1XX1A

Structural basis for ion-coordination and the catalytic mechanism of sphingomyelinases d
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
285
structure length
285
Chain Sequence
ADNRRPIWNLAHMVNAVAQIPDFLDLGANALEADVTFKGSVPTYTYHGTPCDFGRDCIRWEYFNVFLKTLREYTTPGNAKYRDGFILFVLDLKTGSLSNDQVRPAGENVAKELLQNYWNNGNNGGRAYVVLSLPDIGHYEFVRGFKEVLKKEGHEDLLEKVGYDFSGPYLPSLPTLDATHEAYKKAGVDGHIWLSDGLTNFSPLGDMARLKEAIKSRDSANGFINKIYYWSVDKVSTTKAALDVGVDGIMTNYPNVLIGVLKESGYNDKYRLATYDDNPWETFKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for metal ion coordination and the catalytic mechanism of sphingomyelinases d
pubmed doi rcsb
source organism Loxosceles laeta
molecule tags Hydrolase
molecule keywords Sphingomyelinase I
total genus 98
structure length 285
sequence length 285
chains with identical sequence B, C, D
ec nomenclature ec 3.1.4.4: Phospholipase D.
pdb deposition date 2004-11-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 1xx1A00
2ISDA 4F2UA 4I9JA 1QATA 1XX1A 4R7OA 4I9MA 5T9CE 3NO3A 1V8EA 1DJYA 1ZCCA 3QVQA 4I90A 4PTDA 4RW5A 3V16A 1YDYA 4I8YA 1DJZA 4RV3A 2OR2A 1PTGA 1QASA 1PTDA 4F2TA 1DJHA 3QR0A 3KS6A 4RW3A 3H4WA 3KS5A 3EA2A 3V18A 4Q6XA 4QJ4B 2FJUB 1DJWA 3EA3A 3EA1A 2OTDA 3H4XA 5T9BG 4QJ5B 3MZ2A 1O1ZA 3CH0A 2PZ0A 4S3GA 2OOGA 2PTDA 4QJ3B 3V1HA 5T91A 1VD6A 3L12A 2O55A 4I9TA 3RLGA 1GYMA 2ZKMX 3PTDA 1DJIA 3I10A 2P76A 3OHMB 4GNKB 3RLHA 7PTDA 1AODA 1T6MA 1DJXA 1T8QA 2F9RA 3QR1A 1DJGA 4OECA 4F2BA 5PTDA 6PTDA 2PLCA
chains in the Genus database with same CATH superfamily
2D0FA 3BJSA 4DI8A 1DJYA 4DF1A 4JDYA 1A4LA 3QKZA 4AHOA 2QCMA 4I6VA 2BBFA 1PS9A 1XLGA 4O19A 4C1KA 1IT7A 2ZA3A 4ZE5A 2DT2A 3B4YA 4PR4A 3TJIA 4DO4A 6CGTA 3MP4A 5CC6A 5J04A 1XLHA 3EX1A 4UNLA 4RXFA 5AC7A 3H21A 1DIKA 1VFLA 1YTEA 3KBMA 5F2IA 4RR4A 3G77A 3GZ3A 3QGVA 4UQAA 1QPRA 1PZ0A 5HQLA 2UY5A 1I4NA 3NWRA 4WSJA 4TMCA 2WKJA 3RCYA 1LQAA 4AD4A 3OVQA 2I9EA 1W17A 3QLLA 1OYCA 3KCJA 3M5ZA 3N18A 1JR1A 3P3BA 3P2VA 3LCIA 3TQKA 4GD0A 3CHCA 1FH9A 2ATSA 3CXOA 2CLIA 4GFSA 3VNDA 3NG3A 1M53A 1B3XA 3C56A 1W1B1 3LCWA 3AOFA 1A0DA 4FNSA 3ORWA 1JXKA 1BKSA 3B9EA 3HG5A 5GJMA 3CAWA 2ATMA 3T78A 1SMDA 3TCEA 3RX3A 3WDQA 5CLWA 4DJEA 5C2CA 4BWLC 1QW9A 3AIEA 1DV7A 1CGTA 1U33A 1RCQA 1EXBA 1LLZA 5ECVA 4NAEB 5FJJA 1TJ0A 3URQA 3E74A 4O53A 4V33A 1SJDA 3MQTA 3FJNA 4C1LA 4XB3A 1QNSA 3Q58A 5EFDA 2R1LA 4KBXA 4ZODA 4DJDC 2HQAA 1X6UA 1QO2A 1TTJA 3VKDA 1GYLA 3M47A 3QPZA 4MGGA 2OOGA 4HOWA 2Z29A 1K9TA 2VEMA 1D7FA 5GNXA 3RMJA 1EHAA 2P5NA 4UFLA 1TWSA 1TKKA 3PJXA 4X22A 2QUVA 3OBAA 3GSMA 3PUGA 3TA6A 3ABSA 2QAPA 4LW7A 4LV9A 5I2UA 3LTPA 5LYRA 4PEEA 3DOPA 1REQB 3MUIA 1RCXB 3SUVA 4PUJA 3BLKA 3B06A 3VDHA 4XBJA 1AH3A 5CJ5A 4WY0A 4O1EA 1V3KA 3VGDA 1GNXA 2BTMA 1DJNA 1A3HA 1R3RA 1IZKA 3LGGA 3NIYA 3RLGA 2CLLA 5AHFA 1F3EA 1Q5MA 1A5NC 2O9OA 2GVJA 1MEIA 3TSDA 1HT6A 1E0WA 3PZIA 4S3DA 1D9EA 4LUSB 1R47A 2O9TA 2PLJA 2ZZ3A 4RDVA 1IEIA 1GJUA 1SVDA 5D2YA 4D6FA 4PTXA 2IPFA 1RK5A 1G9HA 4BY3A 4UZSA 3DFSA 3FK4A 2IQ0A 4WCJA 4NJIA 4IIBA 3SCUA 4LAZA 2Y2WA 4H2CA 1VJSA 4DJDA 1V3LA 1ZB5A 1XINA 3W84A 5A6SA 3LM7A 3DI0A 1B5TA 2LLEA 1UKTA 1H63A 3ZR4A 1H49A 3LSBA 4H9ZA 1IHIA 5IBXA 3IRDA 3W83A 1IXOA 4JS3A 3T08A 2FVMA 5EGRA 3KLKA 4E2BA 1W56A 2ONEA 4IIHA 5KZEA 4BWLA 2A4AA 4LH8A 3VKBA 1XL9A 3PZOA 4ZXLA 4MFEA 3RLHA 4PUUA 2VM8A 4KF1A 4MKVA 3R89A 3S5YA 4HZ6A 1ITQA 3TR2A 2V9DA 1EJ7L 4OFCA 3B40A 3AXKA 1QPNA 3EMZA 3NYZA 4Z17A 3VZZA 2W6RA 4FMVA 3T9PA 3VGBA 1CB2A 2E3ZA 1E73M 1XXXA 1JAEA 1JPKA 3KOWA 1H3GA 3NOEA 3ZWSA 5FI8A 3C8FA 3HPSA 3SSZA 2DVUA 3WQVA 3HJEA 3P84A 4C60A 3S9YA 1F9CA 1XJBA 4O1AA 3EB4A 2EGZA 3PBWA 5D9MA 4D72A 2ZZ2A 4REQB 3NZGA 1KTBA 1ZY9A 4F0MA 3VXGA 3HMCA 3OZMA 4TU1A 4LYKA 1R38A 4QTGA 4LNCA 2XHYA 3TFCA 1TX2A 3RMEA 1BFNA 3T0CA 1UPPA 2G5WA 1GJPA 1NOFA 1PUDA 3LHWA 3MKKA 1KV8A 3WY1A 4FNUA 1VP5A 2GOKA 1MVYA 3VFCA 3AIWA 4RKAA 4NJJA 1E71M 5I78A 3SUTA 1PJ9A 5HR7A 3RN6A 2OELA 1GZGA 4MAVA 1CZ1A 1UD6A 3W1LA 2DSWA 1DIOA 4DBUA 3PWGA 2GOUA 3GVQA 3WK1A 4MJ4A 2WWCA 1C8QA 2QCNA 4Q8OA 4LPCA 3N6QA 3I7RA 2BMBA 4UOQA 3UWEA 4QXIA 1AQ0A 4RE4A 1I2QA 1O5XA 2RHGA 2Q8LA 3WBYA 4ZTYA 2ZA1A 2DP3A 2HROA 1S3HA 3A13A 2I16A 5LXXA 1HNYA 1BRLA 4HHPA 4O54A 5DELA 1Z48A 3GXNA 3MJMA 1Y0EA 4M81A 4H00A 3AIUA 4AY7A 1HKWA 1H50A 3T4CA 3RJYA 2Q8XA 2ZA2A 4G56A 1H09A 4JTDA 1TVLA 3I3EA 4YHGA 3UF9A 2G97A 4D6DA 1XIIA 3P0WA 4HK5A 3PUEA 3W53A 5JH2A 1TB3A 3L67A 1FXPA 1L2QA 3E6EA 3GU1A 4HIBA 4DXXA 2QHAA 3LMZA 3R2GA 3TCSA 3K8MA 2A6LA 3L4XA 5A6TC 3F7JA 4UIOA 2WC4A 3CHEA 1NARA 2YXOA 3PULA 2DV0A 5KZ6A 1UMYA 3WJZA 2VWTA 1DJGA 2J8TA 1MZHA 5A6LA 2DIKA 5AYBA 2DSUA 3TN3A 1R9ZA 1YX1A 3SCNA 1OC6A 1UR8A 3BG3A 5T8GA 2DSZA 3VOJA 3KBSA 4A3YA 2XH2A 2BOGX 1FY6A 4C6NA 1FP8A 4M5PA 4O18A 3ANVA 3NGJA 1OWQA 4L6OA 5CC5A 4HCLA 3G1AA 1BTCA 4K2SA 4AC1X 5DRIA 5REQB 1CCWB 3KAOA 2JIWA 5HUPA 4DWSD 1PX3A 1W1ZA 4P5UA 1D8WA 3HN3A 1OB0A 1ZLPA 1TIWA 4TV6A 4LYRA 5CBBA 3AZSA 2X41A 1ZTVA 4LBRA 4GCXA 1T0OA 2QPXA 2IXVA 3T2QA 1UROA 2PTXA 1XBZA 3MY9A 4ERAA 1ZP3A 1DWAM 3G1RA 4LVDA 2E6DA 5CPOA 1PIGA 3WJYA 4OIFA 3IJQA 2UWFA 3CNYA 2CYGA 3BQ5A 3VDAA 5BXPA 6TIMA 4S1FA 1DWHM 4AIBA 1FCVA 3BMWA 5AZ0A 1CENA 1UP0A 