA 2E28A 1NAL1 4W4QA 1OF6A 3WQEA 1W5NA 1XCXA 1ZBVA 2OEMA 3PBVA 2ZRVA 1XJBA 3N34A 5EMMA 1O60A 4E5TA 1Y8BA 4KF1A 2WQPA 4YXGA 3SFWA 1DJQA 1XBZA 4PODA 2VUNA 3EX6A 5FL1A 4Y9PA 2AQWA 3GR4A 3Q58A 4ZO6A 3GXDA 1FCVA 3CMFA 3A12A 3PPCA 1GHSA 4DM1A 3ITCA 5M5DA 3WQDA 5CPMA 4HNNA 4HK5A 1O6IA 3HPAA 2GQ8A 3H2NA 3STCA 3T0TA 3TMLA 3VIGA 1T7LA 1W37A 4M6UA 3WQ6A 3FFSA 5D9MA 3ZYZA 1O1HA 3CEPA 1RD6A 3WJSA 4GHRA 3LGGA 3H2AA 2HV5A 3G1VA 1DQUA 2YXGA 1S2WA 3GG1A 3GUGA 1HP4A 2J74A 1R30A 1JZ4A 5KSWA 2GSEA 4MJ4A 2PDFA 2VQUA 1FP8A 3KHDA 4JTDA 3VCCA 3NL5A 3PBMA 3LS9A 4NASA 3CZKA 1YNQA 4S3KA 5KZDA 4MKSA 2VGFA 2YGYA 1EP3A 5BXRA 1L8NA 2HVNA 1M65A 3L21A 1E70M 3BMXA 3IPWA 3MT1A 4AZ6A 1L6SA 3IRDA 3WD0A 3E0LA 7A3HA 1RALA 1XS2A 4Q8NA 5FD0A 4EF9A 4EVZA 2H9AB 4HT3A 3ANYA 4KFNA 2GJXB 2HE8A 3PR2A 4RDYA 3W2UA 2E7FA 1TZZA 1QTWA 4W8BA 4GXMA 1B4EA 3AMLA 3UNDA 3NR0A 3RR1A 1AVAA 3RNDA 1BWVA 4C91A 2EKCA 3W76A 1ZGDA 2G8ZA 3HG5A 2RDTA 5EYWA 2TMDA 1B2YA 1E1CB 2BWGA 3WEOA 1B90A 3WUFA 2XH4A 4UTHA 4QJ1A 3VM5A 2VVSA 3SY5A 3N3MA 1OK4A 2C1IA 4M6VA 1RAKA 4UZUA 1BWLA 4AZ5A 2VOMA 3WLIA 1J5TA 1O68A 3CZLA 1CCWB 2UY3A 1JD9A 3WK2A 1JCTA 2GDUA 1SZFA 2OX1A 1KKOA 1IT7A 4U3CA 1FWDC 2DZAA 2DH2A 1S5NA 2CFFA 4RNHA 1PWMA 1J5SA 3TWAA 2ZX6A 2PDCA 3WQPA 2AGKA 2A7NA 1BHGA 2ABAA 2I9EA 3FV9A 1NDZA 4H4IA 2W6RA 3V1PA 1LQAA 3W2MA 3Q94A 2FZMA 5A6TC 4UFIA 1TRIA 1DWAM 1HNYA 2DIKA 1VFOA 1B57A 3WSUA 4DZHA 4J3WA 3T44A 1QI4A 4PUEA 5G4HC 4EX4A 2PC4A 4K1WA 1A5UA 3EKZA 4FK9A 4CVUA 3HFTA 1YDNA 3IWPA 3VIMA 5BU9A 2CZVA 1HL2A 3VNLA 2QAPA 1GW9A 4E4UA 4O8RA 4EAYA 3QW3A 4D72A 2D0HA 3LM3A 2GSJA 2V68A 4AYSA 3CHEA 3KUMA 2YW3A 4F0MA 4GOAA 3ITVA 2OEKA 3NVDA 4ZA0A 5TNVA 3WBYA 3QLLA 1S2UA 3PSVA 5GNYA 2JIEA 2GOUA 2HXTA 4YLWA 4XVEA 1A5OC 1SR0A 4BQ2A 3NPWA 2GVJA 2VKZG 2OWXA 1MEWA 9XIMA 1QNOA 1NFGA 4M51A 1UQYA 2OXNA 3FNDA 3W25A 4NHVA 2CLMA 3MHFA 2J9YA 5AC6A 3FHQA 1TVPA 2EG7A 2CCRA 5TAOA 3C52A 2Y24A 3HPSA 3S8HA 4WRHA 1WKEA 4CLMA 3FYPA 1TSIA 4IHCA 3HA1A 3L2LA 2PDIA 4JGDA 3MJMA 4H6KA 4UNKA 2PRMA 4YYFA 2TPSA 3FVDA 3VCRA 4GXWA 1PPIA 3BXWA 4B15A 4H9MA 3B0VC 3VD3A 4JTEA 2AL1A 3SRFA 4Z42C 2PDYA 4LC8A 1CXIA 1JL8A 4I9AA 4LYKA 2BX7A 4UB9A 4JN6A 2RHGA 3RITA 2WNZA 2C71A 4GBUA 2BBFA 2FJKA 1VR6A 3A9IA 1OK6A 3MMUA 4PL1A 3SEPA 2VURA 4PE8A 4EAMA 3GFZA 5GQBA 1PCKA 4OJYA 3W84A 2RAGA 1QBAA 1C9WA 4WHBA 4WIWA 1AJ0A 5LIKX 3SGZA 1DE6A 4QISA 4AG0A 3BTNA 2WSKA 1JZ8A 2GSHA 2GVYA 3LTYA 3H7VA 4CQBA 3WMBA 2VD8A 4BHYA 4QQUA 1KW1A 3MUIA 3MCMA 3V18A 2GWGA 3B4UA 1UR3M 3N2BA 4HNUA 3KRZA 1BF2A 2Y8UA 1ZBWA 1TWSA 3GIQA 4J3ZA 4NZ1A 4DJEA 4FNTA 2YOCA 3R94A 1C90A 3NOYA 1G67A 3UCDA 4AC1X 2DVUA 4A2SA 1FTXA 3GC4A 5TD4A 2BG5A 1LT8A 3W29A 3S46A 1DKWA 4JX4A 2REQB 3UYCA 2VX6A 5I3KA 4REQA 5F1UA 4O4VA 4LS0A 1J01A 4ZFMA 4BQ3A 4PUNA 2P50A 1QBBA 2W3ZA 1ZB5A 3LHWA 1OT2A 4JL1A 1TVLA 4Q8TA 2BOGX 1CGUA 2ACRA 2XG9A 4KRTA 3ONBA 1UR4A 3K1DA 4DPPA 3TP4A 2XIBA 3OVPA 3W4RA 2BASA 2WPBA 5A6LA 3ZLHA 4PFMA 1IEIA 4ACYA 1XLAA 5EKYA 2VEIA 1HT6A 2R1NA 4N6FA 2J7CA 4WUIA 1XW8A 4DBDA 4H41A 2YLAA 4LU0A 3FHAA 3W7KA 3A4XA 3F5JA 5HPOA 3MV11 2GLKA 5CGMA 3TROA 2YCJA 3A6OA 1OD8A 2EKGA 3T81A 1ITCA 1PUDA 1P0BA 3HJZA 4D8AA 1DIDA 2G96A 3MANA 4UTFA 2R1PA 4X63A 1KWGA 3RAOA 4GY1A 3H7RA 2P53A 1SJDA 3QKZA 4XQ6A 4BKNA 3L4YA 4W88A 1JZ6A 2DT3A 4HPXA 4HZ6A 3T7VA 3L67A 1BG9A 4K7YA 3KOXA 5CPNA 1TE6A 3DAQA 3E2RA 4MKVA 2UY5A 4C1NA 4C6BA 1R3YA 2TAAA 3R58A 4NU7A 3TV8A 3P2VA 5A2BA 1H4PA 3SQMA 3RXZA 4FOUA 4KETA 4GUIA 2RDWA 3O16A 1CECA 4IOTA 3BAKA 4LUSA 4GVFA 3TQVA 1OGBA 1A5SA 1JGMA 4M3PA 1NJJA 1GZJA 3OQ8A 4GISA 2PCQA 3LGDA 3QKEA 4E2BA 3K46A 5HJXA 2I7GA 4B3ZA 4AHQA 1SSDA 3UXKA 2PP1A 1M1BA 3BURA 4W85A 4ES4A 4HA3A 3BW3A 4LH8A 1HKMA 3VFLA 3Q65A 3CUZA 1ZBCA 2QCNA 4JFWA 4Z1YA 1ZFJA 3S83A 1S5MA 3IJLA 3P14A 1Q66A 3TC6A 1TMQA 5DXXA 4DJEC 2X40A 5EFFA 5E70A 3MSYA 4V1XA 3CZJA 4NX0A 1KO0A 4LJ3A 1FWGC 2YA1A 2NQ5A 3BLPX 3BAYA 2J79A 4R9OA 4B9ZA 4GIEA 4XAGA 1O12A 2Y70A 4QQ3A 1Q4NX 3OP2A 4HSNA 1TA3A 1QNPA 2VJXA 4OBRA 4X2PA 2ISVA 1VBUA 4KEMA 