1XX1A

Structural basis for ion-coordination and the catalytic mechanism of sphingomyelinases d
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
285
structure length
285
Chain Sequence
b'ADNRRPIWNLAHMVNAVAQIPDFLDLGANALEADVTFKGSVPTYTYHGTPCDFGRDCIRWEYFNVFLKTLREYTTPGNAKYRDGFILFVLDLKTGSLSNDQVRPAGENVAKELLQNYWNNGNNGGRAYVVLSLPDIGHYEFVRGFKEVLKKEGHEDLLEKVGYDFSGPYLPSLPTLDATHEAYKKAGVDGHIWLSDGLTNFSPLGDMARLKEAIKSRDSANGFINKIYYWSVDKVSTTKAALDVGVDGIMTNYPNVLIGVLKESGYNDKYRLATYDDNPWETFKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sphingomyelinase I
publication title Structural basis for metal ion coordination and the catalytic mechanism of sphingomyelinases d
pubmed doi rcsb
source organism Loxosceles laeta
molecule tags Hydrolase
total genus 98
structure length 285
sequence length 285
chains with identical sequence B, C, D
ec nomenclature ec 3.1.4.4: Phospholipase D.
pdb deposition date 2004-11-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 1xx1A00
2OTDA 3KS6A 4R7OA 3KS5A 4QJ4B 1DJYA 3CH0A 3L12A 1DJWA 4I90A 3OHMB 1DJIA 3QR1A 3MZ2A 1QASA 3V1HA 6PTDA 3NO3A 1DJHA 4I9TA 3RLHA 1GYMA 3H4XA 1DJGA 1DJZA 2PLCA 5PTDA 2F9RA 7PTDA 3EA2A 1PTDA 2P76A 1PTGA 2ZKMX 2O55A 1XX1A 1V8EA 3RLGA 3PTDA 5T9BG 1T6MA 4RV3A 4RW5A 3QR0A 5T9CE 3V16A 2OOGA 4F2BA 2ISDA 1O1ZA 3I10A 4OECA 4PTDA 3EA3A 3EA1A 3V18A 4S3GA 1ZCCA 1VD6A 2PZ0A 2OR2A 1YDYA 4F2TA 2FJUB 3H4WA 4GNKB 1DJXA 4RW3A 4QJ5B 1QATA 3QVQA 4F2UA 1T8QA 1AODA 4I8YA 4I9JA 4QJ3B 4I9MA 5T91A 2PTDA 4Q6XA
chains in the Genus database with same CATH superfamily
5HMSA 3CJPA 4DY1A 1LTDA 1PE1A 2F61A 1FKXA 4Z2JA 3GFZA 1KM0A 4RE2A 3I6TA 2PDMA 4HN8A 1RY0A 4F66A 5TNVA 4NF7A 1MW2A 4JN8A 3C3NA 3E02A 1BF2A 2J25A 4JHOA 4MJ4A 4C7DA 2E28A 3R4IA 5GPRA 2V82A 3EZ4A 4HBKA 3NZQA 1C7TA 1JQVA 4QNEA 5EU9A 1AQMA 3P93A 4JEQA 1T6MA 4GYKA 1GORA 1RBOB 2PMQA 4PMOA 3PBWA 3RX2A 4IJBA 1I2QA 1HIZA 3IK4A 1U22A 2OOGA 3MP5A 3MMDA 3OG3A 1ICQA 2XM2A 3H7UA 4GZJA 3NQBA 5A6JA 4GGBA 1ITCA 3U2EA 1CENA 3GQYA 4KRZA 3WIJA 3S1GA 2DH2A 3TSMA 3KX6A 4O1DA 3MI2A 1VFOA 4U10A 