3RR4A 3VGHA 1NQKA 2VR2A 1G4EA 4JTEA 4X61A 2Y89A 4P7LA 1TYGA 3IUIA 4Z42C 1ME7A 5G4EA 1ENUA 1PDYA 2RAGA 4I7UA 1KCLA 4YPJA 1MXGA 1JGIA 5AC8A 1FTXA 1SPQA 1UWAA 3R79A 5LXEA 4PMRA 4C6IA 1IZJA 4WX2A 4CQBA 2O92A 1J0YA 1ISXA 2QR6A 3MUXA 2FIQA 4A8LA 1OIMA 4IX0A 4POCA 3FDKA 3VZXA 4XKMA 4CNTA 2REQB 5AZ1A 1WKFA 1R9XA 2J7CA 3LLXA 1BWKA 3P8IA 2YA2A 1FUYA 3UGVA 4YXGA 3O8AA 1NY1A 3DX5A 4P8WA 2ZZ6A 4PULA 5T26A 3VNJA 3U2ZA 4DNMA 1PIFA 1E5NA 2FYMA 1X6NA 3OZYA 3QFEA 3QKEA 3HB9A 4FEZA 1U2YA 4LALA 3HTWA 2OLHA 2D2GA 3RAOA 4Q7IA 3G0UA 1LRQA 1XP3A 1V0MA 3VD7A 3L5AA 4C6FA 4PTDA 4IP4A 4W8AA 3P7YA 1E6PA 2XH0A 4GUIA 5CGQA 3QY6A 1LLOA 5M17A 4H6KA 3KBNA 3GH7A 7XIMA 1XICA 2NSXA 1T99A 3WQ8A 4B3LA 1W3JA 1OG0A 2YFNA 5U7SA 1O68A 4V28A 1OF8A 2E6FA 1EA0A 3UR5A 4S39A 4MNMA 1QW8A 3DECA 2A7RA 3LK6A 1F7BA 4C7FA 1QNRA 2JBMA 3UXKA 4ATWA 1Y65A 4EF8A 1HUVA 4L65A 1KKRA 1K9DA 2BXVA 3HV8A 3U8GA 2EQDA 1XDLA 4CD6A 5I6SA 3W00A 2NV2A 5EBUA 1ADOA 4CN1A 1W1IE 4CCCA 5CAHA 3WFZA 3TH6A 5TNVA 3U7VA 5AOUA 1ECQA 3HMJG 3TC7A 3SRHA 3TNBA 1WDSA 4JY9A 4ZBCA 4UTHA 1EJXC 3GIQA 5ABFB 1AUSL 2XM2A 3GU9A 1DJHA 1KFEA 2HBXA 3NQ6A 3N9SA 1IV8A 3WEMA 4RZ5A 2UZ9A 4G1KA 4AZIA 4UXDA 1UWTA 2P50A 2NQLA 3GXMA 3CV7A 4AVFA 2V38A 3AJ7A 3CIXA 4TX9A 1KXTA 3UR7A 2NWSA 3CLMA 1OIFA 4PCNA 1H2JA 1TCDA 4ACYA 4Q7NA 5AHNA 1OGSA 3BOLA 3LG3A 3TK7A 5T9BG 1BHGA 3G2GA 2EPHA 1JFXA 3TYAA 4WVXA 4Q8NA 3HQPA 3D6NA 4L4OA 3WJXA 4M56A 3MI2A 4P8UA 2WO5A 3VMOA 3DUGA 2QAFA 1XYMA 3LPOA 4LC8A 4GJIA 4PBGA 1J79A 1LF1A 1OQFA 4ROPA 2WANA 1BXBA 3M5VA 3QYSA 4JN6A 4MZ8A 3VKKA 5C2GA 2XH7A 3U9IA 2EBNA 4WJ8A 5CPMA 3H2NA 5IDZA 1PAMA 3W6YA 1PKNA 5IHRA 1EA9C 4J5NA 4M29A 4S3CA 3B8SA 2J47A 3QSTA 1UZ1A 3N12A 5JBFA 1HN1A 3W38A 3OB8A 3L5LA 2D0GA 4X63A 3D0CA 5TBOA 4NI3A 3M41A 1Z41A 1OVDA 7REQA 4QM1A 2O0TA 4KIRA 1CGXA 2P3EA 3WDHA 3BOFA 4TR9A 4MWAE 2ADAA 5HA7A 4AB4A 4ATDA 1EZ2A 3ARZA 3DHPA 1XIEA 4HT3A 5A5WA 4FLQA 3VO0A 5HK4A 4R27A 1S5WA 3PAJA 1SSGA 5FJRA 4W88A 6PTDA 1TVPA 3LXAA 1YLVA 1X6LA 2OOFA 1QNOA 2DZAA 1AJ0A 4G8TA 4S3BA 2HVMA 3CUZA 1DIEA 1VLWA 2VTFA 5GJNA 1XSKA 4IPLA 4H8VA 3MSRA 3O6AA 1R3SA 4ZCWA 3VGFA 1NIUA 4BZYA 4IQLA 4D8LA 1V03A 4ERIA 1S39A 2GUBA 4JIPA 3BWWA 1S38A 1P43A 2ZBTA 1FWCC 1GK8A 2ZE0A 1MI3A 4OUIA 2XGIA 1RV8A 4RPQA 5FSDC 4B3KA 3G3DA 2OX4A 5A8MA 1VHCA 3M0ZA 3TXVA 1B4EA 1I1XA 3ZO9A 3OA3A 4HYRA 4MPQA 4RLIA 2A0NA 3D3AA 4A3QA 1HQTA 4RV8A 4UFJA 3WMCA 2Z2BA 5DQPA 3IEBA 4H8UA 3TUUA 1FBAA 3DFHA 3AAMA 1OT1A 4WKHA 2ACUA 5IRPA 4H9UA 2W0UA 3TW7A 2CESA 2DUAA 3N4AA 1KCZA 5XINA 5DCEA 4EXAA 4IJBA 5EMKA 3EB2A 3W82A 4HQVA 3OTRA 1H7NA 2HZGA 1KXHA 1R30A 2CBUA 2ON3A 2D20A 4CEXC 1OX5A 1XF0A 4O57A 3T09A 2GSJA 3WLOA 3UWVA 1XH1A 5E5CA 4ZTXA 3GTFA 3NXFA 3TSBA 1JIBA 4IF2A 3F2DA 3WKZA 3LS9A 3CQHA 4AZHA 3WG6A 4GI9A 2YB4A 4MOZA 2VJXA 2HVNA 5FESA 4D71A 4AHQA 1JZ2A 4WZHA 2AAAA 3LBMA 3WD2A 5B7ZA 4BI6A 3S4TA 4Q32A 5H8PA 1GOWA 2ZTKA 4XTDA 2CKRA 1TWIA 1UQZA 1AH4A 1BF6A 4JHOA 3AMDA 4GXPA 2BDQA 1TZ7A 2W91A 4QE5A 1HJVA 4DF0A 1GVSA 2FMNA 3WD0A 3L65A 4EE9A 2YCLB 3THAA 1RZMA 1LOLA 2IXUA 3QHOA 3BXWA 1VBRA 1Z6KA 2FH6A 3B4UA 2OEMA 3WDIA 2Y7EA 3H2CA 3WSUA 2R24A 2VO5A 3N4FA 3TN6A 2ZWYA 3T2OA 1AD1A 1Q6DA 4CU8A 5HULA 4JIRA 3VU2A 1DPMA 1S46A 1K4GA 2NW0A 3WH5A 1V0NA 2PDIA 2XIIA 1NFGA 4DUWA 2VD9A 3WLJA 1Z8AA 3LXCA 2YFOA 4GMEA 4PMDA 1WV2A 5IDIA 4Y6GA 1J96A 2QCDA 2YA1A 2G95A 2Z25A 2WNQA 2OT1A 3URNA 4C5ZA 3DIPA 1S5TA 4V2XA 2KX9A 3JW7A 3S1UA 4PTNA 1NTHA 2FZNA 1V02A 3QW4B 2Q02A 3W2MA 1W1PA 2PS2A 1XV8A 3DFTA 5DCDA 3TTQA 1EWEA 3HGRA 1OYAA 5AYXA 1A0CA 1T96A 2ZX6A 5CAKA 5C9RA 2QZRA 3NYDA 3CQJA 2VRKA 4GQBA 4B2DA 1LJYA 3GO2A 2GJLA 3V0TA 5AHMA 5LA2A 2ZOXA 2YDSA 3A9IA 3VDGA 1NDVA 3IJ6A 3P5ZA 2R82A 2QPUA 3B8VA 3FN9A 3VZYA 3PUDA 1ML1A 2FB2A 4NNBA 2FZDA 2VFIA 3KEHA 2IKHA 3QV7A 3CV6A 2YCKX 1KBIA 4GACA 3OGSA 3Q2DA 1FP9A 4LFYA 2P53A 1PDZA 3MSDA 1HG3A 3CPUA 3W22A 4LS0A 3S2NA 1MEHA 3HOJA 1A3XA 2XGZA 4C1NA 1IEWA 2OGJA 2QPSA 1ODUA 3NDZA 5AC5A 4J3VA 5U4NA 1KTNA 4PZVA 4BR1A 3R58A 1W6TA 4F2TA 3R8HA 3WH6A 4GH3A 4JKMA 3CT2A 1B2YA 2E5CA 1G6CA 3ABXA 3W0KA 2DIEA 1BSIA 2W61A 3FGCB 4FNQA 2I1OA 4WJEA 1GYMA 4CQ9A 4HHMA 1F5ZA 5BOEA 3CEUA 4CNOA 4F2UA 3E49A 2X16A 4MB3A 3THCA 2C79A 3GTNA 4NVTA 3CQKA 4LUIA 2PFHA 1FH8A 2VURA 3KS5A 4W5UA 3WF4A 4FK9A 2E9MA 4FALA 3G22A 3O0KA 3R4IA 5LNVA 3OQ8A 1XRFA 2CFFA 3T81A 5FF2A 3BCJA 3MA8A 6ENLA 1EQPA 1U5JA 2E28A 4DJEC 3QJAA 4ACZB 3IWPA 3P60A 4FIRA 4QITA 3ARSA 1FWNA 3GDLA 3DHUA 5DMLA 3PS7A 2DH2A 1XLEA 5T91A 4MHBA 1OZMA 4RW5A 1UR3M 2X1RA 3BTNA 5G1MA 5E9AA 4X60A 1JPDX 3UZYA 4GRSA 1KTCA 3UJSA 2BVYA 2IPJA 3MB9A 2WMIB 1YHTA 3PJWA 3GDTA 3IGSA 4XD5A 2ZZ4A 4KCWA 1X39A 1YDNA 3BARA 4FZIA 2WBKA 4Y9MA 3NDYA 3H6OA 3LU2A 5MF5A 1KGXA 3NJ3A 2JGYA 3FNDA 1EIXA 3LV6A 1M41A 2VOMA 4XAGA 2DQWA 2PDMA 2A5HA 2Y4SA 2O55A 2W67A 4NX0A 5HJLA 3I10A 5BNKA 3NGFA 3MPGA 3NOYA 5D32A 2SFPA 4LUJA 4NXKA 5AVHA 1O60A 2ACRA 3RO8A 2D1ZA 1NM9A 1CTNA 2Z7KA 3W7NA 3DYMA 4J3ZA 1MMFA 1UMLA 2AMGA 2BVDA 3GTIA 1CI1A 5FJTA 4AISA 3G8EA 1NP2A 4R33A 1C93A 3AWNA 1A49A 4GJ1A 2PBOA 3FXYA 3U2CA 3UYIA 4GBUA 4RXGA 4PSPA 4DYJA 1FFQA 2GPTA 2CLEA 4LS2A 1CGVA 4IT1A 1WCGA 4H9YA 3HIJA 3BSGA 3PSWA 4GINA 1ISWA 1V6XA 5CJNA 