1VBRA 3NQMA 1GZGA 4GNKB 4O52A 5BYWA 3NZ1A 3NQAA 1NELA 5A2AA 3F5LA 4J28A 2JF6A 1MQQA 3WNNA 4N6EA 1H1NA 5ABFA 2XGIA 2VX5A 1SW3A 3CASA 4TVCA 1DJWA 1WDRA 1AW5A 3IAQA 4LB4A 4GK8A 1NU5A 3CQKA 1BG4A 5IHRA 3ABZA 3OVRA 4ZSUA 5CZSA 3I6EA 4H7ZA 4Z0SA 5FESA 5I09A 2OOFA 1KRAC 1G5AA 4MDOA 3RU6A 3U5UA 3DG6A 3EEGA 5CPTA 5DY3A 1PS9A 3WQ8A 1K9TA 4O10A 2QKFA 4A21A 4QS6A 2G3NA 4DO5A 5C9UA 1FWIC 1DP0A 4GZEA 3L0GA 2XSXA 4L4OA 1JAKA 3GBDA 1OX5A 4P7OA 1BSIA 1US0A 3ORWA 1QXLA 1T96A 1JI2A 1VFSA 3ARTA 2XWDA 5CAHA 1I45A 3UERA 2Z1KA 3LTPA 2J9ZA 3U5YA 2KX9A 2R14A 1E6XM 1J12A 1PJ9A 3S1WA 1PL9A 2XIJA 1JFHA 4Y9NA 4NVTA 2EPKX 2Y61A 1W3HA 4WJEA 3QHMA 4S3BA 3HBLA 2QNEA 5AFDA 3NG3A 3RR4A 4GIAA 3AJXA 2EHHA 2A21A 4S3GA 2ZADA 5TQLA 1ME9A 5CSUA 1HO1A 3GVQA 2NX3A 4IFKA 1XDJA 3THAA 4AAJA 1UR0A 5CH9A 4IGMA 7TIMA 4N02A 3WMLA 3CH9A 1CXEA 3EX4A 2ISWA 1XPGA 4CN4A 1EUNA 3CH0A 3BOFA 2FGLA 3SJ3A 3E1F1 2HDJA 3PZTA 3ONCA 2GK1A 1Y5VA 4UTKA 2F6XA 2NQZA 4AX6A 5I79A 3HFYA 5LA0A 4LUTB 2QIIA 5LGZA 4JIPA 3PZQA 1OX6A 2YL8A 1XQKA 3HO8A 5D9NA 4R53A 3TYUA 3ITYA 4GCAA 4MB1A 1B3WA 4W8AA 1TE1A 1TV8A 1ZQ5A 4MLRA 5I3HA 1CGVA 1JJKA 1VPQA 4GUFA 3MC5A 3O9NA 1WQ5A 4CGTA 3QZEA 3VNZA 3CQJA 1C7TA 1XD0A 2YYUA 3TSBA 4XAYA 4ERAA 1P0DA 2E25A 1ZJHA 4ML4A 2A3LA 4QCEA 3TC7A 1JG9A 2V5LA 1JPDX 2OWCA 3IJ9A 2CC0A 4UQDA 3P5YA 4D6HA 5KETA 3GNPA 3GZ3A 4JTIA 3W27A 4MWAA 4HPNA 3SR7A 4YTUA 1XGEA 2O9RA 1DV7A 1PE1A 4KRUA 4I5RA 3SADA 2X16A 1Q6FA 1TR9A 1XDLA 3F4NA 3VDHA 2YBVA 3N15A 3W1AA 2E5DA 1M3UA 2VO5A 3W26A 1NDYA 3OA3A 4AIUA 3QGVA 3P61A 1XSIA 3KTSA 1SFJA 3DEQA 5LIWX 3K1GA 2CEQA 1L9WA 3KTXA 5D02A 1KV5A 3VC5A 3SY8A 4AYGA 3MMTA 4PH6A 1VCFA 4XZHA 4I90A 2I57A 1K6AA 2RGMA 4HN8A 1IWBA 1X1ZA 3CAVA 4E8DA 3BMVA 1BQGA 1XBYA 2IPFA 3TKFA 3AHVA 3N12A 1VYSX 4BF7A 1NWUA 3OZPA 4XZ9A 3KXQA 1PZ2A 3ZWSA 3BLIA 2PDQA 2NWRA 3EKLA 4QIUA 5GNZA 1I6NA 2WWDA 2NSOA 1ME8A 2QVNA 4LCRA 3SCSA 3E2VA 5B7YA 3R11A 1TPWA 4LUJA 3WBWA 1R2SA 3PSWA 3VOIA 4O17A 1HF6A 5AB3A 2XU2A 3H23A 4MAVA 1GG1A 1XICA 4YWIA 3KRSA 4GKTA 3GVGA 2WMKA 4PTDA 4MYXA 3G2GA 2FPYA 1W5OA 4H01A 2IW0A 3UWYA 3TYZA 3LPFA 2X2YA 4C90A 4R3UA 2ZX8A 1TV5A 4FNPA 1LTDA 4QNWA 1BF6A 1J2BA 3W7EA 3KW3A 2QDEA 4HOXA 2J7BA 1XCFA 1PBGA 2NSXA 4AXNA 5C6MA 1I1XA 2J7DA 1QHOA 3MPGA 4GXPA 3BLDA 1JDCA 1HVXA 3A13A 3OEXA 2PSNA 3ZWTA 3S2JA 4MUPA 3SIZA 1UBPC 3KEHA 2CETA 3UG5A 4QP0A 4Z17A 4GQQA 3OZOA 3MQTA 2CHOA 2MANA 4M56A 4MNMA 1MW2A 4WSHA 2V69A 3C2OA 4KEZA 4C7DA 1S5WA 5ABHA 2J8FA 3ZJ8A 1XFCA 2ZRYA 1GOOA 2QCFA 3LHYA 1ZAIA 1UKTA 3BSGA 1G7VA 4CU8A 1UWUA 3PF3A 3QSTA 1XKYA 3VGHA 3ARQA 5HMEA 3EWWA 3QQ1A 3MSGA 4S3JA 4H00A 1FHUA 3QOKA 5HXMA 3CV6A 3JS3A 5BRPA 3F4WA 3DIPA 3P74A 4S23A 4KT2A 4XZWA 5I7GA 3PZNA 4PMRA 2OWWA 2BZNA 4LEQA 3CQIA 3O05A 2PTYA 4HTBA 2NW0A 2VDIA 1XM3A 3UESA 4DWSB 4LF1A 1QVBA 3EXTA 4PTNA 2V5JA 1LBFA 4EWND 4BS0A 5FKYA 1DOSA 3BGAA 1GVIA 2CW6A 3W1MA 2WVTA 2J13A 3MSRA 3N3TA 4RDWA 2VDHA 4LS2A 4A2RA 2A5HA 4U31A 4IIGA 2ISDA 4IJBA 5FSDC 5H6HA 1W1TA 2VFDA 3NSMA 3O3RA 3WEMA 1IWAA 3OG2A 1TCDA 4KCTA 1MXGA 3GW3A 3AUJA 3BOLA 1WZLA 3NM1A 4UBPC 1Q8AA 3UP8A 1K9EA 1ITXA 4NJGA 2D0GA 5BOFA 2I1OA 4MIMA 3IV8A 4L80A 2NUYA 1GVFA 3SQSA 3GH7A 3LHVA 1EGMA 1C3FA 3RCMA 1YXDA 2YB4A 1YTDA 5B7ZA 1HGYA 5I5RA 3GDLA 3KRBA 4X0VA 2DV0A 4GGHA 4HN4A 4QJ5B 3WJXA 3SGGA 4QR6A 3VKJA 1K4GA 4F4RA 1VRXA 3JR2A 3WK3A 3AMGA 5A8OA 3HF3A 4Y90A 2Q3OA 2W62A 2OYLA 2BLEA 4M29A 1B3OA 4NJJA 3M0LA 3RILA 3A64A 1FHLA 3C56A 4XTIA 5G1TA 3ZJ7A 3CO8A 1WDWA 4PB5A 5BRQA 4AUBA 3DBNA 3OTRA 1H3GA 3VO0A 4RZBA 3UJ2A 1OB0A 3SCPA 4GQ0A 2IPGA 3LHUA 5DRIA 4AY1A 7TAAA 4KW2A 4GH1A 5DO8A 4TXEA 3RK8A 4G9PA 3UXAA 5K7JA 3L4WA 3QMSA 2BVYA 1N7KA 2DY3A 4RDVA 4A3YA 2VEMA 1B31A 2Z1WA 1HKKA 4V28A 4CU6A 1NF0A 1QMLA 4L4LA 4PGLA 4L6HA 4D2JA 3OU8A 8XIMA 1SZEA 1R3QA 3WF2A 4IGHA 1K7FA 1W1B1 1GVEA 1POJA 2RKXA 2CHNA 4JHMA 3VOJA 1XLIA 1U1UA 3GDKA 3T42A 2J88A 3VKCA 1CXKA 1EZ2A 3QMTA 2HNEA 3V1HA 1W9VA 4D8LA 4LB3A 2Q8XA 4ZBCA 4L1XA 1TPC1 1TO3A 3NXLA 3R89A 5CJNA 1SW7A 2J8GA 1NWTA 3UWWA 2PTZA 