3FW6A 3L7RA 4MPQA 2ZE0A 2FHFA 1QUMA 3ORWA 5LXXA 1JPHA 5FJTA 1S5TA 4CQ9A 1TV7A 2QMJA 3RN6A 2DIEA 5D2TA 5HOSA 3M5VA 5A6LA 3CPGA 3W7HA 1TWZA 3NA8A 3PFMA 1X97A 3NO5A 2VL4A 4G7EA 3UBPC 1NWSA 1DJYA 3AICA 1KRAC 2VXNA 2VFEA 4ZFMA 3A47A 2ATMA 1Z3NA 1QVBA 4NXSA 3PZTA 2F6KA 2QCMA 1I1XA 1IEIA 5KZDA 1YDVA 2VC9A 3HOJA 1FTXA 2SFPA 3VDBA 1G7VA 3PB0A 4W85A 3WLIA 1XSKA 1PTDA 1VFLA 4DYEA 1PKNA 2WHJA 2GQ8A 4FX6M 1M68A 3QHOA 4S3FA 3VYLA 1R86A 4PB5A 1UQYA 3F4NA 1RXOB 3AHYA 2GVEA 5HWMA 2OVLA 2CLFA 4M19A 4HOWA 3T42A 4HMDA 3CU2A 2XGZA 4CQCA 3T81A 2OO6A 3MSGA 2R24A 4LJ3A 1VJZA 4O16A 3N2TA 3H7VA 4WLCA 2DSKA 4RNFA 3RU8X 3TAKA 4MKNA 2D22A 4NT0A 2D3NA 2XSXA 1ISXA 1C93A 3AZTA 1J2WA 1EBGA 4JZ5A 4QDWA 1XYLA 4W93A 1TJ1A 3CB8A 4MTVA 4LS2A 4ACZB 1ECEA 3E2SA 3E2QA 1MW3A 4MWAA 1NDZA 4ZQRA 1ZU8A 2FDSA 4KPLA 5IM51 2Z4GA 4Q6XA 3O6AA 2C13A 3VOIA 3SIZA 2VCBA 1WPCA 3NSNA 1XCFA 1E4NA 2HXTA 3QV8A 2W0UA 5JH1A 2WM0A 1XYZA 1Y5WA 1K4HA 1RH9A 1E1FA 1UD4A 2GQ9A 2E6DA 1MUMA 1E72M 1VH7A 4JFSA 4TMBA 3S9IA 3W7DA 3VAVA 1CEOA 1D9EA 3VMNA 4GFIA 5D2VA 5EFDA 2BASA 3EWXA 1FP8A 4PCFA 3QLDA 2WQPA 1KFLA 3VD4A 3QR0A 2BY0A 4KS0A 1JF6A 1ZJHA 3PZ9A 4YHGA 5FF0A 3BW4A 4F8XA 4D6JA 4E3VA 4OJYA 2P53A 4GABA 2OQHA 4WY0F 3COTA 1W3TA 3ZSTA 4B5SA 4EVZA 1GVYA 2J9XA 3UGRA 1J4EA 1LUCB 2DH3A 4OV9A 1IWBA 1CGTA 4KWWA 5C9ZA 1JZ2A 5CPLA 4E5TA 5CJ5A 6XIAA 2J13A 2EPMX 3UR8A 1WE5A 3FS2A 4YLWA 1T40A 2J88A 1IQ8A 3UZWA 4JCLA 3LRLA 3EX4A 1Q66A 4UFJA 3IGUA 3O9NA 1YXCA 4Q8VA 3S8HA 2Z27A 1AD1A 3LHWA 4FXRA 1TV8A 3W2MA 4KETA 3T6CA 1SFJA 4H9MA 2YA1A 4PR4A 3E5PA 4S3JA 3T05A 4AU0A 1C92A 1HL2A 1WDSA 4AMCA 3UWQA 4LUTB 3R94A 3UXAA 4DF0A 4UQDA 3FJ6A 3BURA 3UZYA 4AYSA 3UWWA 1S46A 4ADUA 3DOPA 1XD0A 1OVDA 2PDGA 1XBXA 2WC4A 3LMZA 4RZ5A 2WMFA 4MLRA 1PJ9A 2GUUA 1GT8A 1RCXB 4I7UA 4LNCA 4Q3MA 2V3EA 3UEQA 3OLIA 3WBWA 2BZNA 2ZUWA 4H41A 1XLKA 1MW0A 1VEPA 2CLHA 3T0CA 2NX3A 1W8GA 2CYGA 1Q6CA 3KCJA 4E2OA 4LAMA 4C6CA 4EXQA 4LVBA 4GC3A 3WUEA 2XGBA 1MZRA 4HCHA 3CUIA 3NPUA 2V5CA 1BGGA 3G0UA 2G0WA 2QIWA 1OIFA 3DFSA 3EWUA 1JDDA 4G1NA 1WKDA 2ABBA 4WDTA 2WMKA 1F9CA 1S5VA 4RDWA 