2PC4A 1QASA 4NX5A 4PBEA 5TIMA 4XZNX 4IQDA 2E5BA 1M65A 2VELA 1NVMA 3V4BA 4RE3A 3TTYA 1XSIA 2B81A 4KWUA 2WZIA 3HO8A 2HS6A 4Y2WA 9CGTA 4FO4A 2W79A 1Q66A 2FH8A 4EXQA 1BVWA 1R85A 3G1VA 4H9MA 3MI6A 4Y7EA 4NRRA 3FOKA 1ZBWA 4LEQA 5JMUA 1F6KA 1KFWA 2QCLA 3VABA 3UNTA 3NQMA 2X30A 4GY7A 3GY1A 4HPGA 2XVNA 3QW3A 4PA8A 2PRHA 4W7UA 2YDQA 4Q4QA 3URAA 2WKGA 3LX9A 4I9MA 2J8FA 2NVDA 3FAWA 3LB0A 3S6OA 1GVOA 4GFIA 2ZX8A 3N73A 2O9PA 3BAXA 1GTEA 3LOTA 4UCFA 4LGXA 3S5NA 2VT0A 2WHLA 1TMLA 3TNOA 1SSDA 1MSSA 3M0HA 4NKCA 3RCMA 3LPPA 3NFUA 4GO8A 2NUWA 3W25A 4UBPC 3WF3A 3ZQ9A 1K03A 3ZT5A 5FIPA 3KWSA 2PEVA 2VD8A 3GE7A 4UCGA 3ZMRA 3ZLHA 5IFPA 2HWGA 3V7PA 3S1WA 4NQ1A 3E1F1 1OSEA 1SFTA 1C3FA 3T4WA 5M2FX 3UFYA 4DB7A 4J3SA 1O7AA 4PFMA 4IFRA 5DEZA 4QG6A 3A23A 3CUHA 4ZB0A 4Z1YA 3W4RA 3AFBA 3BGAA 1O1HA 3W7KA 3GHSA 3B0UX 3L0GA 3L5MA 4F0LA 1EP2A 3GFZA 1EJVC 5I23A 4FX6M 5FF4A 3GKFA 5BWAA 1TSIA 4XZLX 4AF0B 2OYKA 3WK0A 4LX4A 1E6RA 3S9ZA 1XGZA 2ZUSA 1LBFA 4B9ZA 1H41A 1E0VA 1U22A 3IUHA 3PN8A 3L4WA 3WLKX 3GWQA 2DPEA 3W28A 3GZAA 5H1WA 5HMFA 3BV4A 4US6A 3ARUA 4O16A 3UXDA 1C29A 1EBGA 2YJQA 1JCLA 4PCFA 1ONXA 1IEVA 4NZ3A 5FL1A 1TJ1A 3DKJA 2X2YA 2Q6ZA 3SIZA 4JTFA 1R2TA 3Q37A 1I60A 2OWWA 3N34A 2Z4GA 1Q7MA 4JFWA 3I6RA 1G67A 4M3PA 4ZMGA 3S1VA 3NQCA 3CMJA 1RXOB 3NVTA 1E4MM 4M7TA 3MUCA 4WK9A 1GOIA 5G1TA 4S3EA 3AUJA 1UUMA 2RDUA 4AW7A 3ARXA 2PDNA 2GVGA 1AZ1A 1KR1A 3DXIA 3UXLA 1ICSA 4UFHA 1NFBA 2TPSA 3ITGA 4RDZA 4W86A 4FR1A 2C18A 3FSTA 1YYAA 3A21A 1O5KA 4R34A 2NV9A 1PL9A 5C71A 1TV2A 3W72A 4PL2A 1D3CA 1H7WA 1PEZA 2V2HA 1RK6A 4FOKA 5TD4A 2QULA 2NQ5A 4J35A 3GBEA 1IT8A 2ZE3A 4HB7A 3PM6A 4I9AA 4K38A 3EKLA 5A1AA 1AK5A 4BK9A 4YN5A 2ISDA 3DERA 1AW2A 3BK0A 1XLBA 4GH1A 3UYCA 3N17A 1XYFA 2HXUA 3VDCA 2CZEA 4DAFA 2PPGA 3GG0A 4YHEA 2FHBA 1XFBA 1CXLA 1VIWA 2BHZA 1HO4A 3CUJA 4BI5A 4B2DD 4E0CA 2CETA 4J3XA 1ALDA 4ZR8A 1QW7A 1P6CA 1TMQA 5I3DA 1YIXA 1TV7A 4Y8FA 3OYZA 5LGXA 4ZFCA 4IP7A 1MW2A 3OG2A 4TOQA 1PTGA 1B54A 1CBGA 3FV9A 2VX5A 3B05A 1V6VA 1GCYA 4KRUA 4DWSB 3BZJA 3DFQA 3OLIA 3BURA 1AG1O 1VIZA 3AMLA 3MSGA 3IIOA 4AVOA 1XPGA 4Z2JA 3V36A 1IXNA 2YL9A 3ISIX 4AFYA 3CUGA 3TOPA 1VYPX 3AWOA 4S3KA 3WQPA 3H7RA 5ABTA 4FP1A 4Z1DA 1ZGDA 3VOHA 1E9LA 3IGUA 4KT2A 1W1TA 4R5EA 3NPVA 1X38A 2FPTA 4AUBA 4CQDA 1L6SA 2OG9A 4U31A 5DT7A 2QMKA 1H62A 1Z69A 2GJXA 3KTSA 4U4MA 4NXSA 3ATZA 1SJAA 9XIAA 2HPMA 2HSAA 1M3UA 1MFUA 3RRAA 3NPUA 5G5IA 3MYOA 3EWUA 3GBDA 3VM7A 2VXNA 3BG5A 3IK4A 3ONBA 1UH4A 3W29A 1GEQA 3ARTA 4KWSA 4BEQA 2J66A 1BLIA 1AQMA 1RJQA 3EPOA 3SR7A 2VFEA 3S5ZA 1EFZA 4ADUA 3OOQA 4GWEA 4ZSTA 4C6PA 1E70M 3GXTA 4UTTC 2VFHA 3SIMA 5MKGA 2V5JA 4IJRA 3PG8A 3CMFA 3L21A 4IXXA 4IUGA 3WDPP 2XWEA 4QG9A 4JD4A 3UP8A 4IGSA 2X1IA 1PTAA 1FHUA 3BPWA 3THQA 1R6WA 2Z24A 1UBPC 2Y61A 1AW5A 3RDKA 3L2LA 3VAVA 3QZEA 4LAMA 2PF8A 3CC1A 4IIFA 3FEQA 1YDOA 3W2UA 4RUBA 5LIUX 5A95A 4L9XA 3TMQA 3VVGA 3FKRA 3KP0A 2YYTA 1OHLA 1TWDA 3E2VA 3WNPA 2XM1A 1SW3A 4OV4A 3APGA 4QCEA 3I6TA 4HPJA 3GVWA 3LRLA 1QNQA 1V4YA 3U6WA 4GJJA 3W74A 3O7UA 4X2RA 1JZ8A 3VNLA 4K7YA 1TZ9A 5C8BB 1LWIA 2PMQA 1VB9A 2C14A 1G1YA 3W7LA 3WQFA 4KRTA 2IMRA 1OFQA 5J5DA 2YCJA 4ZENA 5E6ZA 2C0HA 1QPQA 3UY7A 4AG0A 5K9XA 1WXYA 4GUHA 2IQDA 4WXZA 2OSWA 2V8ZA 5D9PA 2F84A 3NURA 2F6XA 5G1YA 4W9TA 3CYVA 4BJHA 2R1KA 3M0IA 3W1XA 5HXMA 3STPA 1L2UA 3BZGA 3CQIA 3KOYA 1G7VA 3QHNA 4CCEA 4XV0A 3QVQA 4O4WA 1UPMB 2QUNA 4PMXA 3RRXA 4NU7A 1LUCA 1PCWA 3HG4A 3D3FA 2YDAA 2GLKA 4B3ZA 3W85A 1EC8A 2PTZA 1CX9A 1AMKA 1XC6A 3B0YA 1UKPA 3WUBA 4R85A 4GKTA 4OZOA 1E9ZB 4HJFA 3AIQA 5BROA 3TN4A 3CS2A 3NZ1A 1E4NA 3JZUA 3CZLA 3EAUA 1XIFA 3ID7A 4KESA 3VPLA 4N6EA 2FZMA 5C7HA 4AWEA 1ZBKA 3W24A 4AZ6A 1SJCA 4C91A 4JHZA 2PDQA 2VZUA 4MYAA 2GQ8A 3KDNA 3LN3A 2VWSA 1TTPA 2J6XA 2ZUUA 4E4FA 3ALGA 3BLFA 3CV2A 2PTWA 1W37A 2VOTA 2WCSA 3LHTA 4OBSA 4WEVX 2ZRVA 1O95A 3WMBA 3OZOA 1B57A 4DVOA 2JKPA 5FF3A 1TPUA 1WXZA 3LERA 4REQA 3U7BA 2AGKA 5D2WA 3HF3A 2ZWZA 2WVTA 3LHZA 1VFFA 2AQWA 1A5KC 4GYPC 1J2BA 1TE1A 2CZDA 4HYVA 3M1ZA 2J6VA 1QI0A 3W73A 1DTNA 1I2RA 1XBYA 4JQ4A 2G3NA 4HMEA 1HL9A 3Q4DA 3ICJA 3GNOA 2BHYA 1VAHA 4DN1A 4AYSA 3WQ4A 3L68A 3PHAA 5IXEA 1LT7A 4HPHA 4RDYA 3VCCA 4GI4A 3VIKA 3WUFA 1W1YA 2C13A 4KFOA 3S0CA 3NQEA 3PBGA 2V6AA 3C2FA 1BPLB 3K4DA 2ZADA 3KVKA 2ISVA 2OODA 1AJ2A 2PLMA 3L2MA 3LHVA 3T40A 3AIRA 4A05A 1W3KA 3GKAA 3A6OA 2UY3A 3WL1A 2XINA 3KHJA 2GSHA 2WC3A 3AXHA 2VVSA 3KS6A 2VUYA 1NWSA 2ISSA 3TV8A 4LVGA 4GUGA 1HP4A 1R7OA 1MYRA 1VRXA 1NWUA 1ZUAX 3EXTA 4LNYA 2E7FA 3O2LA 1C92A 2ISFA 4AIUA 1H4PA 3M7SA 2WMIA 3RIKA 3DGRA 1R46A 2WHKA 5L6UA 1KGWA 2YW3A 3GH5A 1XIGA 1UOKA 3N6HA 4MMWA 4PRWA 2HK1A 1J10A 4K68A 1TV4A 2QUMA 4M1RA 3TOYA 2Z6IA 1QPOA 1RJRA 1POKA 4C6KA 4M24A 3ENLA 4HA4A 1YPFA 3K8KA 4DJFD 2P0OA 1GGOA 4QRNA 3EKGA 1RLDA 2P88A 2NT1A 4DZ5A 4XUYA 1IZCA 2E6AA 3MI3A 3MV11 5EB8A 1DP0A 1QI3A 3BGJA 1R2RA 4WQ6A 5FD0A 5GVJA 2W92A 4NL1A 3HPAA 4WOZA 2XFWA 3CAVA 2FZBA 4JZ5A 2AMXA 4I90A 1RD5A 3RUBL 4JFTA 1QXLA 3RR1A 4O52A 2DW6A 3N13A 3CUXA 3N6JA 2E8YA 1QHOA 4IZGA 1KLZA 1JYVA 3K4AA 2FDMA 3RYSA 3QYQA 4TV5A 4LCSA 1RD6A 2YL6A 3EXSA 4HK6A 4CQAA 3QQWA 3MS8A 3EPMA 5I00A 3POCA 2J7FA 5BZAA 4P7QA 4GK8A 1W91A 3UR8A 4L1XA 1XSJA 