4R88A 3CNYA 4I3GA 4NZCA 4JIIX 1MZRA 1XF0A 3QHOA 1LCOA 4PUUA 4LEFA 3R8GA 1JIBA 1M7XA 2ZRXA 1VLWA 1OZQA 4B5TA 7ENLA 1OM0A 3W7PA 4U10A 2DZSA 3GIYA 3M5ZA 4DJFC 4PTMA 3U0HA 1OBAA 1TPFA 2DT2A 2WSRA 3EXRA 1S5TA 3NGFA 4PMNA 1R9ZA 2XIQA 3GD6A 4GYKA 5AHMA 4IQEA 4DNHA 4H9ZA 5REQA 4C7FA 2ZQ0A 3WQFA 4YIWA 2Y85A 1E3ZA 3W1QA 1EIXA 5SWUA 3FGCB 3W3OA 4ICCX 3H55A 4A4AA 2OGJA 1SZRA 4DUOA 3TFXA 1VS1A 4GVGA 3TQ0A 3EMZA 1WB0A 5AYZA 2OOGA 2WJZA 3G8RA 3UG3A 2HS8A 1WYIA 2E3ZA 1T0OA 1OHLA 4XKYB 4ASTA 1DWFM 1ONXA 4PUWA 5F2IA 3TW9A 4ORMA 3AHXA 1NF7A 1TIWA 4IM4A 3D5HA 4MNLA 2E67A 2Y7GA 3URNA 5BXSA 3V4BA 1C29A 3NQ2A 5I00A 3NJ3A 5JIWA 1M7OA 5T26A 3D3AA 3SN0A 4N4QA 1PZ0A 2WKGA 1LJYA 2FTYA 3TH6A 3F2DA 4LVFA 3EOOA 1XISA 3TQKA 3VK5A 2HMCA 3MA8A 4PN2A 3WK1A 1Z41A 5HWMA 1PKYA 3VKDA 3VDAA 4H8UA 1WDDA 1AL8A 1RR2A 3M0KA 1H50A 2WYSA 1XHGA 8CGTA 4R33A 4DYKA 5FL0A 2D3NA 1XP3A 3TCSA 2HTMA 5IFPA 3QPEA 2EO7A 1TR1A 3WLJA 5HQMA 3WQ5A 4CNTA 2WC7A 1W1IE 1K9DA 1YPFA 3ZVIA 4JN8A 1KBBA 3LCFA 1WAWA 4IF2A 1AH0A 1FY6A 4CQDA 4IGNA 3PUOA 3QY7A 1WDQA 1XV8A 3RDKA 2J7GA 1QFEA 4FX6M 3VGDA 2XFWA 2HK1A 4JKKA 4GACA 3D0CA 1C8XA 1GEHA 2J25A 1H60A 1EYWA 3AXIA 2KAUC 1XSJA 2PODA 1V02E 1WO2A 4LANA 1PKLA 5ENLA 1FWTA 4XO7A 3QR1A 1IZCA 4DZAA 3GK0A 1Q2SA 2X2GA 4UQ9A 1YKWA 3B04A 3GE7A 3GXPA 1KBLA 3AYSA 4PCSA 5DF0A 3G3DA 4G7EB 2NX9A 3UW6A 2P1FA 3IGHX 2OO6A 1DWIM 4O15A 3UR7A 4LAOA 3N9KA 4IIHA 2XVGA 5DBTA 3A23A 4LC6A 2V82A 4MB5A 1T8XA 3CAKA 2PCEA 1KR1A 1VEOA 3M0XA 2Z1SA 1KFCA 3PBWA 3STFA 1ESWA 2BDQA 3G1HA 3CPGA 2V38A 3N2XA 3OLDA 3NPVA 1KBIA 3O7UA 4AVFA 1P0KA 1FCUA 3ZT7A 3ATYA 2GUYA 4AD4A 1ISYA 3I10A 2PDMA 4JNYA 1G6CA 3KCJA 1IIHA 3JVAA 3S9YA 3EEZA 3SUTA 3FA4A 3EX2A 2A4AA 4A8LA 3AMCA 5ECUA 1XYMA 1BEUA 3UVAA 3L7RA 3WFZA 1XSKA 1BPLB 2YCEA 5HJYA 1JCYA 2FZ8A 2FHBA 1UKPA 3PFRA 4QDWA 3AU2A 3CB8A 4C60A 5AHFA 2CLFA 4MADA 3THDA 4TV6A 3UZZA 5A94A 3WQWA 4OV9A 1HFBA 3TVAA 2VEFA 4H7CA 1PIGA 1MZHA 3LCLA 1ZY9A 4MKNA 1XBXA 4O1FA 1Z42A 3IAPA 4POCA 2XVLA 2A0NA 1GJPA 5H8PA 1WZKA 4A3QA 4UNIA 1KM2A 1BXBA 2QMJA 3E2QA 3RLVA 2C18A 2DDXA 1BQCA 1P6CA 4N4PA 1EFZA 3B03A 4IUGA 2VFIA 1NOUA 2WM0A 1K6WA 2OSXA 1ADOA 3AIQA 2F38A 2WMIA 2FMOA 4Y9OA 2GJNA 4I5XA 1O5KA 1W9XA 1XLMA 1UD8A 3HN3A 4ACZA 5XIAA 3EA3A 4UOZA 5C9WA 2VVNA 3MZ2A 4MF4A 4OGZA 2R1LA 1WBHA 3E0FA 2F7FA 3C0JA 1VEPA 4DM2A 2VFEA 4JTHA 3CK5A 1DXIA 1DEDA 2AL2A 1SW0A 3IIZA 1BVWA 4NX5A 5DT7A 3AIRA 2X1TA 1LRNA 4FNUA 3M0JA 2XH2A 2GQAA 1GZ1A 1RQHA 4NZ5A 1YHTA 1GEQA 1UP2A 1KRMA 5A6MA 2FVLA 3B8DA 2X0HA 2Y8VA 3CJPA 4UZSA 2VXNA 5CGTA 1FWNA 4IMFA 2PD9A 3DFYA 3OLGA 3AJ7A 3PP7A 3BCDA 2B81A 3WDJA 3I7QA 4TX6A 4NJKA 1X97A 2PDUA 3R43A 3UG8A 1OFDA 4S3DA 1W2VA 3NO5A 3WO8A 4FNSA 2PWEA 4LXFA 3TYCA 1FHDA 3C2EA 4R5EA 4JNMA 1R85A 2IQTA 3KOFA 2D2OA 3P8JA 3T0BA 1R5YA 3IUDA 3LMZA 1F76A 5DN1A 1CLXA 3BQ6A 1EBHA 2DZXA 3R1ZA 1TTQA 1XYLA 4EXAA 3S1UA 5M17A 3SFKA 4MWAE 4WKFA 1GVQA 3REQA 3AICA 3BG9A 3H2EA 3RPDA 6TIMA 2Y88A 3PG8A 3H22A 3LQLA 2INFA 3IUIA 4KWWA 4MNJA 3UZYA 1XX1A 2PTXA 5HNTA 1UH4A 1XYZA 3BG3A 2P8BA 3DHDA 4FA3A 4DWSD 2PDPA 3DKLA 2QYGA 2VX7A 1EGZA 3NEVA 3PS7A 3H6OA 2OB3A 3R8RA 3P62A 4NKCA 3QOMA 4DXXA 1SGJA 4GUHA 5HANA 1YEYA 1E55A 1F74A 1BD0A 1R7OA 1UC4A 2I14A 1J6OA 2V81A 2PAJA 1I60A 2PU0A 1EGVA 4S3EA 1KM3A 2E9LA 3MUCA 4X3ZA 3KS6A 1DTNA 5L9FA 2XVNA 3SRDA 2ZFAA 1J79A 2ZXAA 1VHNA 4TO8A 3O6DA 4KGJA 4YN5A 4JFVA 1S1PA 3WLTA 4Q8PA 3NZPA 4BY3A 1FWJC 3KE0A 5BNKA 3VNIA 2YDRA 1A5AA 4FO4A 4KESA 4HP5A 1MVYA 3L2MA 3SM0A 3WKZA 3GH5A 3O6YX 3QXBA 1TJPA 4AD5A 3CWOX 3LX9A 1KXQA 2HVOA 4BCEA 1QU4A 3FJ4A 3THUA 4M82A 4O13A 5BU6A 3UG4A 1VPYA 4TOQA 2JQXA 2VNCA 3T4WA 1JDAA 1DHKA 1BVZA 1XYAA 3VZXA 1U5JA 1POKA 3M6DA 4JS3A 5H2ZA 4LAUA 1S3HA 4ADSA 5D30A 2AKZA 1QASA 5B80A 1T41A 2Z27A 2WNNA 1TWIA 1DJGA 3L68A 2YLLA 2WSPA 2WZEA 4OBTA 1TV3A 2OZ3A 3LRLA 1AW2A 4IWWA 4N7QA 4R7JA 2VWTA 4ZB0A 4RE2A 4F66A 3QN3A 4H9XA 1CT5A 5IDZA 2QIWA 2OKOA 3WUEA 2CWXA 1QHZA 4FP1A 1XLDA 1WKFA 4PTWA 3W7HA 1TJ1A 2WOQA 5D2YA 3WJYA 2SFPA 3R13A 1OCNA 1EDGA 