4CD7A 4PL1A 4W88A 2WKGA 1CB7B 4ACZA 2HBXA 7REQB 1KXQA 1L2QA 1T7LA 1YTDA 2C15A 2QVHA 4H8HA 4US6A 1ISZA 1H7PA 4XO6A 2NX9A 3H22A 3AZSA 3CHFA 1BSLA 3LDVA 3FLUA 3LPPA 1P1MA 1RVKA 3CEPA 2PWGA 4YTTA 3OZMA 4CCEA 1VAHA 5D2WA 2FTWA 2W79A 3U2OA 1QK0A 1JDCA 1Y7VA 3M0ZA 4GI8A 3CV1A 2GDUA 3UZXA 3WD3A 1SJDA 4LTSA 5DANA 3DFYA 1MVYA 3KL0A 3SM0A 3TYCA 5K3VA 4OOUA 1R3VA 1NWUA 3GVQA 3VIGA 2WC3A 4Y8EA 3UZZA 4QGCA 1H49A 4KKXA 4QLLA 4A8RA 1R2RA 1GNXA 3CAWA 2QMKA 1TSIA 4AIUA 2Z7KA 3S5ZA 3TROA 3F4DA 3TW9A 3QV6A 4DJDD 1ZJBA 5F2IA 3W1XA 1HX0A 1BTCA 4REQB 5U4NA 1LUCA 4DUVA 4JTEA 2XVPA 2NVAA 2FH6A 4OUEA 2WVUA 3ARYA 4ZXLA 4L7ZA 3GFXA 1WDDA 5EMMA 2YA2A 4GZIA 2XIJA 3JU2A 3WQFA 3DYMA 4DZIA 3TLQA 1N2VA 2J75A 1ZHAA 4B2DA 1HGWA 4QISA 2X0SA 3ABXA 4H19A 1GZ1A 3W1LA 4JTTA 2E5DA 1Q6DA 2NVCA 3S83A 1GVQA 2Y24A 2FZMA 5I5RA 4YJ5A 1A5KC 1EX1A 2F8QA 3QQWA 4LUTA 3FK4A 4GUIA 5FF7A 3B8DA 4Q8QA 3IJ9A 4B5UA 2OEKA 1Y5XA 1TPWA 3GXDA 4PCSA 1SO6A 3MW7A 2ZVIA 1W3NA 4HZ6A 1FVPA 1SO5A 4JTUA 2GJRA 1Z6KA 4YCPA 1M5WA 1R5YA 5B7ZA 4HU8A 1ZBVA 1WZKA 1V3LA 4PUJA 5CC7A 3WQWA 3V35A 3U7BA 1KRCC 1J2BA 4FI4A 1W9DM 4H7ZA 2YDRA 2VNCA 3BAIA 1JNEA 4O10A 2QUMA 4H7VA 5CZJA 5BNKA 4RDZA 3VNZA 4AWTA 4O8RA 2CHNA 4LNYA 1H1ZA 3CXOA 3UA4A 1EP2A 4HNOA 3W1TA 2Q3RA 1TV2A 4IOTA 7REQA 1JZ7A 4AF0B 1R9XA 2W3ZA 3KBNA 3VX0A 3KLKA 4WK9A 1VIZA 1X96A 3NPXA 4UFIA 3VIFA 2FZ8A 3WBYA 1FKWA 3VM7A 1HFBA 3P8IA 4GK8A 1O4UA 2PODA 1ISWA 2VEMA 4B90A 4W7UA 4ONVA 2FMOA 1QCWA 2CC0A 3MSYA 4F79A 5DT7A 3EMCA 4L5ZA 3V4BA 2YL6A 2BNJA 3H24A 4CD8A 3I6RA 2G3IA 4M7SA 1E6SM 1OCQA 4M7TA 3L4TA 4KIEA 5GNYA 5C7HA 3W70A 8XIMA 4RXFA 3VNMA 5KTLA 4GO8A 4HA1A 1ZCOA 1SQ7A 3MQTA 1ODUA 1PKLA 4A8LA 1DXEA 3DHFA 4XIAA 3B8IA 1JPMA 1TVNA 1WKEA 1PDZA 1E0XA 2CU0A 3WY1A 5F2MA 2WJDA 3RG6A 3LG3A 4JYDA 4NUWA 4FAMA 4Q7NA 4PODA 1MXDA 1KRMA 4REQA 1QNPA 4IGSA 2NQZA 1X38A 3CM4A 1DE6A 4GXWA 2OX4A 2XUCA 2A3BA 5G2HA 2DU2A 3ZSSA 2R94A 3OYXA 3CQJA 3UFYA 1QHPA 2O7QA 2DQWA 1A0DA 3TN5A 1WXZA 3RLUA 1DV7A 4A05A 3PZGA 4CQ8A 2OLAA 1SSGA 3GHTA 1I0BA 3VNIA 2CBIA 4BJHA 4LANA 4A8IA 2E67A 3NQMA 1CZ1A 3SCNA 