4L6DA 4ZE4A 3IAPA 4MDPA 2E0PA 1AD4A 2GZXA 4PMUA 3MO4A 4ZOBA 4UR9A 1FWIC 3TJLA 4GZIA 2CHRA 1SR9A 3BLIA 1KV5A 2HXTA 2CXGA 3KL5A 3L4UA 5EMJA 1EC9A 4IPJA 3G0XA 4FOJA 2R8WA 3BJFA 2V5BA 3TJXA 2YGYA 5IBXC 4O0QA 1ZAIA 3CWOX 2P3ZA 3VOCA 3BL3A 3AXIA 1P0KA 3EDFA 5F7UA 1SZGA 2ZQ0A 4LWWA 1JI2A 4INFA 4K8EA 4M7SA 1BWVA 3MMUA 3MU7A 2QV5A 1T6MA 1H0GA 3OW1A 3PTMA 2WMFA 1JXJA 3PAOA 3KFTA 4V15A 1XH0A 3W7CA 1MEWA 4AYGA 3BCFA 3LBCA 2XIOA 5D2XA 5BMXA 1ZHAA 1IGWA 2TSYA 4UR8A 4L4PA 2DDXA 2BLEA 3VNMA 5LIYX 3B8TA 1HZYA 2HNHA 3TYDA 3W1UA 4NZCA 4KPLA 4IPNB 2EJAA 2RUSA 4BA0A 1R7AA 2OTDA 1KM2A 2VZTA 1TQXA 4QHRA 3F4WA 1E1EA 1F3XA 3WNLA 1WZMA 2FGZA 3C3NA 3KVLA 1P7TA 1SM9A 4DXKA 3NVDA 3HZ3A 3T0DA 4FNRA 1AH0A 3IACA 4HNLA 2ZRXA 3BE7A 3APTA 3ZJ8A 1UWRA 3QR0A 1EWDA 3N2OA 4LYPA 5GPRA 2WM0A 4QNWA 5CPSA 3GNDA 2VQTA 1FWRA 3CIVA 1R3TA 1GW9A 2ABBA 1Q6EA 1M03A 1W9VA 2FTYA 3AUOA 2GJPA 1V5XA 3GFYA 1H5YA 4J27A 3DG6A 1PBGA 4PRRA 3T0TA 2F38A 3ITLA 1UD5A 1ZZMA 2YCLA 2OO6A 2XG9A 4DUOA 1CXKA 4QNEA 4Z08A 3H2MA 2X8RA 1H1ZA 1ISYA 2PRMA 1IYXA 3ITCA 3ZWTA 4UFIA 1DWJM 3W07A 1KRAC 3H54A 3FFSA 2I9UA 4QDWA 4WRHA 3SB0A 2E1DA 2OGYA 2J9XA 1F05A 4NAFB 3O1NA 3SDOA 1RCOB 4U5KA 1K4HA 3LTSA 4B16A 1TQJA 3LZ5A 3QSRA 3VKAA 3GX9A 2EPLX 1EEXA 4KFNA 4DY1A 1W5NA 1KC7A 1GT8A 4K1GA 3MO7A 4NYUA 1VBHA 3QRHA 4FR6A 4EK7A 1R3VA 4KERA 1DHKA 2EG7A 1O94A 1ZFJA 3PUOA 3NXLA 3MJYA 4WR3A 2OYMA 3S2JA 4HSOA 2VR5A 2C8NA 3WBWA 1CXIA 4M51A 4DO5A 2BFGA 3MMDA 3CAKA 3V0SA 4AD1A 3GR8A 2A3EA 1CECA 1OABA 1JDFA 4HNOA 4ADTA 5I3GA 2WLYA 4C6JA 2VC9A 4AIOA 4GNVA 4ZO6A 2ZCGA 3SY5A 1KRBC 3GDKA 3AU2A 4JTGA 4O0KA 4F0KA 1HKKA 1Y7VA 2OZ0A 1W3TA 1YDYA 1QNVA 2OX1A 3JR2A 2PCEA 5A8PA 2DFAA 2ZRZA 3TN5A 4IICA 1V6YA 4NP7A 3LEPA 4J2PA 4AEFA 1A5CA 1WKEA 1EF3A 1ODZA 4GYKA 3CL6A 3MUY1 4O50A 2DT3A 3VIOA 3PVFA 3USBA 3ARVA 1EOKA 2PRLA 2YA0A 4H9VA 1PKMA 3OLGA 4GQ0A 4JTJA 5EPDA 1RP9A 3QC3A 1E0TA 3KRZA 1H5VA 3L4VA 1TRDA 2VX4A 1L6FA 1UR1A 1QCWA 1XLDA 4RV3A 2XN1A 3ZVHA 3OBEA 1GG0A 1AMYA 3WF0A 3CBWA 4L4MA 4AX7A 3AROA 1VPQA 3UY8A 3SQLA 3CHVA 5B80A 4WDUA 4WDWA 5CZKA 3SEPA 3VUSA 3VDBA 3B3DA 2FTWA 4PMOA 2WSKA 2Y24A 1WBHA 3TYEA 1E1CA 2CBVA 3H24A 1Q4NX 1EJRC 3M0XA 3GXDA 1CLVA 1FWBC 3AIVA 2Z1WA 3HGJA 3ITXA 2PODA 2NQHA 4MWAD 1BSLA 1AQFA 4OGZA 1XLIA 2ICSA 3L7RA 1XUZA 2F2KA 1G7UA 1DEDA 3IJDA 4NY2A 2L5HA 4DZAA 4LVFA 4O8AA 2QQ6A 1F3TA 4D8AA 5HNUA 2A3CA 3ZVIA 2PDLA 4S3JA 1MW3A 2OJPA 3A4AA 4S3AA 4JOMA 1VPYA 1ZP4A 3UPWA 3TIMA 4XAZA 2WCGA 1F6PA 4QROA 1Z3NA 2QUUA 1W1A1 1QFEA 3DYOA 3TZFA 3K5XA 4JHMA 2BHUA 5AVNA 4GBDA 3OIXA 3DHDA 1X8CA 2OXNA 2VP8A 2V81A 2PLKA 1ZPTA 2QKFA 4CCZA 2A1YA 1L8NA 1P5BA 1AQHA 4NRSA 4EWND 1PX8A 2QXWA 1P0EA 3RLVA 4GZJA 2PURA 4KH2A 4AU0A 1LG1A 2ZIDA 5DN1A 2Z6JA 3OHIA 5ABFA 7PTDA 2FVKA 3PY2A 1FXQA 3U0HA 3ZZ1A 4H2HA 5EA9A 2ZICA 3CYJA 4EACA 2BXZA 2NQJA 1NP0A 1PSCA 4NG3A 4HOXA 4HA1A 3EA1A 1MXDA 1VJIA 4UNKA 5DX7A 3P82A 3QTPA 3LNPA 4EF9A 2OLAA 2F8QA 3STCA 1R8LA 2ZXAA 4W5ZA 3UGRA 4LUTA 2DQXA 7ENLA 1WOAA 2BP1A 2FJKA 1RUSA 3DZ1A 4MY8A 2B31A 1CXEA 4W93A 3PBVA 1BVNP 1UR0A 2ZZ7A 3TX9A 1LT8A 3S5OA 1QRQA 2WCAA 4URIA 5HNTA 5A6KA 1LOQA 3TR9A 4H04A 1GZ1A 1PZ2A 1NQ6A 4F40A 3QZAA 3HQOA 1NOUA 5KMYA 2QDGA 4KRZA 4UTJA 1NJJA 5HPOA 3TQPA 3OHMB 1SO5A 4TTGA 3RU6A 4UWMA 2BG5A 1W1VA 1QJWA 1UP2A 4W89A 1WYIA 1VZWA 1B1YA 3REQB 4GO9A 4FHAA 3GDMA 3ECQA 4AXKA 2ZUMA 4AZGA 3LDVA 3W3OA 1JD7A 2D24A 4FA3A 3AHTA 3U3HA 1BF2A 1RA0A 1ZAJA 3EPNA 3W70A 1JUKA 4GNJA 3H7VA 3WCZA 4H41A 4ZQPA 1I2NA 4HPNA 4IG2A 1CB7B 1NWRA 1MRAA 4XAPA 1KFBA 3U5UA 5I09A 2NQ9A 2PSNA 2QCFA 2Z00A 3QEZA 3UCDA 4HVXA 4N0RA 2BVTA 5A2BA 3A4WA 2XTKA 3ANUA 1JDDA 3V35A 1EEPA 2YXGA 4MB5A 3W7IA 2GGHA 4N9DA 3JU2A 4IISA 4YTUA 2IKJA 1KFJA 3LCHA 2NT0A 1GPFA 4V1XA 1GONA 4R7JA 3FYOA 1YXCA 3KHDA 1CNVA 1ZJIA 1KM5A 4L1GA 3OYXA 3ME3A 4XTIA 1TE6A 3M16A 3SFWA 3NR0A 4R53A 1MQPA 4PB3A 3SRDA 4JN7A 3M64A 3W7RA 2D23A 1KR0A 3ARRA 4KS0A 4NF7A 2DZUA 3BLLA 1YADA 4L61A 3PC0A 1XR2A 1VGAA 2TYSA 1MW1A 3CUIA 3LD5A 1DL3A 4RNHA 2F61A 3C5QA 2FGLA 1KM4A 2A3BA 3XISA 4MNJA 3UZZA 4AAJA 1MWOA 1EC7A 5JU6A 3SRFA 4UZUA 3A4JA 1DQUA 4YYFA 1FDJA 2FMOA 2Q3RA 2BV9A 3HPXA 3UWQA 1JYXA 3EKZA 4KW2A 3VIIA 2CZVA 1U5HA 3W81A 3CL8A 2TRSA 5K9DA 2FFCA 4PL1A 4QJ3B 4X3ZA 2H9AA 1JZ3A 1NF7A 3M5YA 2WXDM 5AC4A 4E5TA 3U5YA 1XI3A 3L4ZA 4S3FA 3KBVA 3P81A 4K37A 2PD5A 4MF4A 2VC7A 4EP8C 4WDXA 4A3RA 1KRMA 1OK6A 2ANUA 1XW8A 5LHEA 3V1PA 3BW3A 3K4WA 1E9IA 1VYRA 4KQNA 3GC2A 3TQ0A 1J5TA 1BQCA 1ZJAA 1P1XA 3LSCA 2PI6A 5HWJA 1IWAA 5A69A 4M19A 3NO1A 3GVVA 4QJ5B 1PYFA 4WGHA 3A3WA 2ZUWA 2BZNA 1RA5A 3LHYA 1RAKA 3EX3A 3IV3A 4JNZA 1FCUA 2PDWA 4ZL1A 1OFBA 1VFOA 1OFDA 3K13A 4D6IA 5GJPA 4NNAA 1WAWA 5A3HA 4KWWA 3LGDA 5BU6A 2ESCA 4P2VA 1J11A 4ZVJA 3SN0A 1YXYA 3CPRA 1AODA 3LPGA 1EYWA 1P7TB 3AHXA 1C90A 2CNCA 1RP8A 4JL2A 4IMCA 4MB1A 1MZRA 3C2VA 1E3XA 2QUTA 5KITA 4G6CA 1BRLB 5E0FA 1Q65A 3QPEA 4M6QA 5HR6A 3EA3A 3MYPA 3EDDA 4C7DA 1J01A 3KOXA 3QF0A 4GIAA 3CMGA 5I02A 1SZRA 4ZXOA 2VFDA 4US5A 4C7GA 4H8NA 5HQEA 3IK2A 4OQVA 3N2MA 3AHYA 2FHFA 3VC5A 4DI9A 4KCUA 1T5AA 3E5PA 3LENA 3MCNA 3NZQA 3ARQA 2QJNA 3A22A 4X2PA 3APYA 4RDWA 1S2CA 2J9YA 1CLXA 3KL3A 1I1WA 1G01A 3U48A 2EPMX 4LEFA 4YTTA 