2POTA 3LXAA 4O1EA 1IXOA 2NT0A 3M5XA 3G24A 3OJGA 5I02A 1MXDA 4A35A 3G0UA 2PWFA 4HMCA 3DCPA 2D0FA 1AH3A 5K3VA 1A5MC 2W91A 1EJTC 6ENLA 1VBGA 1LRTA 2QPUA 4P7NA 3P0XA 2J78A 2PI6A 2HPIA 2OQLA 1EOKA 3ABOA 4TX8A 5FEXA 1UZ4A 1QRQA 2GVGA 4DUVA 3MP3A 5M2FX 3Q37A 4JIRA 1CBGA 4DIAA 3BLOA 4V1YA 4AH7A 1E43A 5K4ZA 4XISA 3KP0A 1R3WA 1LOSA 4CQ8A 2PFHA 4I6KA 3NPUA 2O7QA 4HCDA 4B5XA 5F4XA 4UOQA 5CZJA 3LBOA 3QQ0A 1N2VA 2OSYA 3P67A 2E4TA 1R3VA 4C6PA 1W2PA 1L2UA 3WF3A 5AC5A 4AD2A 1C7SA 3LCWA 4EPBC 5DT5A 3N19B 2QQ6A 4RR4A 5JBDA 1OFOA 1U33A 1V6UA 1WPCA 4E3TA 3LN3A 1TELA 1RUSA 4DHGA 3LV6A 3W6YA 2ZC8A 4ZR8A 1GWJA 3F5KA 5BMXA 1EPVA 3CUFA 2ABBA 1O94A 4M19A 1EXBA 4I9JA 3R4IA 1YQ2A 3GFXA 3N4AA 4O1BA 2PTWA 1VCVA 3NQ6A 3VYLA 3UEQA 4PMOA 4GNVA 2WJEA 4EXBA 4G2DA 3H8AA 4HTYA 3ZM8A 1ODZA 4M1BA 3UETA 1BWKA 4UTJA 4JOMA 2V5BA 3V5OA 4WY0A 4E8CA 4HZ8A 3IJ6A 1KNWA 4H6EA 3QYSA 3WYZA 2R6OA 3S2LA 1GCYA 4GY7A 4XUGA 3KDNA 5E5CA 1SM9A 5LIXX 1CXFA 3CYVA 2XIOA 5I3GA 1RVGA 1E4IA 4WKAA 1XFBA 4I9TA 5JQ9A 3S9ZA 4AISA 4GZJA 3TN3A 1ICSA 4NNCA 3GAYA 2C6QA 3PAJA 3MHGA 3JW7A 4MY9A 4QNEA 3KP1A 2H6RA 4KWOA 2INZA 2FH6A 3IGXA 4B5UA 2ZZ1A 3TXVA 7REQA 1H0GA 2F6UA 4NYYA 1KQZA 1XGZA 1LWJA 4S3AA 4JXCA 4F3HA 4HSOA 5I3JA 2BXYA 5CBJA 1ONRA 2RH9A 4NZJA 1J93A 5HMFA 2D24A 3MJYA 8A3HA 1O66A 3PZUA 1OD0A 1FP9A 5K2ZA 5I3IA 2OELA 1YPXA 4HOWA 2AQOA 4PMDA 3P3BA 1EL3A 3LZ5A 2VWSA 2YXXA 3GYEA 4IT1A 1AQ0A 3PJWA 4NJIA 1XH0A 2DZUA 3W7DA 4REQB 2PLMA 2DVTA 3CL8A 1JYWA 1Q65A 2VFHA 3BLLA 4AWEA 2OLHA 1OYCA 1KCLA 3CZGA 3CS2A 3EAUA 4CD6A 4NAEA 4O54A 3OBEA 4CUCA 5HR7A 5DRCA 1E9IA 4GGBA 3SQLA 3UR2A 3D46A 1LWHA 4UFHA 1A5CA 4JQ4A 3LY0A 1ZPTA 3MZNA 1J0IA 3DENA 5FJOA 3B9NA 4ZOAA 3Q45A 1D9EA 4C5YA 3WEZA 3H2CA 3BPWA 3GU9A 4EPDC 1Z48A 1QPKA 1I2NA 4DRSA 1SJAA 1NDVA 3R0KA 1ZCOA 2HXUA 5HNRA 3TC3A 3VDCA 1QNQA 4GCXA 1L6WA 2CESA 2P5NA 5KINA 4RLIA 3WY1A 4IMCA 1IF2A 4TU1A 3A9BA 1FWRA 1K8CA 1E6ZA 4CCCA 3SI9A 1Q2RA 1EX5A 4QCFA 1RCQA 2ZDRA 1RY0A 4C1NB 2BFGA 5A95A 1M41A 4WD0A 5D32A 4CEXC 1RBLA 2J8TA 3ITGA 4PCTA 1A3WA 1J96A 3PBGA 4LY4A 4US6A 4Q7NA 4DJDD 3W7QA 5HNUA 4R9XA 2HS6A 4LUSB 2V3EA 5C9ZA 3DBPA 2PDGA 5D37A 1KCZA 1RVKA 4JQ1A 2OMAA 2HROA 1LORA 2ZC1A 3OW1A 5KEZA 3PK7A 3PTQA 1FBAA 5DFAA 2IPJA 4LNYA 1AUSL 3DC0A 4H1ZA 4O0ZA 5EL1A 5EGRA 2W9MA 4G5DA 3SCQA 5KMYA 2NQJA 1ALDA 3V0UA 4Z2GA 4LCQA 3KFTA 4OE7A 2VC7A 4IPPA 5AC4A 2J75A 3U57A 1TMLA 9CGTA 1H7OA 2NT1A 1EH9A 2XFYA 1YW1A 2QLYA 1K02A 1A0CA 2CLKA 3UJFA 1E51A 3F2CA 1MO0A 1JCNA 3OGVA 4QX4A 3W7CA 3I6RA 5HOSA 5HINA 1MUWA 3V0SA 3PZ9A 3U6WA 1D8WA 1LZOA 4BA0A 3FEQA 1R7AA 1MFUA 2YA2A 5M3WA 1TA3B 3TZFA 4OQVA 3WH9A 5D4YA 1QPOA 5FOOA 5HMSA 2AQVA 1DJZA 3TYDA 2AAMA 3R10A 4MJMA 2QPXA 2W61A 3K30A 1JXKA 2ODOA 1XLKA 1J18A 1E1FA 4B2DA 5ABFB 4ZOEA 1REQA 1E6PA 2V9DA 4TTGA 2BMBA 5C70A 2Z29A 1PDZA 1GVRA 4JICA 3MO4A 2QPSA 3NL2A 1MEIA 1JRBA 2XH7A 1UD4A 2PLCA 4YTQA 4D9PA 5CPSA 2D1ZA 3TWBA 2BY1A 2Z28A 3HOJA 3HPXA 4XK2A 2NZLA 5CBIA 1AZ1A 4ZE4A 1KFJA 3K2GA 1DL3A 1P1XA 4RJEA 3KCOA 1X8FA 5LNSA 4AWTA 2AMGA 2H3BA 1VZWA 1E56A 2GVEA 1Q7QA 4G1NA 3A5VA 2I56A 2X8RA 2P88A 5EBAA 3BOXA 3WENA 3DGRA 3QC0A 4NY2A 3UJEA 5IM51 3O15A 3SB0A 3UY7A 2BVTA 3TU9A 1W56A 4AIBA 1XIBA 3NDZA 1G4TA 1KCKA 5A1AA 4FOJA 2R8WA 3TYAA 4QLLA 2OLAA 5LIYX 1KXTA 3GX9A 4ZENA 1LL4A 3A4WA 4HNLA 5EFDA 1QW8A 3I68A 3QGAC 4IFKB 4IXHA 4FI4A 1CI1A 4FNQA 3UQNA 1NFBA 2FTPA 3ZOAA 2ATSA 2EXOA 4IFOA 2R1MA 8TIMA 4WDTA 1EO5A 1ZU8A 1RCXB 3GS6A 4Q4MA 1F4AA 2WV8A 2XPKA 4JYEA 3IIPA 3GBEA 2O9PA 3RX2A 3W1PA 1OWQA 2GK1B 1F61A 1JUBA 4D71A 3CV2A 1SMDA 5LNVA 1YDVA 3TTSA 4ONVA 3CU2A 5KZ6A 4CQ9A 4BI6A 4ZEPA 3LRMA 3WX7A 3AFBA 3LV5A 3WBEA 3CHVA 4PEKA 4H6RA 3H54A 2PGFA 2ZUUA 2I16A 1SZNA 3ZJKA 4HIBA 4OBSA 3SCOA 1RD5A 4PBGA 1Q6RA 4DBWA 1MW0A 4EF8A 3UVIA 3OODA 3GU2A 3M0ZA 3S6OA 2YCLA 2B31A 3UXDA 4EPKA 3P60A 2C91A 5LGXA 4Z1AA 4RX0A 3QPYA 1R47A 3AZTA 1RSCA 2CWNA 1FVPA 1P4CA 1GGOA 2G41A 3GDMA 4Z2KA 2E1WA 1FH8A 5HULA 1ECEA 4MWAB 3N9RA 4G6CA 3ARSA 2XISA 2PWUA 3CB3A 4FLRA 1BYDA 1QW9A 1WCGA 