5I3DA 2PTYA 2X30A 2AKZA 3IK2A 3C2VA 2ZRYA 1Q8AA 3OBEA 3THUA 2FHCA 2R1LA 3QFWA 3QMRA 3O06A 3W37A 1T99A 4NKCA 4JGDA 5FACA 1W5PA 1GJUA 4PMQA 2DZBA 5EY5A 4PMYA 5I02A 2IS7A 1JYVA 2DSWA 3JW7A 2HEJA 1KV8A 1Z32X 3C86A 1GQJA 4AWSA 4MOZA 3SURA 3DH7A 4J5NA 1IT7A 3K8KA 4ATWA 5T9BG 7XIMA 3N4FA 3G1YA 4F9JA 2QXWA 2DT0A 3CAVA 4ZQMA 4GVFA 1LBLA 2VURA 4M1RA 1EC7A 2ZBTA 3GLCA 3CL8A 1H7RA 1KQYA 3AUJA 2VEPA 1XG4A 1GQIA 4NHVA 4PMXA 1V6WA 2VR4A 3U48A 2NQHA 4MJ2A 3HGOA 4GI9A 1UHVA 5DXYA 3N29A 5CSSA 4L80A 5FI8A 1KR0A 2HNEA 2POZA 3W7RA 2WLZA 4Y96A 4AZIA 4N0RA 1LWIA 3CBWA 3DGRA 3KTXA 1QI5A 3WDPP 4HPJA 4AF0A 3TA9A 2PWHA 3GU1A 3NM1A 5I3IA 2NQ5A 1ONXA 3NUKA 4GJIA 4A29A 4WUIA 4KCVA 3N6HA 3CH0A 1YIXA 4DBSA 5G4EA 3O0FA 3ITXA 5CCZA 2C6QA 4XZWA 1P48A 1XP3A 1JL8A 1V0MA 5IBXC 3RLHA 3FY1A 5I3JA 3H4XA 3WFLA 1JD7A 1B3WA 1G01A 1Z42A 3PHAA 3APGA 3PC0A 3SECA 3PPGA 4YCOA 4OUIA 1IT0A 4NYUA 2B31A 1P0KA 4ICMA 3P5YA 3VOCA 2L5HA 2YOCA 1W54A 2G4FA 4RV3A 5DCDA 3BJFA 4KWOA 2ZYFA 4I9AA 1D3HA 5ABTA 1OX6A 3G8EA 4C6QA 4AD0A 2FKPA 3E38A 2PWVA 4XTDA 2A85A 2R9RA 3B3DA 1VHCA 3WH9A 3VOFA 3I3EA 4FHAA 3ES8A 4I5UA 1VKFA 4C6LA 5LNSA 1K8ZA 1OX4B 2WVSA 3GZAA 4PL2A 5BCAA 4DJEA 4Y90A 2EPOA 3INPA 1TA3B 1EJ7L 2PP3A 4L61A 3SCVA 1I2PA 4L1WA 1KCLA 1G6CA 4F2TA 2W91A 3NQAA 2BDQA 3SQLA 3B8WA 2E5CA 1E0VA 1GOOA 2E6YA 1UWTA 2PDJA 4QG8A 2E9MA 4BQ5A 2O4MA 3EOEA 4JY9A 5HUPA 3WH7A 2ASHA 3PSVA 3TQKA 2CETA 4QQ3A 2BODX 4HMCA 2Y8VA 2OZ3A 4IT1A 3ERPA 3RR1A 2DORA 2PDHA 1FDJA 4EPEC 2OPJA 3EPNA 4P7LA 3LY0A 5E1QA 3LM3A 3W1NA 3PG8A 3WLRA 3NNTA 3WD1A 1SZNA 4Q8PA 3BMVA 4TTGA 4H6QA 1H2JA 2WAGA 2NT0A 1W1B1 4HTYA 2YL5A 1SM9A 1V79A 3B9OA 1XWYA 2G3MA 2VELA 1R87A 4QDPA 4ATDA 4LAKA 5F4SA 4I8DA 4RUBA 1PS9A 2XIOA 3PUEA 5M5DA 2VX6A 2E3ZA 8RUCA 3LI1A 3THAA 1CXIA 2ZZ7A 2V30A 4ROQA 3D3AA 2X2YA 2FVKA 4NX0A 5K2ZA 3AC0A 2WVTA 5FSEC 2DSUA 1H7XA 4A2SA 3VKCA 4QS5A 1KM5A 3I4EA 3Q45A 4R7JA 4FNQA 5DQPA 3V0SA 5JU6A 4V1YA 1OM0A 3GTXA 4BI7A 3N2BA 3OLEA 2Y63A 4QXIA 2VQUA 2C0AA 3WK2A 4P5UA 5DF0A 4GUJA 4AX7A 3T0BA 3W2LA 3MMTA 2DY3A 2FHBA 1E5NA 1V3MA 1Q6GA 3LCLA 1C91A 