2X1SA 3L9CA 2HTMA 1Q6LA 2DZWA 5CH9A 4B91A 1VQTA 3T42A 1EUAA 4XD4A 3BANA 3C4UA 1S5MA 4W8BA 3BO9A 3CH9A 2V5LA 1S5VA 2DZXA 2X05A 1WPCA 2OO0A 3G6LA 3SGUA 2DY3A 1V0KA 4R9OA 4F3HA 4MLJA 1XKYA 4A21A 1VFTA 4UFMA 1I0DA 2Y5EA 2ZKMX 3PPFA 1JJKA 5EU9A 5D04C 1TJRA 3N3MA 4N9EA 3LY0A 3LTYA 1QU4A 3N2CA 2OR2A 3EWDA 4K3ZA 3QHMA 3PBMA 3GVGA 2VGGA 2JFEX 3OZPA 4PUNA 3V75A 5DMNA 4LANA 3C3UA 4RZ4A 1QNPA 4LOCA 3WNNA 4C6BA 3AYRA 2Z2UA 4GVGA 4UQEA 4MIMA 4KMQA 1WUFA 4B5NA 3KE0A 4H8HA 2Q09A 2A2IA 1SMAA 5D8WA 3HPFA 3UJ2A 5RUBA 5I79A 3L66A 3N9RA 5CBIA 1RALA 3MZNA 5KEZA 1UBSA 5FOOA 3W37A 3TLQA 4IMAA 2Y85A 3FJ4A 2O4QA 4UFKA 2NSOA 3RPDA 4ORMA 1UC5A 5D03A 3P8JA 3PG9A 3OO2A 4RK8A 2DVTA 3PJUA 4Y96A 2PE4A 4AD2A 2OKTA 4N4QA 1OCJA 1WDDA 3A47A 2CBIA 1XIHA 4RNJA 3TROA 4OVXA 3B0VC 1UJQA 2XIMA 2VX6A 4HNNA 5DXXA 3FXGA 2X0YA 3MANA 2WMJA 1US2A 3BLPX 3Q45A 2FPYA 2QJJA 3IGHX 3RU8X 1CLKA 2J27A 4PEKA 1RLCL 3WN6A 1QATA 4E8GA 2IW0A 5JBEA 1QAPA 4GQGA 4D6JA 4NJHA 2QDDA 2PTYA 2EPNA 6A3HA 3C61A 3WX7A 5LKYA 1J0KA 2WQDA 1EB3A 4CN4A 3OVGA 4V27A 3MP5A 1XYCA 1XCWA 2PWEA 4A6GA 3UG3A 4IIGA 4PUMA 2VGIA 5KZMA 1OGBA 4FIQA 3GK0A 3EEZA 5A6AA 1TPVA 1LM1A 4Q33A 5HINA 3AMKA 2DSVA 2Y1HA 2G8ZA 4WF7A 5EKYA 5MKGB 1GVEA 3JS3A 4QEEA 3S1XA 5IOBA 4BF5A 2Y63A 4X0NA 2OVLA 3F5LA 4O4VA 1W5PA 1TCMA 1XLKA 3M46A 1RR2A 1D3HA 1XGEA 4KGLA 4DBDA 4I3GA 1A53A 1GOKA 2GJRA 4O13A 2Y8KA 4TMBA 3G1XA 3FVMA 1B9ZA 2JQXA 3V5CA 2OZ8A 4M0XA 4XISA 3UJRA 2J7EA 4C90A 4A8RA 1D3GA 2J79A 3AU6A 2X42A 2H90A 3WLLA 4JEJA 9XIMA 3ZFHA 2VCAA 2D2JA 3HPZA 1W54A 2FPVA 4O10A 3GH4A 4BF7A 2W9MA 1WNOA 2BB0A 3UNDA 4J1OA 1UWIA 3FYYA 3WIJA 1VR6A 3AICA 3W75A 1H7OA 1WZKA 3G0SA 5E6YA 1V0LA 4IMGA 3VMNA 2X1UA 4EWJA 1M01A 3UW6A 4WY0F 3EB3A 3GHTA 3U4AA 3BAIA 3QGKC 4JPGA 1FWJC 1G4SA 5LGZA 1B0IA 2JGQA 1GOQA 1QHPA 4NJKA 3H22A 4N4PA 4UTTA 2E9LA 4OOZA 4Q6JA 2PDXA 5D38A 3O3RA 4FS9A 1JCNA 4KEVA 3PWIA 2OEJA 1D8CA 6TAAA 3T55A 1IXQA 1J0IA 2WK2A 3KVJA 1TV5A 1HVQA 4HHLA 1HJWA 3R0UA 2HCVA 2C1GA 3PFMA 4U10A 4HPXA 2PGEA 3AYVA 3CHDA 2OFJA 3SY1A 1S1PA 4ICNA 3W6MA 4MNKA 3WDRA 3LCXA 4XD3A 2Z7GA 1DXIA 4QSFA 3H23A 1QK2A 4LYQA 3PBYA 1LUCB 5EMUA 2QYGA 4Z2LA 1DWFM 3EX2A 4F9DA 2VRJA 5SWUA 4GYPA 4W7WA 1S1RA 3GFXA 3MMWA 4JTTA 2INZA 4IPPA 3ZT7A 4LY4A 5CEWA 3NO3A 2FDSA 4QBXA 2OU4A 1EJSC 1OBAA 1NDWA 3WO8A 1K6AA 4BEUA 2NXHA 3EA2A 2VEPA 3EWZA 1D2KA 1LOSA 4QE4A 2TAAA 1Q8AA 1ZNNA 2G4JA 3M9YA 4MPKA 4OECA 4I5RA 4U3AA 3C0LA 3GG1A 1JQVA 4J3WA 4DRSA 1NSJA 3ZIZA 4RPPA 4UTMA 1KFKA 3TMLA 1KM1A 1AA1B 1JAKA 2G3JA 2WKLA 2D3LA 5C0QA 2XN2A 3IJ9A 2E68A 2CW6A 1OC7A 1LG2A 1QTWA 1ZCOA 3GXPA 3G6MA 4GUJA 1IQ8A 4JQ3A 4B4FA 2PDFA 2I5IA 1V6TA 3XINA 2ZTJA 4MUZA 3BCDA 3NL5A 2H9AB 1ONEA 2YB1A 1FH7A 5BMWA 4GVIA 3SGGA 1FKXA 4XX6A 1UR2A 3CB8A 4Y9PA 4XZHA 4KCVA 2VZOA 3G1YA 3MV01 1GKRA 1OCNA 1KQYA 2BOFX 2WLZA 3SUWA 2B7PA 3U57A 3ABRA 3MZ2A 3EEGA 1M04A 8XIMA 4QE1A 1C91A 2JKAA 2GSEA 3GD6A 1XLFA 2DJXA 2P76A 3BLOA 4EAYA 1JF5A 1K6WA 3EOSA 3A5FA 1E72M 1GQNA 1KGUA 1TA3B 3GNNA 1UUOA 3SRKA 4B5XA 1ZL1A 4HJWA 2B7QA 1A3WA 1Y5XA 4XO7A 4A35A 2F6KA 3PR2A 1NDZA 2OCZA 4PTVA 4DQWA 1F6YA 4PMNA 5BXTA 3SBFA 3T0BA 3TONA 1MUCA 3C86A 1TREA 4K6AA 4AVNA 2GJXB 3E0LA 3ZLFA 3N14A 3V18A 4U3CA 1B30A 1FWSA 1SO6A 2OPJA 1S2TA 3EMQA 4GQQA 4MY1A 4JIIX 4DJFA 1CT5A 2BY1A 3E2SA 2A3AA 4US5D 1TUXA 3PNZA 4QQ3A 1UR4A 4FNTA 4O14A 4E8DA 4JFVA 2XIJA 1XIMA 3UJEA 3M0KA 1FOBA 2C19A 1FX6A 3D5HA 5E9XA 3R8GA 1JL8A 1WDPA 2ZDRA 3ALFA 1JF6A 2QGYA 1FWHC 1PO9A 4YWIA 4DWSA 4GE8A 3QFWA 1AL7A 1XBVA 3WH8A 4RE0A 5CZ0A 1K1DA 3BLEA 2IKIA 3W87A 3R94A 4UUIA 3VC6A 4E2OA 4OWGA 4HD5A 4B92A 3C8NA 1CPUA 1OEPA 3HG2A 1FKWA 3O16A 2XFYA 1BG9A 5D05A 4UTKA 1ITUA 3A9BA 4XIAA 5D2VA 3BUVA 1XLLA 4JEQA 3L0NA 4ES4A 4DPPA 3EWCA 1W2PA 3CO4A 4Z2HA 2VVNA 3VKJA 4EPBC 4KIEA 4CQ8A 3KOFA 1TUFA 3PZUA 1EJUC 1L6YA 1EGVA 1VCGA 4AHPA 3F4CA 3SCPA 2WAGA 3GIPA 3SCTA 1XIBA 3LGEA 4OE7A 4PBFA 2I56A 5I03A 4HK7A 4EOUA 5K3VA 3B97A 3I7SA 1WA3A 4WD0A 5I7GA 1EH9A 4R7WA 4CNUA 2VUNA 3HU7A 3IJLA 4J3UA 5CGMA 3NSNA 4AD0A 5FA5A 4HU0A 2ZVRA 3IIVA 1H61A 2P8BA 2EPKX 4FNPA 3E3HA 1S5NA 1I9CB 4PCTA 3WNOA 6XIMA 3H2OA 3FA5A 5JIWA 1UR9A 1JYWA 1ZJHA 5CQ1A 5DMMA 5TAOA 3CK5A 2CXEA 1Z42A 3AIBA 1A50A 4JCLA 2VEGA 2GQ3A 5CJMA 3WQ6A 3OEXA 2Z1KA 2DW7A 1E6XM 2Y7DA 3KDOA 3UVIA 3WQ5A 4JTLA 3WQEA 4I9TA 4QS5A 2W62A 3DI1A 2HVOA 4Z1CA 4JYEA 4NILA 3LCGA 4R88A 3LXBA 4LF2A 2BASA 1UA3A 2EHHA 3NM1A 3WLIA 4EVZA 2GUYA 3SSJA 4XZWA 3BQ6A 3WD1A 3M6DA 4B5SA 4GLEA 5CBJA 1GJWA 1R5YA 3DBNA 3IRSA 2DIJA 2UBPC 2AGTA 1HJXA 5I5RA 2VR4A 1X7IA 5FEXA 4TO8A 1Z9AA 3K1DA 2YCEA 2ZZ1A 4PMYA 1TR1A 5ECUA 1VHNA 4PUKA 1OD0A 2QVHA 1KBKA 4A4AA 1N7KA 4HHHA 3CWNA 2P0IA 4ILSA 3C2YA 4JN8A 3IJ7A 2DZVA 4MSSA 1KWGA 1SFLA 3LA4A 3VNYA 5F1UA 2H3BA 2ACQA 3OGVA 1ZCCA 3SCRA 1GOOA 4Y8EA 1GVQA 4EPKA 2NV1A 4C6CA 1KQZA 9RUBA 3XIMA 4AZ5A 2HE8A 3DESA 3GXFA 5I3FA 3N15A 3LHUA 3SCQA 1C8YA 4YIWA 3MW7A 4G7EB 1SGJA 3FA4A 2GVLA 1B3ZA 1OFRA 3WK2A 1AJZA 2BWGA 1XS2A 5AN7A 4D8ZA 1WDWA 1JCJA 2DT0A 5M03A 4M80A 3KLLA 3LLFA 2WVSA 4DEFA 4YMZA 4Y90A 5F4XA 1JCMP 1TX0A 2PTDA 4S23A 1UZHA 4UMCA 1GZJA 3URBA 1VPXA 3AALA 3UXIA 3W7PA 4UMBA 1F3WA 5HMEA 1K8CA 4ZQOA 1W3LA 3P6LA 4IMFA 1H7RA 