2WCGA 1YE6A 2P8CA 1EJRC 3C0QA 1O4UA 4J3SA 4D1JA 4IUOA 2R24A 3TE9A 5FJTA 1YIXA 1C8QA 4IIDA 1NEYA 3ZO9A 2E6DA 2ISFA 5A8NA 1JXJA 3GM8A 3RO6A 6XIAA 1KXHA 4N9EA 3EXSA 3EWXA 3FJLA 4H3DA 1J9YA 4X2RA 4UMAA 1J0JA 3GY1A 1PDYA 1UWQA 3VU2A 3VILA 1D8CA 4C1KA 5D2VA 1GKQA 4WXYA 1OG6A 2ZTJA 2XDFA 1VLIA 2CBUA 2P76A 3C0LA 1HX0A 3PN8A 2H8XA 3AYTA 4JTRA 1PSCA 2E6FA 3OVGA 3Q2DA 3L4VA 2D73A 4XZIA 1EO7A 3ARYA 1BSLA 3N2TA 1ODUA 2XN2A 2RFGA 1TTJA 4LAKA 2PDXA 3HMJG 3EX3A 3LPOA 1V6VA 1Q5MA 4IQJA 2X42A 2VRQA 2WHMA 1W54A 1UA7A 1NWRA 2YDQA 1CGYA 4PMQA 4EOUA 4AC7C 3W02A 3FAWA 4A8RA 1EBGA 3N4FA 3KAOA 1UJQA 1SQ7A 1TTIA 3DFOA 2PC8A 1T6MA 1W91A 1XIJA 1K8YA 2VFFA 3UWZA 1VKFA 1YXCA 3SCRA 1UD2A 3IJQA 3GXFA 1ADSA 1E9YB 4JKMA 1OC6A 1M9HA 1UCWA 2BB0A 4OOZA 5CC5A 4FXJA 4KFPA 1XPYA 3W00A 2YZRA 3PWIA 3GZAA 4C6NA 2HBVA 4GABA 4HA1A 3EDFA 4XUYA 4HYVA 2GWNA 4WY0F 2YBTA 5IBXC 4W9TA 1Z6KA 2PLKA 3KBJA 4IGSA 4K8HA 4J3XA 2ACUA 3DFSA 3MYPA 4JD4A 1WKYA 1P0NA 1UC5A 3PPHA 3SUSA 5AY7A 4PMVA 4J40A 4QM1A 1LT7A 1CLVA 3NL3A 2X09A 3GHUA 5AYYA 4Z2HA 3C5QA 1YNPA 1L0PA 2YCIX 4UTTA 5F2LA 2J77A 4UFMA 1OFAA 4JDYA 4LOCA 4QLJA 4M0XA 4JQAA 1EXPA 3FDGA 1WBJA 2YDAA 1QOQA 2A3CA 1V08A 2VC5A 3WFAA 3LNPA 2ZUVA 5A6JA 4HNTA 3BL3A 3CHCA 2I5IA 3WLLA 3AXHA 4NZ3A 2Z1XA 4MMWA 4ZFCA 4O12A 4F79A 5AZ0A 1XLLA 2WZMA 1CENA 2VYOA 1VEMA 3PZIA 3U3HA 2BOFX 1OINA 3W7GA 2FZ9A 9RUBA 1GQLA 1XC6A 3LCHA 3ZT6A 3GAKA 2ZXQA 3LM7A 4M6PA 4KIEA 1KM4A 3F4DA 3HGSA 3AIVA 4OU1A 1A53A 3UZ5A 1W3IA 4QEHA 5K4XA 1UW9A 2BSLA 5U4NA 1XLEA 2Y5JA 2QJNA 1GK8A 4LWWA 1VFHA 1W5QA 2ZYFA 4QTGA 1U1JA 1KFKA 2FKPA 4PA8A 2ZXDA 4RNJA 3SUUA 1PZ1A 2Q6ZA 1BKSA 3TJLA 1LLZA 3WQCA 1F3WA 4UXDA 3J7HA 4Y2WA 4DXKA 1LLOA 5CZ0A 4O0QA 2HK0A 2V5KA 4PUMA 3C2FA 3AWOA 3FDKA 2FHFA 3D6NA 1I75A 2VRKA 1Q6OA 3KHJA 4WCJA 4U2YA 6XIMA 3LCIA 5JH1A 2IKIA 4CCDA 2CBJA 1NP0A 4DXVA 3MDWA 1D3CA 4U4MA 3VIHA 5AOUA 4ATWA 3ITTA 1FWFC 4XD5A 3FW6A 4N2YA 3C0SA 3P84A 4Q4RA 3WLMA 1CDGA 1V7AA 5A8MA 4E8GA 2G95A 5HMDA 3TN5A 1C92A 1K77A 3SO7A 3W1XA 3GG8A 1QT1A 3VINA 3VIPA 2VMFA 5DX7A 3K13A 4AD0A 1EC7A 1E3XA 2VZUA 4JTLA 3LQGA 5FF3A 4MNKA 4NUWA 3M47A 1OF8A 4XIAA 3MS8A 1IYXA 3E96A 1YDYA 3MUXA 3UFYA 4B90A 2C14A 3BJFA 3MBDA 4YVVA 1XLJA 4L9ZA 4Y6GA 3W1LA 1UYQA 4G56A 4OKDA 3VIOA 2QDHA 4UTTC 2CLIA 1G1YA 3GO2A 3W81A 4Z1CA 5D8ZA 1UWSA 6ALDA 2C0HA 1JEZA 1ZHAA 3ARVA 2R1KA 4RNIA 3N9SA 4KH2A 3UPWA 1IR2A 1QK0A 4JX6A 3SGUA 2BXZA 3KWSA 2YCKX 3WBXA 3ARRA 1IEVA 3CAWA 1RPKA 2PPGA 4PMYA 3SY1A 4CCEA 1VRDA 2FZBA 3AXXA 3AUOA 4Z0JA 2CERA 3TJIA 4YJ5A 1ZP4A 1BXCA 5I78A 3W9ZA 3G1XA 2BGQA 4QSFA 5LA2A 2QT3A 2UBPC 2DSZA 3KRUA 3DG3A 2DU2A 2CZFA 3O06A 2OQYA 3TR2A 1CZ1A 3FSTA 3DYOA 1NIUA 2YYTA 4LY8A 2A6LA 3VD7A 1VJZA 1X6UA 1WAUA 1W1PA 3GNXA 2VRJA 1W1ZA 3G1SA 3I7SA 1XYFA 4P7LA 4PC8A 4GI6A 3R6IA 5REQB 2A7PA 3BV7A 5D09A 1UZHA 4B5WA 5AZ1A 4UQBA 1QWGA 1XLBA 4GX9A 2CLPA 3NOEA 3HB9A 3VIJA 5I24A 1XIHA 2A79A 3L5AA 3OGRA 5E6YA 1R2RA 1LOQA 4FZIA 1ZAJA 1DJHA 3UWUA 1TZ7A 1WV2A 3F2BA 4V27A 5DMNA 3LDVA 4WZHA 1CTNA 4XSLA 4KBXA 3NQCA 2QMKA 2QUUA 2ACQA 3VIIA 3H2MA 1OX4A 3I65A 4IIFA 1A3XA 3D47A 1PX4A 3FVMA 3NO3A 1SJCA 1NQ6A 2WK2A 6REQA 1OC7A 2DUAA 2V0TA 5EA9A 3QEZA 1W31A 2O7SA 2EJAA 4OIFA 3BAXA 4ENLA 3W1TA 2GPTA 5U7SA 3CUJA 2PWDA 3PAOA 1I2QA 1TG7A 3W23A 3LRKA 3MYOA 4JEQA 1J0ZA 5DXYA 4R27A 4FB7A 2QV5A 4AXKA 5DCBA 1ZP3A 3WCZA 4GJJA 4MZYA 1IZKA 2ADAA 3HGRA 3WK0A 2CPUA 5CQ1A 3S47A 4JN7A 5EMJA 3LI0A 2OGYA 2BS9A 3T0CA 1KGWA 2FZDA 1SUXA 2PS2A 4A05A 4CCZA 4K7VA 7XIMA 1PYMA 3QF0A 1OCQA 3HZ3A 3V5CA 1MEHA 1AA1B 4Q4PA 4L56A 1S2CA 2P3EA 1Q6GA 5FF0A 2NWSA 2QCDA 1R9YA 3AXMA 3V7PA 4HHPA 3GTXA 1SYTA 3ARUA 3AS0A 2VHLA 4QLKA 4K8GA 4QITA 4M80A 4DLFA 4W5UA 1W0MA 4GPNA 4UMCA 2Y5SA 4M6QA 4MDPA 2X05A 3AHTA 3SRHA 3VE9A 4ALDA 3U4FA 1ZAHA 4MOZA 1Q7MA 2JIWA 3WH7A 4Q8VA 3GWQA 1PKMA 4U5IA 5CSSA 4TMCA 1V0MA 3LZ3A 5J8LA 1O7AA 1GNXA 2Z0IA 4IL2A 4HJFA 1LROA 1EC9A 2VP8A 4MZ8A 3CQ0A 3WH8A 2ZZ7A 4CD4A 4O19A 1CGXA 3TLLA 3BQ5A 1J11A 1BXNA 2B7OA 5CAKA 3BW4A 3EPOA 3P93A 1OIFA 1QNRA 