4NRRA 4H6RA 2VM8A 3VE7A 4U28A 3NO3A 1J0KA 1HKWA 2VZSA 2PD5A 4Q4OA 5IHRA 3BSGA 4U33A 3AXKA 3W3OA 3NQGA 4GQ0A 1ZPTA 4M80A 4KF1A 4UTFA 3GIYA 1V8EA 5EA9A 1V7YA 3KP0A 1IYXA 2V68A 1A5NC 3WJYA 1FX6A 2G95A 1WDRA 1PBGA 3FAXA 2OX1A 4MVAA 2CBUA 4GX9A 3ONBA 4MYXA 3GIPA 3WEOA 3AS1A 3MWCA 2FMNA 4I7VA 3EDFA 3L65A 4X2PA 2ZXDA 4OIFA 2CHRA 4X3ZA 4QE5A 1GUVA 4CD6A 2WQDA 1G4SA 3R8RA 1OX4A 2R8WA 3PM6A 3OO2A 3M64A 1OG0A 1TA3A 3UQNA 1LBFA 2AAAA 2A7PA 4YVXA 4FPSA 4RE3A 4YYCA 1DXIA 3HIJA 1V0KA 1RA5A 3VKBA 1E6XM 3NJ3A 3ZVIA 1OBAA 2PSNA 3AIWA 3ZS4A 4Q4SA 3ITLA 4HNVA 1Z9AA 1HKMA 3DESA 1V3IA 1KTNA 4GBUA 2JQXA 4AZ7A 4BF9A 1E73M 4IMAA 1LRNA 1OFOA 2OU4A 4AFYA 5M03A 5DMYA 5CPOA 3TAOA 3C61A 1EJRC 3O1NA 3RM4A 1EA9C 2GSJA 3O3RA 1R30A 3ZT5A 1G67A 2ZUVA 3WUFA 5LA1A 4QE4A 4Y2WA 1OIMA 2A3HA 2GFTA 4US5A 3AS2A 3N2CA 3HGRA 1I4NA 5XINA 1C9DA 3H26A 4HK7A 4NL1A 1POJA 3W75A 3TN3A 1E70M 1EJUC 4AUBA 3B03A 2PB1A 5ECUA 2ISVA 1P6CA 2ZRVA 1O5QA 1EF2A 1OCBA 1IV8A 3AJ7A 1BKHA 5CJMA 5BRPA 3VKDA 5FJIA 3ANVA 1JZ4A 2HV5A 4YPJA 1J5TA 1KCZA 1W1A1 1JUKA 1N7KA 3A22A 3EMQA 3WLOA 1XF0A 1EQCA 4JQAA 1DJNA 4DJFC 5LXEA 1J6OA 1TMHA 3WZ0E 4DO5A 3BANA 2X0HA 1UMLA 3W00A 3USBA 3N4AA 3GH4A 3ITTA 3G77A 1MDLA 3LTSA 4DB7A 1AH4A 4QJ5B 3PJXA 2CZDA 4LOCA 2PWDA 1FXQA 3AOFA 1OGSA 1A5AA 3CQHA 3EYPA 3WQOA 1O7AA 2X1SA 4NJGA 4FF5A 3KBJA 5DEZA 2VX7A 4IHCA 2D0FA 2CPUA 2OG9A 5E93A 4LRSA 3W1MA 1QI0A 5CGQA 3MZ2A 1VBGA 1TVPA 1LRQA 1BAGA 4YMZA 4XVEA 2FTYA 3UA3A 3WH5A 1UD6A 4RXGA 2RJGA 1QI2A 1K70A 3CUJA 2WNNA 2BY3A 3SJNA 3JVAA 3B04A 4B5VA 2REQB 3GTNA 4FNTA 4GKTA 2AL1A 3FOKA 1BYAA 4EKJA 3AAMA 4KWSA 4GGHA 5TAOA 3C2RA 2C0HA 1NP0A 2E0PA 3V5CA 3G1RA 4OVXA 4NXKA 4XK2A 4YXGA 3W24A 2F2HA 3TFCA 1XIMA 2QJGA 3PPFA 1NTHA 3QLLA 3WNOA 5C9XA 4BQ3A 4UFLA 3P62A 4KEVA 1MWOA 5HA7A 1EO5A 4S3AA 3PG9A 2IKHA 5CBIA 2VEFA 4IIDA 2CWXA 4F4RA 2V81A 2OYMA 1GOIA 3A3HA 3LRMA 1DJQA 1W2VA 1UYQA 2EPNA 2RHGA 1MNZA 3PUDA 5HDRA 1R85A 1G1YA 5AHEA 3GYEA 3R2GA 1EJXC 2J66A 4MY9A 1ZP3A 3HPXA 3E0WA 2ALDA 2DVTA 4TR9A 3G1DA 1NQ6A 3KS5A 3ZOAA 3HPFA 4U2YA 3SCSA 4UC5A 3S46A 2GK1B 1Q8JA 1VR6A 