1W3NA 3E2QA 4ZOAA 1ZQ5A 3MVTA 1B3YA 1XKJA 4E3TA 1BYCA 1AW1A 5LIKX 3II1A 4KWOA 3DFPA 3A12A 3NL6A 4Q4OA 3WLQA 3ZVHB 6REQA 1V08A 5C5YA 5FAGA 1YKWA 2PWUA 3MHGA 3BW2A 1UASA 2I7GA 4IIEA 4J7RA 1JVNA 1HF6A 3O63A 3NPWA 2D2HA 2J9ZA 1FDYA 2X1TA 1DQWA 4DM2A 1M9HA 1MXSA 4F2BA 2RFGA 3DC0A 5C55A 4ZQRA 3BH4A 1XDMA 1TPB1 3W1RA 3PP7A 4M1BA 5LA1A 1WOBA 2G0WA 3MKCA 4LY8A 1WDRA 2A3HA 5AB3A 4G7EA 2UY2A 1JG9A 1JPMA 4RE2A 3EDEA 2GGGA 1GQKA 3S42A 3U4FA 4DHGA 1ME8A 4IXHA 3B9OA 4LV4A 4XIMA 4P8VA 4OTKA 3KZPA 4WKFA 4IQEA 2WSPA 2Z26A 1Y5VA 1GQLA 3PPCA 1OFEA 4B9YA 4FB7A 2DGAA 4HTYA 3NNTA 3EX4A 2VYOA 2JEPA 3GNRA 4AY8A 5A8QA 1QUMA 4H19A 1ZAHA 3QV9A 1LRTA 1UIPA 3PJTA 5C70A 3IVTA 1SZEA 1NDYA 3F2BA 2X7WA 3CPGA 3MDUA 5TQLA 2WWDA 2ZXQA 3EMCA 3GDRA 4HCHA 1JYNA 2C3ZA 3WJSA 4UNIA 1XCXA 1XDJA 1TVNA 3ITYA 2J7HA 4BS0A 1RHCA 3E96A 2ZZ5A 2CHNA 1BYDA 3TW6A 3VOGA 5DLCA 1ISZA 1M7JA 3T0AA 4Q4PA 2QCGA 1XYAA 1BXCA 1EP1A 2H3DA 1VEOA 4G9PA 2NLYA 1ZU8A 3E02A 1DJQA 1J18A 4IGMA 1L6WA 1YNPA 1GG1A 1UHVA 3K8LA 3N9KA 3WBEA 4ORIA 2J4GA 4CQCA 1E3ZA 3UJFA 4V1YA 3T44A 4NNCA 1DIDA 3RF9A 1HVXA 2YL8A 2X0SA 8CGTA 3F2CA 4XBKA 4QAWA 1CIUA 3NTYA 2PU0A 1RJPA 4FF5A 3W7MA 3WZ0E 4CD7A 3PZMA 1DE6A 3BJTA 2P10A 3WQWA 3HG3A 4FLSA 3N2XA 1W2VA 2YKKA 4JTAA 4LB3A 2INFA 3SQSA 4CLMA 1HFBA 2ZDSA 3GW0A 2ODOA 3H70A 2V63A 5DT5A 3F5KA 1L6GA 1YTKA 3LCLA 4MJ2A 1B3OA 2PDBA 1T8XA 4DX3A 3E0IA 3EOLA 3PZQA 4O11A 5F4WA 4ATLA 2EKGA 3DBPA 2IQTA 4AX6A 4MKSA 3S2LA 3ABOA 5AYZA 2WVVB 3RJXA 2C1IA 4P8XA 2J13A 3NL2A 3AQUA 5FACA 5AFDA 1OFOA 3VIPA 5ENLA 3KRBA 4MY9A 5AYYA 4XWUA 2DZPA 3B9AA 5I3JA 4UR7A 1XPYA 4F66A 2CIPA 3CZKA 1KFLA 3GC5A 4MJMA 2DZTA 4AC7C 2VC5A 5FL0A 2NUXA 4F4RA 2ZRYA 3TWAA 4FPSA 1I0BA 4PRTA 5FEPA 1K8XA 3TP4A 4LUYA 3VIMA 4A2SA 2DZBA 2FKPA 1JDAA 4JFUA 2JKEA 3AS2A 2PWHA 2XN0A 2EF9A 2WSQA 5A2CA 5DFAA 1PWLA 4YCOA 1DXFA 4IFKA 4I5UA 5D8ZA 1TIMA 3GAKA 3GDBA 5HANA 3BAYA 3JVAA 4IWWA 1K9EA 1B3WA 4TVUA 2HS8A 2YLLA 1LZOA 2VCCA 3G1DA 4IPIA 2EG6A 3VD5A 1G0CA 1QVBA 3DDMA 1E51A 4LCQA 3NEVA 4WOQA 4ZZ9A 4LQ1A 2XU2A 2QMJA 4W84A 1O4UA 3WH9A 3OIHA 1E6SM 2CLFA 3CEPA 4YNGA 3MHFA 3ITVA 3GNXA 4XAYA 5DF0A 2G3FA 2PDGA 7TIMA 3FYPA 4DYEA 3L12A 2WPBA 5FJOA 2ZFAA 1OX6A 4JYFA 5LZLA 4QLKA 3SAZA 1T8QA 3PZGA 1JCXA 3WQCA 5FCZA 3RM8A 4L4LA 3F4VA 3MUAA 2DORA 2PF0A 3U2OA 2AL2A 3LQLA 4PUWA 1S2UA 2QCDB 3MHUA 5JBDA 2BSLA 1SU5A 1XLCA 1M7XA 3R25A 4MADA 4GZ7A 4X0VA 5FJIA 3GR4A 3QR3A 1FFRA 3KCLA 1EYEA 1KBBA 3DGBA 2RH9A 3CASA 3NQ2A 3B8DA 3FLUA 5FEWA 1U1JA 1KKOA 2Q71A 5CPNA 3W2JA 4H3DA 4D9PA 3R0DA 3LUTA 3R10A 5KTLA 1EPXA 5JVLA 4LAKA 4S2CA 5CZSA 1HW6A 2PAJA 1B9BA 3S83A 3E9AA 2D73A 2YBTA 1C9DA 3VUPA 3INPA 2FB3A 4QX4A 1RH9A 3FW6A 3RILA 1EX5A 2BODX 2V30A 2FLIA 3A64A 5IM51 4GZEA 1KW1A 3CGTA 3UU0A 4DF2A 4MZ1A 4EPDC 4HSNA 1H51A 1HGYA 1JGMA 1WBJA 2WJEA 4JIQA 4HU8A 2V3EA 1V3MA 4HMDA 4FXSA 2WJFA 1KB3A 4WUIA 4P7OA 5I06A 4H4IA 4W4QA 1UP3A 4MZYA 4H9TA 4XO6A 5BXRA 3DFNA 1GVFA 5ABEA 3W7GA 4E4PA 2RDXA 1H11A 1UJPA 4GG9A 4ENLA 3W7QA 3A3XA 1LTDA 1IWBA 3TSMA 4HKPA 4A22A 2FGBA 3G24A 1F76A 3ZSTA 3LYEA 3M43A 1CGWA 2PDPA 3DCPA 5IFTA 3TYZA 1XGDA 4QSHA 3VGEA 2V3FA 4DIAA 1ITCA 3W01A 1KXQA 3FDGA 4QJ4B 2QS8A 1ELSA 1LL7A 1A5MC 4H9XA 4K7VA 1FHLA 5F2GA 1DE5A 1O5RA 3M0MA 2CBJA 4HNVA 1X1OA 5HMDA 4Q4MA 2YBVA 4GISA 4GPNA 2AKMA 1TJPA 2XPKA 1U1HA 4AXNA 1TTQA 2GWNA 4HNTA 5D2TA 4NI8A 3R43A 2QJMA 4PMVA 2Y7GA 4ZSUA 2VENA 4L80A 1BQGA 2YXXA 5AC6A 3QR1A 1BKHA 1VYSX 2CITA 3H12A 1THFD 2XYLA 1F73A 2A85A 3BICA 4ML4A 1KCXA 1AZ2A 2WMKA 2GWGA 4NIRA 1FDZA 2PA6A 4C5YA 3MT1A 1GVYA 2GYIA 2QV4A 1TPH1 8TIMA 3EGJA 4HU4A 3TDFA 3NPXA 1JULA 3K1GA 3S8HA 2MNRA 3VD4A 3GUGA 4KFPA 3ZOAA 1WKYA 1TV8A 4CD5A 4N2YA 4JTIA 4Q22A 3WF2A 4D1JA 3H4XA 1TPFA 2GDQA 2B7NA 4H6RA 4XUGA 3O05A 1K3UA 3TTSA 3PF3A 5A6BD 3TVAA 2WPGA 3C2EA 4IMDA 1OT2A 5EYWA 5CSSA 1XHGA 5LNRA 1XBXA 2V3GA 1UA7A 3TTEA 3W7EA 1PTDA 1R3YA 4O0ZA 5CPLA 3B8IA 5I3HA 4JXCA 1RBOB 3WF1A 3HURA 3H53A 2Q01A 4UQCA 4YYCA 3N04A 4HP5A 3VE7A 3LI0A 5CSRA 3OJGA 4AZCB 3QH2A 1UH2A 3EWYA 3DHFA 4JX6A 2YR1A 4ASTA 4J2MA 1F61A 2QVNA 5JQ9A 3PB0A 4M6PA 3QV8A 3VE9A 1TA3A 2DH3A 5GQBA 4N9CA 3UR2A 3P74A 4H6EA 1XLMA 4GXWA 4XG1A 3VGGA 4GHRA 3CAQA 2WZEA 3B0XA 5I07A 2QF8A 4BF9A 2R91A 1JZ4A 4Y9AA 4BFAA 2DT1A 4QDPA 1HGWA 2GVEA 1C9WA 1IT0A 1P6BA 5HQMA 2AKZA 3IIXA 3LCFA 3TKFA 1I75A 4DO6A 2VNCA 1YPXA 3WLMA 2EXOA 3BMVA 3WH7A 3PBUA 3R7MA 4ZGYA 3UVAA 3AC0A 5CZJA 1GW1A 3FJ6A 3NUKA 1UOZA 4U2YA 2NXGA 1OC5A 3W7HA 5HWNA 2VEFA 4BQ5A 2ZRWA 4H6QA 1Y8BA 2ASHA 1YRRA 2BGQA 2QNEA 4O8RA 1ME9A 4QS6A 3E38A 1RBAA 5D9NA 1AVAA 2E77A 1L8PA 1S2AA 1QI2A 4Z2IA 2W66A 1EPVA 3BSMA 3GR7A 4ML9A 3WELA 1CYGA 1H7PA 1PXGA 1CXFA 4MUPA 3AHZA 4EIVA 2QEZA 4A3HA 4OUEA 1OFAA 3RK8A 1E0XA 1PB0A 3MCOA 2P1FA 1TFVA 2R1NA 3I4EA 5BYWA 4R9XA 1GEHA 1MRQA 4K39A 2J8GA 3WD3A 3UQNA 3NEHA 3I7QA 3DFOA 4FF7A 4FXRA 3AS1A 1PE1A 3GTXA 3A3HA 5K9CA 4PTMA 1MNSA 3FIGA 3UA3A 2XISA 4XAFA 2NQZA 3C2OA 2RGMA 3UCCA 4I5XA 4I7WA 4HSHA 1W8GA 2OKOA 3MMTA 3T05A 2CERA 5JXQA 2Z0IA 3IANA 1MW0A 4C6EA 2CCRA 3OGRA 3QMRA 2I17A 2QLYA 4HMCA 2OQHA 1XD1A 4JGDA 1DHPA 3VIGA 1CWYA 1DBTA 2PZNA 1TPDA 3IIPA 2VCBA 3SQMA 4HMNA 4DM1A 1WDQA 2V3DA 3CV1A 4JYDA 1JDCA 