5D2XA 1WKDA 4UR7A 1EA0A 2MNRA 2ZZ2A 1IQ8A 4K1GA 2OSWA 2YXOA 1Y7VA 4FALA 2PDBA 2DP3A 3L5LA 2FPVA 2VZOA 5M1TA 2OKTA 3TCEA 1TQJA 4MWAD 4HYRA 5FJRA 2OYKA 2F61A 2P3ZA 5LHEA 2Z25A 4IPLA 2YR1A 4ICNA 3FK4A 2X1IA 5ABEA 3ITLA 3GNRA 1ZJIA 2WBKA 3WUGA 4PMJA 3TEVA 1UWTA 3FLUA 4GQRA 1YMYA 4PCFA 3ZXWA 1J4EA 4YPJA 4NQ1A 3B8WA 4L61A 5MKGA 2ZUNA 3CTLA 3VAVA 4C6IA 1VPXA 1A0EA 3ES8A 2ISSA 4I8YA 4LYQA 4BF9A 2YL9A 1MMFA 2VZTA 1PHQA 2Z6IA 3PANA 4Q6XA 3CEUA 4GZ7A 2WKJA 2EBNA 1GQKA 4PR4A 3RM9A 1VAHA 4W84A 4TR9A 1GT8A 1OT1A 3T2QA 2FHCA 4L1WA 3OOQA 1OABA 3W87A 5ABTA 3NQDA 4Y9MA 2PWHA 3IVTA 3RM4A 3NGJA 4X22A 4US5D 2OEJA 4O1CA 3POHA 3H12A 1RQEA 3RM8A 1VD6A 1DIEA 4QDMA 1KKRA 1ONWA 1KRCC 4UFLA 3UZWA 1SR9A 3DU0A 3E0IA 1XWYA 3HPZA 1GOMA 3VOHA 2JEQA 3SZ8A 4ACZB 1EJSC 4UQEA 2ZA2A 2D2GA 4RE4A 3M43A 3AOFA 1CW2A 1UKOA 1V3KA 2V63A 3QW4B 4IFRA 1E73M 3AU6A 2CBIA 4JIHA 2Z00A 1TV7A 5D8WA 1OQFA 1TPVA 1S46A 3NQFA 3NQ7A 3DFHA 3A3XA 2O4QA 3TK7A 1IR1A 1HXJA 1UUOA 2AL2B 2FDSA 3FJNA 3LCXA 3UZJA 2EAWA 3G6LA 4AHPA 3ABSA 1N8FA 1FCBA 4MVAA 3MHUA 3DN5A 3OA5A 3QC3A 2V30A 1H51A 2FB3A 5DBUA 1TVNA 4IISA 5LSMA 4UQAA 3E2SA 4ZXLA 3URQA 2WVSA 1JDFA 1OGSA 2EG6A 2VENA 7PTDA 1P48A 2HWGA 2PDLA 1ISZA 3AZRA 5JIPA 2VR4A 4F0SA 5HDRA 5D33A 3IACA 1XI3A 2PUZA 3HPFA 1GORA 4F40A 3G18A 4NZFA 4Y8FA 2D69A 5E09A 3WD2A 4DO4A 3SUVA 2DIEA 4MB4A 4OECA 3TTYA 3N04A 3VZYA 4ZODA 5KTLA 4Y9AA 4S39A 4QAWA 4V33A 1ZENA 3CUIA 2PEVA 1ZJAA 3NEHA 4E4PA 3MWCA 1GTEA 1QOPA 1LQ2A 3MMDA 4B4HA 3HQPA 3NDYA 2XHYA 3XINA 1H09A 1KM6A 3NZQA 4WF7A 1X1OA 1ISWA 4LTSA 5EMYA 1B5TA 4C6FA 5IHSA 3GB6A 3BW2A 1F2JA 4FNRA 4C6JA 3B97A 3TZNA 5KZEA 1MDRA 4Q33A 5BROA 1E5NA 1SO4A 3EOSA 4KGLA 4NSBA 2E5CA 3W2JA 3IJIA 1Q6DA 1LOLA 3EZ4A 4B9YA 3KX6A 4BEUA 3PNZA 4HNVA 2ALDA 3KVKA 4FIQA 2DZPA 5AC7A 3M6YA 5I77A 3LD5A 4KCWA 2DT1A 4PUKA 1PYFA 3CIVA 5LA1A 1A49A 2F9RA 1UPPA 1IV8A 3BC9A 3VVGA 2QJGA 2DUZA 2J27A 3BSMA 2GJLA 2Z1BA 2VDGA 1E6SM 5MHBA 3QY8A 1V02A 3VC6A 3S5YA 4FIRA 3P80A 4WSJA 1B54A 4B92A 4RZ4A 3MCOA 3R2GA 5G2WA 3KBSA 1XIFA 2Y8KA 4GG9A 1RP9A 4DI9A 4U33A 4DBSA 1TX0A 5D2WA 4Q22A 4IX2A 2C0AA 3WDRA 3EMCA 1DWGM 1HKJA 3S4TA 2VD9A 3RLGA 2QUTA 1FWSA 1WZAA 4MY1A 1R2TA 2JKEA 3KVMA 1K9FA 4K36A 3R0UA 4XD3A 1LWIA 2A7RA 2YZ5A 3S1XA 4AZCA 2G3IA 3B0YA 3ATZA 2W92A 1R0MA 3B3DA 3MSDA 1EWEA 1VFTA 1W8SA 3PZGA 3KVLA 4LAZA 4FLSA 1W8GA 4N42A 3VNYA 2WMFA 1NQKA 2FH8A 2XSBA 5CLWA 3DZ1A 1RJPA 4GVHA 4GI9A 4XO6A 4D6IA 1GTHA 3PWAA 1Q6CA 2PGWA 5T8GA 2ZBTA 3ELFA 1JPKA 4S38A 1F6KA 1DXFA 5CBBA 4KIRA 3K4DA 1H7WA 1YLVA 1LF1A 3GH4A 4YVPA 4AMAA 3GHTA 2NV2A 3PUDA 1XRVA 5C2GA 2XSAA 4DWSC 2VCBA 4ZGYA 1E6RA 5A6BA 3WH6A 1YTEA 3MI3A 3FX4A 3ARXA 3WLQA 3VOCA 3AIBA 5I07A 1BVNP 1D7FA 2DZWA 1JUKA 5A8PA 3AHZA 2GGEA 1O1ZA 4QRNA 3M64A 4ZXOA 1GJWA 5C0QA 2JF7A 4KERA 2P0IA 4ZQOA 4MTVA 3EWYA 2Q71A 4P61A 2FFCA 3T6CA 3QH2A 1XIDA 1TWWA 1H7PA 3ALGA 1WUEA 5EY5A 2WKLA 2PF0A 2G50A 4WSKA 2E40A 1KBKA 4FPSA 4URIA 1M04A 1PHWA 1RK6A 4L5ZA 4OHQA 1A80A 4P8WA 1VJIA 3IS4A 1PWLA 2WCAA 3IIOA 4AZBA 4PMXA 3S2MA 3KBWA 4AB4A 3OLIA 4FHAA 1AJZA 1EB3A 4S2BA 1TQXA 3MVTA 3GUWA 1LP6A 1GVYA 1WXYA 3A47A 3EA2A 1RLDA 2QJJA 4GI4A 1IXQA 2I17A 4WJ8A 3W53A 2EPMX 3XISA 2R91A 4PTVA 4C6OA 5LZLA 1I9CB 1V03A 1L6YA 4AHOA 1YYAA 1OEPA 1HKVA 4JNZA 1KTBA 4WY0B 1TPEA 4W86A 4GI8A 5T9CE 3TTOA 1E0XA 2V3DA 3FYYA 3LBCA 2A2IA 4UNLA 3WNMA 1UG6A 1RLCL 3BG5A 2IPWA 4LV4A 3EMQA 4DPQA 3WL1A 2DUXA 5E0KA 3DI0A 1R86A 3EOEA 4EACA 4HNCA 1JFXA 2HJPA 3PZOA 2WJDA 4QHRA 7REQB 3NQBA 3ISIX 3MBFA 1QPNA 1AD1A 3CPUA 1ENUA 3B8VA 2JKPA 3KWXA 1P5BA 3BLFA 3EWCA 1SO5A 3W88A 3KL5A 1DQWA 1K8XA 4QBXA 5AECA 4HU0A 1LBLA 4NG3A 2PRHA 3CLMA 3N2CA 5C2XA 4F48A 4LX4A 3RFAA 4BK9A 4H9YA 5JBFA 1R46A 3INPA 4PB3A 1AW1A 2I5QA 2QGHA 3E6EA 4D6FA 2W0UA 1E1EA 4C6DA 1VB9A 3SCWA 4AIEA 1JYVA 4YTRA 1SFLA 5DEZA 3KBMA 2G4FA 4JYFA 1U22A 4NAEB 3AROA 3LXCA 4WGXA 2ZZ4A 4L7ZA 3DYMA 3PTDA 3L4XA 1N8WA 3UGVA 4ZQPA 2ZKMX 3KTCA 4W7WA 5FJJA 5A5WA 6TAAA 3HQOA 3KCLA 4BEQA 3U2EA 3IIXA 2W63A 4JFUA 3OLEA 2OU4A 