1AQ0A 3W2NA 2Q8XA 2V9DA 3WF3A 4M56A 2QCHA 2DT1A 3A3XA 1OK4A 2YJQA 4C5YA 3IJIA 1HP5A 4HNLA 1AW2A 1M04A 5GQBA 3MU7A 1WAUA 1XRSA 4JFWA 9RUBA 4HZMA 2Z28A 4MHBA 3HGSA 3R0KA 2WKJA 4O0KA 5H8MA 5DRIA 2I17A 2WHKA 3LGGA 2GJPA 4O0ZA 4HPHA 2ZRWA 3T08A 2J77A 1QFEA 3FEMA 4FXFA 2X09A 1MRQA 3CTTA 4W89A 2X1UA 1WDPA 2H3DA 3VKKA 3KAOA 2ICSA 2FH8A 1XLEA 3QN3A 2YCIX 3KE0A 1FWRA 1PX8A 1EEXA 3IJQA 3RUBL 3G1SA 3WDHA 2EJ1A 4S3DA 4ENLA 4UBPC 1G4TA 2DEPA 1QHZA 4X60A 1US0A 4G6CA 3B8SA 1BYDA 3B9NA 1EOKA 2WMJA 3P81A 2A79A 4F2UA 3K1DA 3UNTA 1QWKA 1E6RA 4U3AA 4XQ6A 1X1ZA 1TPUA 5GJMA 2V67A 4ZXOA 1A5CA 1V3HA 1CX9A 1TX2A 1IIGA 3ARZA 4C6NA 4Y9AA 1MEWA 3TYZA 1WOBA 3RDKA 3H54A 3E9AA 4BFAA 3WH8A 4MY1A 4C6PA 5M1TA 3VNKA 4AWEA 2VUNA 3W86A 3B8VA 4WGXA 1RP9A 5LZLA 3HV8A 2PCQA 2REQA 4GJJA 1QMLA 5CBBA 3IS4A 2WHLA 3A64A 2HISA 1Q85A 3CO8A 3PS7A 3L2IA 1A50A 3QTGA 4Q4KA 1IHIA 4WSHA 4H1ZA 3S2NA 1TMLA 3D3FA 3LBCA 3VNYA 1IEQA 2PRMA 2EG7A 2VKZG 2V2DA 3IACA 1I2RA 3L66A 1JAEA 3LLDA 2CEQA 3QFEA 1HO1A 5GJNA 5I77A 3KW3A 1OQFA 1WKYA 3N9SA 4TU1A 2XFWA 1RHCA 1QNOA 3L21A 3A23A 2W6RA 4L4OA 4M51A 2EG8A 4LUIA 3WQCA 1UH3A 1UKQA 3GVWA 3NEVA 4PB3A 4W5ZA 3PWIA 2Q6ZA 1UWQA 2OSXA 5D8WA 1JGMA 3BZGA 3PZIA 1M41A 3AMDA 2QGHA 4CVUA 4I8YA 2XH7A 3M4HA 4UZSA 3S5SA 1FH8A 3ARWA 4Z2LA 1JUEA 1EUNA 1C8YA 4ATLA 2GDQA 2GK1A 4AVFA 3TTSA 1KM4A 3AALA 4LW7A 3T78A 1JZ8A 2IPJA 4IPNB 3FX4A 1QOXA 2NSOA 3XINA 1F6YA 1G4EA 3CQKA 4NQ1A 4HSOA 1ZP4A 1TPVA 1NDYA 4WKHA 1EPXA 2JGQA 4S2BA 1RJRA 1ONWA 2VRKA 1LT7A 5H1WA 1A0EA 1DTUA 2BMBA 4MB4A 4IGNA 4UTTC 5CXPA 2JEPA 5LYRA 4C5ZA 1B3OA 3FJLA 2QT3A 1HP4A 2C1GA 4W4QA 1YRRA 4JNMA 2XH4A 1E9IA 2PDBA 3BV4A 1CLXA 4DWSC 4V15A 4O54A 1LBMA 4JQ1A 1TJ2A 1F3EA 1PZ0A 3NZ1A 3W7KA 4QHRA 3IV8A 2PEVA 1H63A 2OZTA 2EF9A 2OJPA 4PMDA 2BVTA 3C6CA 4RZ4A 4WR3A 5CC3A 3AISA 3AXMA 1B0IA 2AQVA 4QCEA 1YKWA 1TQXA 4UFKA 3U2CA 4GVIA 4DXXA 2YGYA 4HHMA 3VGHA 1GKQA 3KHDA 3NWRA 2AGTA 1ONRA 2O9OA 1OYCA 2QUVA 1S5WA 2WBGA 2X16A 3URNA 2XVKA 3VX1A 4H8NA 4DVOA 1I60A 4PBGA 1J0IA 1HF6A 1W1TA 3LMYA 1M7XA 1EWEA 2OWXA 9XIMA 3CV2A 3OVPA 4L9ZA 4IFRA 