1J93A 1QK0A 4NZ5A 2EPOA 1BD0A 2P8CA 3WLNA 1FHDA 3WUEA 2G50A 3TWBA 3RO6A 2HEJA 3PZ9A 4YS1A 4BQ3A 1RQBA 2NXIA 3G1HA 5C9XA 1V3IA 1GUVA 1B4KA 4LSBA 5FEZA 1YE4A 3G18A 1BWLA 2F2HA 4BHYA 1V6UA 5KSWA 2QF7A 4D6EA 1OYBA 2KAUC 4CNNA 2HMCA 1X1NA 4IH3A 5I3IA 3GG7A 4GKLA 2D3NA 2DU2A 1UQYA 2W5FA 1A5AA 2ZVIA 1YEYA 4AD3A 1QI5A 1G94A 3UZJA 1EJWC 3VNZA 2V0TA 3MCMA 2X0HA 1EOMA 5EY5A 5I3KA 3U2EA 4IHCA 1IXPA 4B5VA 4O1BA 1E4LA 4E38A 4LXFA 4K36A 4P61A 3CWHA 2VQUA 1XX1A 4GC3A 3ZXWA 4L7ZA 1LROA 5CG0A 4OJYA 4QR6A 4HNUA 1XYLA 4BKNA 1IWPA 2R9RA 3NM3A 2GK1A 3EDKA 3BGGA 2DVXA 4R3UA 4QISA 1JZ6A 5G4HC 3NZRA 5LHFA 3GHRA 3M0YA 4MAZA 5D09A 4A29A 5HJXA 4J9JA 1V8EA 3EYPA 4AMAA 1UG6A 3SO7A 3UZWA 3BDKA 1ECEA 1WXJA 1S2VA 1VFSA 3ZJKA 1BG4A 1HL8A 3G1FA 1BTMA 1JRCA 1W32A 2NX1A 1RQEA 1EBHA 4IGHA 2PUZA 4B4HA 5AKQA 1IEQA 4GX9A 1CGUA 1YMYA 3A24A 4PN2A 1NFPA 1JFHA 2Y5SA 3GIYA 4AD5A 2J77A 4WGXA 3R6IA 4N7QA 3GW3A 3KOZA 3M4HA 5BCAA 5CSUA 2XVPA 5REQA 4MB4A 3N25A 2XSBA 4YL2A 1Z32X 1GORA 3KWXA 1KXVA 4LC6A 4HA0A 1GQJA 4GABA 3TYUA 4O1CA 2D0HA 4ICMA 1NU5A 5C9WA 2XIQA 3AO0A 3VKCA 4CVWA 2FVLA 5XIAA 2R1PA 3W7DA 5HAOA 1SW0A 3OPSA 5E09A 4AZCA 4C6MA 3W2LA 3QY7A 4R7OA 1BYAA 4ZOCA 4DELA 4AF0A 3OLEA 2R1MA 4ACZA 4B5WA 1FVPA 3GG8A 2EG8A 3WBXA 3L2IA 3MTWA 4H01A 1MNZA 2OEKA 3FS2A 5B7YA 3AXMA 3DG3A 1WB0A 1HJQA 4RX0A 3N4EA 1H1YA 4GIEA 3OG3A 1Q6RA 3EOUA 1E1CB 1M6JA 4N6FA 1KBLA 3LPFA 4EX4A 4F0RA 2CWXA 3CTTA 1VF8A 1SZNA 3CQ0A 4HA3A 4MM1A 3AS3A 5BWFA 4ADSA 3M6YA 1XM3A 1EGMA 2FZ9A 2VGBA 4WIWA 2VDGA 3WQOA 5A94A 2XJ7A 3ITTA 1TWWA 3W1MA 2QDEA 3W88A 4PUEA 5HUOA 2QJIA 2Z1SA 5AHIA 1FWTA 4FX8A 3PZTA 1ISVA 2PBGA 2R94A 1OK4A 2YIHA 3QOMA 1Q13A 1JEZA 1E9YB 1LRNA 2A7PA 3RITA 5H6HA 4GGBA 2FJUB 1EUNA 2WV8A 2VKZG 2OLSA 1TMHA 3CH0A 3VD9A 5HOSA 1E5JA 3MBDA 1MFVA 2VHLA 3REQA 2INEA 1VEMA 4O17A 3M0JA 4HU3A 3RPTA 5CSYA 3WENA 1NEYA 1SQ7A 4Q8QA 1QO5A 4IX2A 3TU9A 4RW3A 2Y7FA 3Q67A 2FHCA 4TTUA 5CPTA 4PSRA 1N55A 2XVGA 4CU7A 1UZDA 3AI0A 4M6VA 2XFRA 3GVRA 1SYTA 2D2OA 3SCWA 1SFJA 3IVUA 3AMGA 2BY2A 1LORA 3F1QA 2E40A 4MG4A 1WZAA 3H26A 2UY4A 4LUTB 2AL1A 2GGEA 3COTA 2EAWA 4QLJA 4G5DA 3AZRA 5A6BA 1GPWA 4ZO8A 2QCHA 3W7JA 3DG7A 4DYKA 3P61A 3GYCA 3QTGA 5J5RA 3WMLA 2E8ZA 3VA8A 1KD0A 4HCDA 1JPHA 4W7VA 1OG6A 1OF6A 3VMPA 4PH6A 5EMYA 3WJWA 2BY0A 4GC4A 1I2OA 1N8WA 4IFOA 1F4AA 4NAFA 4M6UA 3GQYA 1DORA 1MDRA 2OWCA 2MUCA 2G41A 4O1FA 4LRTA 3SUUA 3TFXA 1NOWA 3N19B 4LAUA 2G4FA 3JUGA 1Q7QA 4YTSA 1PIIA 4E2DA 3QXBA 2Y8UA 3WLPA 3S9IA 1EGZA 4I7VA 2WQPA 5GNYA 3R1ZA 3TW9A 3WNMA 3WLSA 4DLMA 4H7VA 4QJ1A 2NVCA 1GKPA 1QPKA 2WMHA 1V02E 3MKVA 3N2TA 3QV6A 2POZA 1F8MA 4JDBA 2RJGA 1IE7C 2MANA 4LBSA 2DZSA 3V0UA 4DLFA 3OQEA 4LUSA 3KBJA 4ERGA 3W1QA 1XCFA 2V69A 1EJTC 2Q3OA 3Q65A 1UWSA 1P4CA 3QQ1A 2Y8VA 1E6ZA 5D33A 2HDJA 2HPIA 6XIAA 3LI1A 3ZSSA 5CXPA 3ARPA 3K46A 2HRWA 3I6EA 2Y70A 1H7XA 2OMAA 2YDRA 4HTBA 1DYSA 4MLRA 1A80A 4XVDA 5H2ZA 1VC4A 3NQAA 1UKSA 2OQYA 1R3WA 3SCSA 4NSBA 2EO7A 2AL2B 2CLKA 3BW4A 1LCOA 1P0NA 4O28A 1XISA 4NZJA 1YQ2A 4C65A 1O1ZA 2ZXBA 1EDTA 8XIAA 3O6DA 4WSHA 2WZMA 5E93A 1OJXA 4K1WA 4QG8A 3RX4A 1NWTA 2UV8G 1A5SA 2GQAA 2CEQA 4L9YA 3HGSA 1RY8A 3MC5A 3WMSA 2OT0A 1LL6A 1LP6A 3ITOA 3BAWA 3STEA 1FRBA 2V5DA 4ONVA 4O1DA 3H8AA 1Y5WA 1BYBA 1K02A 2W4XA 2PU1A 2DEPA 1J8VA 3SW6A 1OFPA 2V82A 1R87A 3DN5A 3N2BA 4JL1A 4IJCA 3VNKA 4KCTA 2PP0A 4EAMA 4FLRA 4UOZA 4P7RA 3KRSA 1Q6FA 5IHSA 1TPEA 2Z28A 3NQDA 1UD3A 1EKOA 3ABZA 3LRKA 2Z1XA 3QMTA 3QGAC 4ZOEA 1YNQA 2PLCA 2WNNA 5EBAA 4EPEC 1EIBA 1XYZA 3IPWA 1UKOA 3UPBA 1TO3A 1EX1A 3VIJA 4GVFA 3HA1A 4Y9NA 1HIZA 3RXZA 2J25A 1J0ZA 3A4XA 3UERA 1UIOA 5CGTA 5E0KA 1CEOA 3OVPA 4I8YA 3B04A 7TAAA 3GS6A 7CGTA 3RM9A 5JH1A 1OX4A 1W8SA 4ZB2A 3P14A 2GGIA 4QEHA 2IUZA 3W02A 1K7FA 3IAQA 3FY1A 2RJHA 4EXBA 3SJNA 3AYSA 1PKLA 1QBBA 4E8CA 2AQOA 1MDLA 2VDHA 4GA8A 5CPQA 3SN4A 3CJPA 5I24A 3LBOA 4J40A 4UTIA 4PCSA 1QI4A 3QOKA 1X7FA 3QBUA 5G2IA 5MHBA 3S5SA 3WDJA 1GQIA 1WZLA 4UQ9A 3R13A 6ALDA 1EF2A 2CPUA 4IL0A 1WUEA 2GFTA 2V68A 1DQXA 3O6YX 5K4ZA 1J0JA 5E70A 1FWWA 4JNMA 4H1ZA 5BRBA 1SO4A 4MTVA 3KVMA 1Q8JA 1K8YA 4W8LA 4ZQCA 3OU8A 1BAGA 3ANYA 1RVGA 1WX0A 2VZVA 2Y6ZA 3M07A 4K8HA 4Z1AA 2J7GA 3E0WA 3IV8A 2E1WA 4WLCA 4OKDA 1SFSA 3R5EA 4HGXA 1TPWA 4BCEA 1DWGM 4MWAC 2XFFA 4GI6A 4Z0SA 4WXYA 1V7YA 1U83A 1RSCA 4UQBA 3NA8A 3L4TA 5CKSA 5TF0A 1R9YA 4DZIA 2OZTA 2PDKA 3R0KA 3BOXA 4LF1A 3P62A 2C71A 4M8UA 3NDOA 3WD4A 1MUMA 5BU9A 3CZEA 5J8LA 3QC0A 5A2AA 5KZDA 2G3MA 4WHBA 3VIHA 2O4MA 3HFYA 3I68A 4NZ1A 3TAOA 5PTDA 4WJXA 2XZ9A 4Z2GA 2CZ5A 1QOPA 3ZT6A 2O9RA 1TG7A 1SZFA 2V67A 5I0DA 1GWJA 3UA4A 1EDGA 5F2LA 5E0CA 1PZ3A 2X2GA 5F1VA 3HV9A 2BGNE 1B31A 2PWFA 4YVVA 2V5KA 3MP3A 3TYBA 4GIYA 3P93A 1DJWA 4YU1A 1V77A 1VKFA 5C54A 1Q2SA 1VD6A 5A6MA 2X7VA 4UTUA 1RQHA 3R11A 2NX9A 4LS1A 3BSHA 3GM8A 1GHSA 1GVRA 1VBUA 4Q4KA 3SCVA 5A8GA 3NQFA 4MJZA 1WO2A 1SR0A 2E6YA 3B0PA 2OSXA 4D6CA 2AOSA 3J7HA 4MVAA 3KM8A 3UEQA 3VNIA 5C9UA 5KINA 3TZNA 2F9RA 1WAUA 1KO0A 1TELA 2ZYFA 4CU6A 1HKJA 1PZ1A 7REQB 1W9PA 2JIEA 1A5BA 3WLHA 1HKMA 4ICCX 2WBGA 1K7XA 1S3TC 5ABGA 1QHZA 1O6IA 2GDUA 2DUXA 1Q6CA 3SADA 2E67A 3VIFA 2PWVA 4YLWA 3RX2A 4ZEPA 3HQ1A 4HNCA 5DBUA 4GYFA 3TC3A 1PPIA 3HGOA 