3FXYA 2EG8A 3PG9A 4JKLA 2DW7A 1XYCA 3ES7A 4ZE5A 1W17A 3NPXA 4H83A 4CNPA 1X98A 4U5KA 3K5XA 3FA5A 3PC0A 1C9DA 3L4UA 2PDJA 3EWZA 1A5LC 3WIJA 3RLUA 3W7MA 5L6UA 3VNJA 1ZZMA 4LBRA 4IICA 4AEEA 4JQ3A 3RRAA 4MUZA 5LXXA 4HQVA 1PX3A 4LGXA 3E0WA 3R79A 2GJRA 1JI1A 3DKJA 4UTUA 1DIOA 3S1VA 4HNOA 4ADUA 4CEUC 4RZ6A 3TNOA 5M03A 1Q85A 1IGWA 3E49A 5I06A 3VGEA 3B8IA 1S2TA 3LPGA 3SCVA 4AF0A 2ONEA 4WK9A 2IKGA 3USZA 4PRRA 3SUWA 1FCQA 1QDSA 3UBPC 4EANA 2ZWYA 3M16A 2YBUA 1QK2A 1NVMA 3WJWA 1NY1A 3N14A 2ZOXA 4NRRA 1NFPA 2W67A 2EF9A 1E15A 1HVQA 3RUBL 3NL6A 3W1RA 1PX8A 1E5JA 4Q7BA 4XZBA 4BQ5A 4M7SA 4ORIA 5E6ZA 5LKYA 1I2OA 5FJPA 1H63A 1RJQA 4K3ZA 3USBA 1DYSA 3MI2A 3TJXA 2EJ1A 3WZ0E 1R87A 3NO1A 4LYPA 5G1MA 4XB3A 3CLWA 1VFMA 4IMDA 3G5EA 2DEPA 2JE8A 4DJFA 1F73A 2O9OA 2O92A 1EHNA 4FXFA 1G0CA 3TTEA 1JD7A 4P8UA 1Q6EA 3M1ZA 1M68A 1KRBC 3ZLGA 1QNVA 3TJ4A 5CSYA 4RV3A 4UFJA 4PL2A 3SJNA 4EIVA 2EGZA 4LYRA 4AQLA 4FXSA 4D6EA 2PWVA 4GFSA 2DFAA 2CKRA 4HGXA 1JPMA 5H8MA 2GFTA 3TSDA 3S2CA 3EDEA 3AWNA 1QPQA 4RW5A 1HTIA 1JF5A 3C8NA 3S1GA 3N4EA 3TN4A 4HPHA 3AZSA 3BVJA 3LMYA 1HJXA 1HIZA 4DBEA 1DJNA 3QFEA 1HGWA 2IQDA 2FTWA 2Z7KA 3TYBA 4ZVJA 3F4CA 2WXDM 4F2TA 2O9TA 4GUGA 2INEA 4Z2JA 3BK0A 4AWUA 3M46A 5BRBA 2Q3RA 4PBFA 4E0CA 3R25A 3BV4A 4HK7A 3BO9A 3BCJA 4H9TA 4RPQA 5A6SA 1WUFA 4Q4SA 3UGRA 4GYFA 2E8YA 3L65A 3CIXA 1XRTA 5CKSA 3SRKA 2E77A 4DJDC 2VX4A 2EPNA 2WVVA 4XBSA 3ZMRA 4IPIA 3RPMA 4JTCA 3VMOA 1HP5A 2EEXA 4WJXA 3TDFA 3H21A 3LUTA 2YW4A 3CHFA 3QRHA 3HM7A 1D3HA 3TIMA 4KFOA 5GVJA 3STEA 1J0HA 3LOTA 1VIZA 3EWUA 3UWEA 3ITXA 2YIHA 2ICSA 4K37A 4MLJA 4ZTYA 5H91A 4C6MA 4QG8A 3CV7A 4N9BA 1KQYA 3JUGA 4M81A 2CZDA 3NXFA 1UD5A 1X7FA 1UPMB 1H61A 3N29A 2EPHA 4QAIA 3OZYA 3KOYA 2OFJA 2V2DA 3S3GA 3LPPA 2ZE3A 3AYVA 3VM7A 1GPWA 1WX0A 3PZMA 3CUXA 2WAGA 2PD5A 3DFPA 5AN7A 3VD4A 3M07A 3B9OA 4MB3A 3F7JA 5EMUA 4N9DA 4GQBA 4CN6A 4LRSA 3KOZA 4IP5A 1RJRA 1TWZA 5C9RA 1H11A 4RPPA 1GQIA 1CXHA 2VC6A 1XCWA 3EPNA 5EB8A 1HL9A 4MAZA 2YCLB 1QO5A 1G69A 3LLDA 1TPB1 4LT9A 1TJ0A 3IANA 2B7NA 3B8TA 3K4AA 1GQNA 4HB7A 2JKAA 3GLCA 2BVWA 2PDNA 4G8TA 3THQA 3WLNA 3LHTA 1AJ2A 1XUUA 3TQPA 3G6MA 1JDDA 2CYGA 4XAZA 4PSPA 5I03A 1SPQA 5DCEA 3WBAA 1E4LA 4XVDA 4NXKA 4GWEA 3MO7A 1GOQA 3VE7A 1UBSA 2W4XA 2ON3A 3OG3A 3PZVA 2Q8ZA 4BR1A 1V6XA 1H62A 3UR5A 5E1QA 2WSYA 7ODCA 3G77A 3CM4A 3ZIZA 1LUCA 5EPDA 3LENA 2WANA 4UC5A 1OADA 4RKAA 3EOLA 5IOBA 1V4YA 1UKQA 1W1A1 2ZX5A 2X30A 2IKJA 4DZIA 1DWJM 4WQ6A 2Z26A 2J24A 1ZTVA 3AS2A 2NV1A 4L9YA 5AHLA 2Q8LA 4LAMA 1IHIA 4PB4A 4L65A 2DSUA 1EHAA 4INFA 3ZFHA 1X1NA 1RQBA 2QXWA 1FHVA 5CG0A 5HA7A 2E0PA 3W72A 5C55A 5FI8A 5D03A 1V3HA 1P6BA 1UOKA 3QSRA 2VOTA 3DFNA 3W38A 3MKKA 3P82A 1KXVA 4BFAA 4UOJA 2V3FA 3QYQA 3POCA 3GC2A 4GH3A 1XLHA 2WJFA 3UA3A 2QCLA 4KRZA 4ZTXA 2VEGA 3WMSA 3EKGA 4RZ5A 1YRRA 1QJWA 2O0TA 1EA9C 1N55A 5FJUA 3LG3A 3WD4A 4HHMA 3WD1A 3I6TA 1I8JA 1WDPA 4M8UA 2GVLA 2PGEA 3GVVA 3IUHA 2Y62A 3DH7A 5E0FA 1XRFA 1EX1A 5J5RA 4OTKA 1FWEC 4UUIA 1CIUA 3B05A 2QJIA 3E5BA 4K39A 3H53A 3UZXA 1UWIA 3QJAA 3O0KA 3LLXA 3QTPA 2B7QA 4Z08A 3IIVA 1I0DA 2ZA3A 3GXIA 3SCTA 5HAOA 5I3DA 1GYMA 2IXUA 5EMKA 4F0LA 2C15A 5A3HA 1AQFA 1UUQA 1Q6QA 3GTNA 1XIIA 2GQ3A 4GX8A 4NYUA 3WN6A 1V77A 1IT0A 4B3LA 4YU1A 2QW5A 1N82A 4YMZA 1QR7A 2E8ZA 3VMNA 3UYIA 3KBNA 5AHIA 2H3DA 1JNDA 3W7OA 3BICA 3ZR4A 3DERA 4WDWA 1TCMA 3PPGA 5AVHA 1DTUA 2QDGA 2CXGA 4PEEA 2Y0FA 1KD0A 1F6PA 1XD1A 3WNLA 1A5BA 1BYBA 3STGA 1PTAA 4R85A 3UWVA 1JF6A 3I3EA 4C7GA 3UPBA 1PIIA 2XM2A 3B9AA 3WQVA 3RLHA 4Z2LA 4O4WA 1W9UA 4JIQA 3K8KA 1B3ZA 2PDHA 3RX4A 3RJXA 2ZUWA 3BH4A 3ABQA 1RK5A 5D05A 3RHGA 2JBMA 4DX3A 5J5DA 2WWCA 3WLRA 3GHRA 3A3HA 3DHPA 1J6PA 2X0SA 1HW6A 5G4EA 3GQYA 3E9AA 1S5VA 3ZVHA 1V51A 3MUY1 3KOWA 5BWAA 1KLYA 1MUCA 4A3UA 2DQWA 3P8IA 4IZGA 4YTTA 2XINA 2PU1A 2PDKA 2ZICA 3U2ZA 1VH7A 1HJVA 4L64A 4NT0A 5D38A 1FDYA 1UR1A 3VGFA 4K38A 4F9DA 7CGTA 5CPQA 4QJ4B 5CXPA 5FIPA 1H1YA 4GO8A 3FOKA 4BF5A 3RYSA 1EEPA 1XRSA 1XLCA 5BMWA 2ANUA 2VELA 5DCDA 3U4AA 3UXIA 2VEKA 1V0KA 3MV01 4FX8A 1PVNA 