1PDYA 2Y2WA 3M0KA 5REQB 5CPSA 3TX9A 1YLVA 5DBTA 1LL4A 1US2A 2X7WA 2E1WA 1MUCA 2WV8A 1OY0A 3QKZA 2J7HA 4NYYA 3S6DA 1GOKA 4Q8NA 1SJAA 3BLKA 3GBEA 1QI3A 2W66A 2WZTA 3I65A 5D9OA 2YXOA 1R9YA 4XZ9A 2DIKA 2QUUA 1FFRA 2Z25A 4FIQA 4OQVA 4RZBA 1O95A 2PCEA 2X40A 1IEWA 2AGKA 4L6HA 5BROA 2OLHA 3P82A 4YL2A 3O6CA 3ATYA 4AH7A 2NW0A 4KW2A 1JYNA 1DORA 5HJLA 3I7QA 3DBNA 4KQNA 3RLVA 1EA0A 1TJRA 3MPGA 1BVWA 2IUZA 3V3WA 5B80A 2A6LA 4ZB0A 1ZAIA 3VFLA 5E0FA 1CGYA 5MHBA 2YZRA 3LXBA 4LF2A 3C0QA 2ZTJA 4YYFA 5BWFA 4NZCA 1KBIA 2B7NA 3EKGA 3F4VA 4ICNA 4ES4A 1J12A 2ZUMA 1GZJA 3G0XA 4OBRA 4DXVA 1JCMP 4ZVJA 3APYA 2RDXA 2WNZA 4XAFA 4DZHA 2BFGA 4Y9MA 1KR1A 4IQJA 2A7RA 2QPUA 1E3ZA 3QF0A 5CGTA 1OJXA 4LEQA 1OC5A 3W28A 4CNUA 5E0CA 4ORMA 1SZEA 4K2SA 4L6DA 1KM2A 3GXFA 1CWYA 4DF2A 4O1FA 2J9ZA 4XAZA 3QKEA 4IMDA 3BL3A 2NQLA 3GNRA 3I7SA 3UCDA 4DI9A 1H7WA 1K8CA 1U33A 5CJNA 4QLJA 3KBSA 4B5WA 3RX4A 4EXAA 3CUGA 2WVVB 3WD0A 1OC7A 1CGWA 4C6MA 9CGTA 3I10A 1H7NA 2OYLA 1UUOA 3W7NA 2OQLA 3GU2A 1PL9A 2PDKA 2ACUA 1XIBA 2OWWA 3BAYA 3VI2A 2OB3A 3WG6A 4D9PA 3UYCA 4TIMA 5AHLA 4R27A 2Z7GA 2Z6JA 3KUMA 5FJUA 2QDGA 3PANA 3WBAA 3A5VA 1QW9A 3ARTA 4NSBA 3C8FA 3GDKA 1NVMA 3FV9A 3OIXA 1T8QA 1ZFJA 3GUGA 1FWDC 3W1AA 3O15A 3MVIA 3T44A 3AZRA 3QOMA 4JTDA 1P4CA 1JCJA 1MRAA 4A8NA 4TV6A 3B9AA 4F0HA 1JF5A 4OU1A 2QEZA 1HW6A 4HOXA 4H9ZA 3BPWA 4MFEA 4PFMA 4QSHA 2Z2AA 5REQA 1XM3A 1LWJA 1TIMA 3VFCA 4XD5A 1DWGM 4JICA 1TVLA 4FZIA 4DLFA 2PDUA 4PFHA 1F4AA 4GVGA 2NUWA 3LXAA 1JCTA 2ZUUA 4DBEA 5A6MA 2PTZA 2I56A 2BVDA 1UH2A 3WLLA 4HIBA 4LS0A 4NNBA 1W3IA 2Q8LA 4Q4PA 1WOAA 1LOLA 1TYGA 5LKYA 2QW5A 1C8QA 4W7VA 3S3GA 5D2XA 2QDEA 2CLLA 4W9TA 2CBVA 1EBHA 4QCFA 5A6SA 3UF9A 4N9BA 4YNGA 4CN4A 4MZ1A 2HE8A 3TZFA 3S47A 2ACRA 1IF2A 1I2NA 1OFEA 4ZOEA 4WJEA 5I23A 3OG2A 2V6AA 4HA0A 1NWTA 2INEA 1QBBA 2A3LA 1G5AA 4OT7A 5LSMA 1K9FA 1EC8A 3DAQA 5KMYA 5E09A 1LORA 1V6UA 2CESA 2PF8A 4UWMA 1VS1A 2HK1A 4I3GA 2ZX5A 2Y62A 3GTHA 4ERIA 3HG2A 4PEEA 4JIIX 4WSKA 1TO3A 2RGLA 1M53A 4H04A 3WDIA 2QJHA 1ITQA 2E9LA 1KCKA 4J2MA 1TELA 4EWJA 3N25A 2V5BA 4ZFCA 1R3TA 3KOFA 5IBXA 1EDQA 