2Y88A 1ZSXA 2PC8A 2G96A 3GC4A 3UZ5A 2YBUA 5D4YA 1HJUA 4DNHA 3PB2A 2PWDA 1EDQA 1VH7A 3ZS4A 4AMCA 2D69A 2VI0A 3SURA 1EO5A 1M1BA 2D22A 4JCMA 2Y5JA 4UMAA 3UD6A 1UCWA 3BG9A 2O7SA 5D9OA 5H91A 4L1WA 1YNYA 3EDJA 5LSMA 3TA9A 1DWIM 3CZ8A 3MDWA 3F03K 1Q45A 3SGZA 1PV8A 1K70A 3RCNA 4YTRA 4KEZA 4UTFA 4LJ3A 4CD4A 1W9BM 3OLDA 5DMYA 1J9YA 1QR7A 4F0SA 3E12A 4KGJA 2FFIA 3HJZA 3T7VA 3TE9A 2J7BA 2WSRA 2QCEA 1Q7ZA 3GTHA 1OINA 3CB3A 4UB9A 3TEVA 4LRSA 4ZQMA 2ZUVA 1H0IA 1DOSA 2ZC1A 4MWAB 1KNWA 4PGLA 4LU0A 3LMYA 1XLAA 2OQLA 3VYLA 5BXSA 1UYQA 3UWYA 1W3HA 3WYZA 4TVDA 4L6HA 3WQGA 2YYUA 1VBGA 4XSLA 1PKYA 1JD9A 4PODA 4TIMA 4XBSA 4CEUC 4DJED 3POHA 4GY0A 1FCBA 3B8UA 1I8JA 1ZBVA 2JK2A 4ECLA 2GK1B 4NASA 4YVXA 5A8OA 4Q6XA 3VI2A 2WOQA 3C0JA 3C0QA 1EL3A 3CZGA 1RPKA 2CWNA 3QQ0A 3B9NA 4K8GA 4RZ6A 1YBQA 2A79A 3PFRA 4QQUA 1PX4A 3SECA 1EP3A 4UTWC 4Q8UA 4IUOA 1QWGA 4JR5A 5CZTA 4AY1A 3PTKA 4F48A 4XZBA 4N9BA 1MQRA 3CL7A 5LNSA 3UPMA 2J78A 3AS0A 3QZ6A 2PCQA 3ES8A 3AHVA 4NT0A 3QPYA 2WW5A 1NF0A 5HDRA 2BNJA 3WFLA 4JIEA 5HJYA 1ZBCA 3UWUA 4WSKA 3OODA 3C52A 3SUSA 2NUYA 1DJIA 4QFUA 4TX8A 2ZXDA 5CC3A 4JKLA 2X40A 3O6CA 2VL4A 3THUA 5FJPA 1DJZA 4HZ8A 4DWDA 5JIPA 4DAIA 2YZRA 2YL5A 4GIRA 3YPIA 4CNSA 4CGTA 2CLPA 5AHLA 1C7TA 1TJ2A 5F4SA 3LNMA 2RDTA 2VX7A 2BS9A 4AIEA 3DENA 4NYYA 2JE8A 3MSYA 4I8DA 2ZUNA 3FKKA 2EKCA 4XZMX 3LM3A 3N29A 3CHFA 4DUXA 3LV5A 2REQA 4W85A 2V5CA 2F7FA 2WNWA 1DKWA 1YTDA 2ZC8A 2VEKA 2J75A 3CLWA 3RM4A 3KBWA 4D2JA 4IIDA 1I2PA 1UC4A 3S3GA 1Q6OA 4YCPA 4CVUA 4UC5A 3MBFA 3UG5A 3GXIA 3NSMA 1PWMA 2W3ZA 3T6CA 3WFAA 4PYSA 4JAWA 4PE8A 3ZR6A 1TZZA 3TTOA 1XD0A 4Y9OA 1MO0A 3M5XA 4XZIA 3K30A 5EFFA 5M3WA 4DUVA 2WMGA 1PYMA 3Q94A 3S6TA 2YOCA 2E5DA 2PDUA 4OBRA 2DSKA 3IGXA 4OV9A 1J6OA 5A6JA 5HBFA 3FX4A 3O06A 3WUGA 2PB1A 4AWUA 3L23A 1UW9A 1E15A 1Q2RA 3RFAA 3AISA 3FA3A 3OVRA 4JTUA 1R0MA 2BXYA 2VDIA 1VEPA 1C8VA 1HTIA 2VZSA 3O9NA 3V3WA 3W1NA 1NELA 5C6MA 3SZ8A 1O5QA 2QCCA 8RUCA 4IOTA 4J28A 3LRMA 4D1IA 1HXJA 1L0PA 4Q8VA 1A4MA 3ZLGA 3DEQA 1TR9A 2ZUTA 4WKAA 3PPHA 3GNPA 1IR1A 2EJ1A 5BOFA 3WL0A 2OWXA 3VX1A 1Q85A 5BRPA 5G2HA 2PD9A 2JF7A 3C2RA 5DXYA 3ELFA 4ZQNA 3EOEA 3DFYA 5FJUA 1X96A 2POTA 3W27A 4RCXA 3P80A 2IS7A 1UD2A 4AWTA 2CKSA 3PWAA 1SO3A 3H55A 4PMZA 3ONCA 5DANA 1ADDA 2PP3A 4CD8A 4JTKA 3KX6A 2ISWA 5K4XA 3FEMA 1WE5A 4X9SA 4E6MA 1LLWA 1OM0A 3M7WA 4ZFMA 3UCQA 4L64A 4EKJA 1US3A 4W87A 1WQ5A 4OU1A 4JNYA 1P6WA 1IIGA 3RGTA 5LA0A 4LBUA 4PMJA 4JICA 4DBEA 3NZPA 3L0KA 4AZBA 3VILA 4ZO9A 1JCYA 3TC6A 2I5QA 2GDVA 3CTLA 4QGCA 2NX3A 4JQAA 1ZENA 1FWEC 1T41A 4MYXA 2WHMA 4B5UA 4JTRA 1K7EA 1US0A 1XQLA 3KW3A 2PZ0A 2YW4A 1V93A 4PB4A 4TVCA 3RPMA 4PCPA 4XKYA 4A2RA 4DXVA 1BEUA 1HO1A 1OCBA 3KP1A 1KM6A 2B0MA 4QIUA 2I57A 2WJZA 2XWDA 4OHQA 1JUBA 5HWMA 5K2ZA 1KM3A 5K7JA 1PHWA 3H7UA 2VGFA 3SM0A 3H4WA 4AZ7A 1YBQB 2HISA 3G1SA 4XKYB 1RPXA 4AH7A 1VCVA 3FAXA 4L9ZA 2XH4A 2ZX7A 1BGAA 2DUZA 4Z0JA 4XK2A 4YTQA 3V16A 4RZBA 1XIJA 3AMCA 3I3BA 1D7KA 1P0BA 1Z7AA 4C6QA 1IF2A 1P1MA 2RKXA 3WLTA 3VD3A 5LIXX 1XUUA 1Q63A 3UG4A 3EWXA 3O0FA 3L4YA 2KZHA 1QMLA 5L9FA 2J7DA 2FZ8A 3DC8A 4IGNA 3FSUA 1KFCA 2C16A 1I6NA 1EQCA 2HNEA 2IPGA 1IEXA 2V2DA 4XSMA 1RY0A 4JX5A 2Y0FA 1S2WA 4ZO7A 3EWBX 4GNKB 1M5WA 1JCTA 4IM4A 4IMEA 4FOUA 2IPWA 3KZSA 3GU2A 2F6UA 1I45A 3KUMA 3KTXA 3ZR5A 4NJGA 2WZHA 1KBJA 3GYEA 3BMXA 5F2MA 1GKQA 1VLIA 2BOEX 1X98A 2WYSA 1CXHA 3K2GA 3FHAA 3JZEA 1W5MA 3PNUA 3W23A 3BAKA 1PCKA 4O15A 1E6QM 2ABAA 4Q7BA 4CNPA 5DY3A 3CO8A 4GCAA 1FA2A 3FCPA 1CGYA 1MUWA 2JEQA 1JZ5A 3AYTA 4KETA 4UOJA 3SFKA 3GHUA 3NQGA 3JRKA 4GGHA 3S46A 1W3IA 3STGA 3LQGA 4RJEA 1JPIA 2PGRA 3AJXA 4PTWA 3NCOA 1YXDA 2E9BA 2YX0A 2QGHA 3H4GA 2PGFA 1OY0A 2R6OA 3S1GA 1W31A 2HE5A 1BXNA 3MWAA 1HX0A 1J12A 1VRDA 2PDJA 3ZJ7A 3EX6A 1P0DA 4JTSA 1VENA 3PZNA 2YCIX 2CC0A 3ATYA 1XFCA 5G4WA 2ZRUA 5XIMA 1LQ0A 3VK5A 4RNFA 1B90A 4WY0B 3ARYA 2C1HA 5C2XA 5DY2A 1LBMA 1XG3A 4E3VA 4JIHA 2B7OA 2PGWA 1R3QA 2A7NA 2IKGA 4HYWA 4HZ7A 1JNDA 3USZA 4FX7A 4NHVA 1OCQA 3CT7A 3PANA 3UZXA 1FHVA 2C15A 1VS1A 1ZALA 4UTLA 3NO5A 4OOUA 1CW2A 2XZ7A 3D46A 4LAOA 1UD4A 4E2VA 1R86A 4F79A 4H7CA 4U28A 1LBLA 3VOIA 4WDTA 3V1HA 4DZHA 3EBVA 3CU2A 3H2AA 3NSXA 2I5GA 2J62A 3P5YA 2C0AA 1LL4A 4Q4SA 4J4KA 2GL5A 2HV5A 1UWQA 1AL8A 4BQ4A 4IFKB 3W2KA 3KRUA 4NAEA 3CUFA 2H8XA 3GUWA 5AY7A 1A5UA 4GQRA 4LT9A 4UTWA 2VEIA 2X09A 5CCZA 4FI4A 3FHQA 3MVIA 4MDOA 1VFMA 3WEZA 3V5FA 4FAMA 1G5AA 1ZJBA 3WEOA 4B90A 1W9DM 2GGJA 4S3GA 5C7VA 3V5OA 1XG4A 3KL0A 2RDWA 3I4KA 4HN4A 3IVSA 2WVVA 2NWRA 2PP1A 1EO7A 2YSWA 2CLOA 4AWSA 1XQKA 4KWVA 3TJ4A 2GJNA 1M7PA 2YZ5A 4JBRA 4GVHA 5LNWA 3FJLA 2FQIA 3WLRA 1E55A 4MFDA 2WM1A 5BW6A 2XIBA 2GUUA 5C9ZA 1UB3A 5ABHA 3D47A 2J88A 4ZA0A 2VMFA 1E6NA 2WNZA 3KXQA 3GB6A 4C6OA 4LVBA 1VCFA 1B3VA 3E0VA 4P7NA 1E0UA 3ZM8A 5DO8A 4AEOA 1E1FA 1IIHA 3F4NA 2VC6A 1OGGA 3A5VA 3PSVA 3GAYA 5FAJA 2WJDA 4U2ZA 3M0VA 4IL2A 1W9XA 1EXPA 5EL1A 3PTDA 1G4PA 2ALRA 4CN6A 5H8UA 2BX7A 1K77A 3BAJA 2ACSA 1DTUA 1KCKA 1F8IA 2PDYA 4MWAA 2BY3A 1JNEA 2XGBA 2C91A 4LCRA 1GHRA 1KWKA 3IJ8A 2NLIA 1XRSA 1V51A 2QJGA 1GOXA 2BVWA 1N8IA 1A5LC 3W1TA 1H1NA 4JY8A 2PWGA 2HBVA 4PUDA 3QLDA 4JKKA 1XIDA 3T2PA 2AAMA 2XVLA 3C6CA 3ARWA 3UXAA 2E4TA 3NAVA 1C7SA</