1PEZA 4XV0A 1KFBA 4W8LA 3WH5A 2UY2A 1XLFA 3OZMA 1QI5A 1ICPA 1NWSA 3IK2A 3HGOA 2XZ9A 3SCUA 5E0CA 4NL1A 5G1YA 3NNTA 3OYXA 4HYWA 5HUOA 2VI0A 4ZO7A 1EWDA 1US2A 3PFMA 2TYSA 3L66A 2ZZ5A 4D1IA 4CQAA 1K7EA 3HV8A 1RXOB 4DO6A 1QATA 1IGSA 1G01A 4JR5A 1FFQA 2E68A 3FKRA 5KITA 2WZHA 3HQNA 2D2HA 4HBKA 2UWFA 4QDPA 1JZ2A 2WM1A 1JPHA 1KR0A 3R12A 1CB7B 4XZLX 2XFFA 5RUBA 3IRSA 4UCFA 3FSUA 1Q6LA 5BWFA 2PBOA 1Z69A 5BOOA 2GDVA 2Q02A 3H2FA 1UIPA 3CT2A 4EPEC 2QAFA 2FQIA 4ROQA 3YPIA 1A4LA 3W7JA 4UCGA 3KS5A 3LHZA 2QF7A 3K8MA 3MP5A 1P1MA 2PGRA 3G3MA 4H6QA 1F6YA 1LG1A 3B40A 1O95A 4WEVX 2J47A 3C3NA 2NXHA 1Z7AA 2X41A 1FH9A 3ZSTA 3HURA 4IJCA 2YB1A 1ISXA 4JAWA 1CX9A 5CEWA 5AKQA 1JQXA 3D3FA 4JTFA 2R82A 3UJRA 4CQCA 3LI1A 5IRPA 1GQJA 1MRQA 4YYCA 1DPMA 1W9BM 2TRSA 3TW7A 4HCHA 3S5ZA 1P7TA 1UA3A 1DBTA 3KL0A 1AD4A 2GOKA 3HG3A 4JTTA 3VKKA 2C8NA 1XIMA 1YADA 3CZEA 4J7RA 1HQTA 3TX9A 1F8IA 2X7VA 4B2DD 1GKPA 3VZZA 1WZMA 2OJPA 4ZQNA 3CZ8A 4BI5A 3QZ6A 3SDOA 4YCOA 4RW3A 3L0KA 2Y7EA 4AWSA 4XZMX 3WQOA 3WJZA 4B91A 5D2TA 4WGHA 2QUVA 1VFFA 2Y5EA 1JR1A 1UR8A 2QZRA 1OY0A 4DVOA 5AHNA 2OZTA 1HJUA 1GKRA 4PRWA 4PUJA 1DVJA 1FWCC 2BV9A 1GHRA 4WR3A 2D22A 4IPJA 1XGDA 1OX4B 3DHFA 1UD6A 5F4WA 2FJUB 1XQLA 1UH2A 3AALA 4LSBA 4CD8A 6REQB 5TBOA 1M6JA 1B0IA 5GJPA 4I8DA 1K8ZA 4JTGA 4OZOA 4D6JA 3R0DA 1OYBA 2DORA 3S5NA 3H4XA 1XLGA 1XL9A 1ZSXA 5I3FA 2XUCA 4KPLA 4H8NA 2J66A 1L6GA 2OTDA 4AVNA 3PULA 3STPA 3MVIA 3NZRA 1F7BA 3VGGA 1EP1A 3HIJA 3R5EA 4JDBA 4FEZA 2YL6A 3W70A 3EBVA 2VR2A 4ZOBA 4DEFA 2QUNA 2OT1A 1OC5A 2EPLX 1U5VA 3BE7A 2FYMA 3S5OA 1TJ2A 5JXQA 5ECVA 3WNOA 1EDQA 3BJSA 1BGAA 1V8EA 4LS1A 3HMCA 4Z1DA 4FXRA 1LDCA 4IXXA 3IJ7A 3M7WA 4ZB2A 5DQPA 4JX5A 2CU0A 3L12A 1JCJA 3FKKA 4J2MA 1AL7A 4IG2A 3OYZA 4I9MA 2QCDB 1W32A 1V93A 3A4AA 2E6YA 3NUKA 3A21A 3UJSA 4ILSA 4IIBA 4IQDA 1FKXA 3ABXA 1XC4A 3QR0A 4GLEA 2G37A 2WBGA 3GR7A 4WOQA 1QI2A 4LNCA 3GU1A 3OGSA 1JCXA 3JU2A 2Z2BA 4GD0A 2QDDA 2YL5A 4MG4A 3TA9A 1CXLA 4O57A 2C7FA 2QCHA 4TMBA 4I6VA 4MHBA 1FFRA 3TMQA 4OUEA 4V15A 1ZRQA 3B9DA 5JH2A 2HBXA 3GKFA 4C6EA 2ZRWA 4BZYA 2QULA 2NQ9A 2BY3A 4HU8A 1QWKA 5FCZA 1R9XA 2J6XA 1FDJA 2JALA 3V35A 1UP0A 5A6AA 4WDUA 2G97A 1ISVA 1TX2A 2NUXA 5HUPA 2BHUA 3Q67A 3IJ8A 5FEPA 4HHHA 4GJIA 2IKHA 3DFQA 1ONEA 3E3HA 4ZO8A 1JCMP 5CGQA 4E2OA 2H90A 2CLOA 1TKKA 1XH2A 2PLJA 4KKXA 3CWHA 4DI8A 5C9XA 2CHRA 2FDMA 5MKGB 4P5UA 5C5YA 4YL2A 3MDUA 1BRLA 3GNDA 3QV7A 2HZGA 5LYRA 3AYRA 2A3HA 4AZIA 4D6GA 2HISA 4GO9A 1EQCA 1NM9A 2D2JA 2QS8A 3W7IA 2XFRA 4I7VA 3M41A 1JYNA 3W24A 4UR8A 1KGXA 3C61A 3PUEA 2VFGA 4QROA 1F5ZA 1A0DA 4CD5A 3AS1A 4LBSA 3P5ZA 1EJVC 4XD6A 3WDQA 3S6DA 4Q4OA 4YCPA 2DSKA 3CXOA 3MW7A 1WXJA 3AQUA 2GQ9A 1U83A 4R34A 3S0CA 1MFVA 1B30A 1ZUAX 4US5A 6PTDA 3S9IA 5XINA 3FYOA 2ZVIA 3WLHA 2FZNA 1GOIA 3TR9A 1GW1A 3UCQA 4ZQRA 4M24A 5F4SA 1UWRA 4NXSA 2IMRA 4DBUA 3DC8A 2VL4A 3NWRA 2DZBA 3M7SA 1O5RA 4NAFA 2J7FA 4WDXA 4HD5A 5A2CA 1UH3A 3KM8A 4NRSA 1SZGA 3KVJA 3WQGA 5G2HA 4W89A 3B0PA 2QJMA 2FLIA 3ZR6A 3GDTA 2WHKA 5LNUA 2HPMA 3BJTA 1JQVA 3APTA 5FJIA 3GSMA 4A29A 1FWHC 4LVAA 1YBQA 3LYEA 3LSCA 2BTMA 1MWOA 3KDOA 1R3RA 4IMGA 3RCNA 2AAAA 4W87A 1KV8A 1M53A 1A5NC 3W01A 2WW5A 3WFLA 4DNMA 3VFCA 3CAQA 1C91A 3THCA 1G7UA 1WOAA 4TQTA 2BGSA 3EB4A 4L9XA 4OUIA 4MWAC 5DELA 3ZJ6A 5D04C 2ZWZA 2OR2A 1HKIA 1KA9F 4NP7A 2ACSA 2V3GA 3VKAA 4RNFA 2QEZA 4IIEA 4LVDA 1AZ2A 3U9IA 4HSHA 4JCMA 3NA8A 3W2NA 3WELA 4S1FA 1J8VA 1O5QA 1XUZA 4K6AA 4XIMA 2NVDA 4C6KA 4E38A 1GYLA 4QFUA 5CJ5A 1NOWA 3E5PA 1QUMA 1HJWA 4S3CA 4A3HA 3VX0A 3VTRA 1CWYA 1ZJBA 4PTXA 1EJXC 1GYNA 3M4HA 1ICQA 3T4CA 2Z2UA 2XVKA 1CEOA 2J7EA 4ZL1A 1AH4A 3ARPA 4OWGA 4D6DA 3GNNA 4F2BA 3G1YA 4PBEA 3G0XA 1MNZA 1JZ5A 5XIMA 4TVUA 1PKNA 4O8AA 3W2LA 2X7WA 3AXKA 1JRCA 2XYLA 3VUPA 2PP3A 1FKWA 1JYXA 3ME3A 2LLEA 2WMJA 1X8CA 1A4MA 2G0WA 2CZEA 3LA4A 2DGAA 1JCLA 5LNWA 1Z44A 1G94A 3IGSA 4GRSA 2DVXA 5CCZA 4AD3A 1VHCA 1R8LA 4IMAA 3RX3A 3WLPA 3O6CA 1VIWA 5I6SA 2DQXA 3MKVA 1TTPA 3M0IA 4LF2A 3SECA 2OT0A 1F05A 1X7IA 2F2HA 3WLSA 5G4WA 2GGHA 4FLOA 1OFRA