3B40A 1ZJIA 1YTKA 2OGYA 3MBDA 3K4DA 3QPYA 5HQEA 1G4PA 4LUSB 2DPEA 2ZKMX 4J2PA 1VJSA 1K9TA 4ZR8A 2O0TA 1S2WA 3IIXA 2YSWA 4G9PA 4KGJA 3EBVA 3FCPA 4AHPA 2J8FA 2WVVA 3OOQA 3FGCB 3LHVA 2ATSA 3RCNA 1WCGA 4NX5A 3VABA 5CGMA 1L9WA 4N42A 1REQB 4ML9A 4ML4A 3Q67A 3DERA 4PE8A 3SO7A 4LUJA 3SI9A 3A4JA 1QNSA 3LLFA 3OVGA 3NFUA 1WDWA 3VZXA 1AMYA 2PDPA 1YADA 4DX3A 1KTBA 2JKEA 3VK5A 4MJZA 4XBKA 5FEWA 3UJRA 4C6EA 1Q2RA 2GDVA 2V2HA 3BV7A 4JDBA 1HZYA 2VVSA 3RPTA 3HMJG 1R3YA 2OEJA 2O9TA 2Z1XA 3KRZA 4O18A 5CPQA 4FX8A 4JPGA 3AYRA 5K4XA 3KVMA 1N82A 2YKKA 3VGEA 2W92A 2PS2A 4UTMA 1KBKA 1HJQA 1VJIA 1SO4A 1YQ2A 1AJ0A 4WRHA 3ARPA 3FN9A 1S3TC 3WUGA 5PTDA 2O4QA 1XRVA 1SMAA 3QC0A 4Q8MA 4DM2A 2IKJA 3L2LA 1FWBC 1W17A 2GYIA 1B9BA 4UTWC 2E8YA 3ARUA 3FA4A 2C3ZA 2V5DA 2R1PA 5BMWA 1XFCA 3KDNA 1IZJA 1XIJA 1EEPA 4Z1CA 1BWKA 3BAJA 3WK0A 3S1WA 3D0CA 3TTEA 2GUBA 4U31A 1OGGA 3MO4A 2NX1A 4GINA 3TQPA 1EYEA 2IQTA 2VOTA 3GUWA 1LOSA 2Z00A 3WLSA 2KZHA 3PJTA 1UOZA 3CK5A 3AMLA 2W27A 1UW9A 4BQ2A 3CUZA 1TCMA 1XLDA 4K8HA 1GEHA 3U9IA 2YYUA 3LCFA 3RGTA 1EIBA 4LCSA 4U3CA 2V3GA 4L64A 3VMOA 4OGZA 5CQ1A 4BWLC 4F3HA 4V27A 3WMBA 4O12A 5IDIA 2JEQA 3HG4A 2BS9A 1W3LA 3PZNA 3RF9A 4H6KA 1UA7A 3MUIA 4JDYA 3OODA 1ZBWA 3N73A 3OHMB 1PTAA 1B31A 3CWOX 4EWND 4HU3A 1UKSA 5JXQA 2DVUA 2YDAA 1R9ZA 3S0CA 5C7VA 2W67A 4OBSA 5K7JA 4UMCA 3K2GA 1ALDA 3CYJA 2WKLA 3GS6A 1PPIA 1HKIA 3BGJA 1N8FA 1QNQA 4ZQNA 4LUSA 1VBRA 4CVWA 1DHKA 5C9WA 4IG2B 4DJDC 4GY1A 1EF3A 3DZ1A 3GH7A 2QCLA 3AIRA 3RLGA 5LHFA 1HQTA 3BLFA 3ZO9A 1AK5A 3S5YA 3U6WA 2DT2A 1XG3A 1A47A 3FGCA 2ZC1A 4FLQA 4YS1A 4QITA 1QTWA 4PA8A 1XV8A 3MZNA 2NLYA 3QMTA 4XD6A 4CNNA 1REQA 2ZFAA 5DMLA 1BVZA 3TC6A 4H3DA 4UNKA 3W7PA 2PZ0A 2VZOA 5F1VA 1UKPA 4MKSA 4YVVA 1JDEA 4IXXA 2UY2A 3B06A 1CTNA 3GE7A 1TPDA 1RPXA 5I03A 3EEZA 5KINA 4XSMA 1TR9A 4YWSA 3C0LA 4GA8A 2WCGA 4FMVA 3SY1A 3CHEA 2HS8A 3AROA 2DJXA 3H2AA 4N2YA 4AD4A 2TAAA 3S2JA 4E6MA 4C6BA 1E5JA 4W86A 5ABEA 1Q7ZA 1W1PA 1EJVC 2I5GA 2XN1A 1CT5A 1Z8AA 1OFRA 4TTUA 3P7YA 4K6AA 1RSCA 1TB3A 4JFUA 1XLHA 1TWWA 5AHMA 4FSAA 2WSKA 3IJDA 4EIVA 4D6FA 3DCPA 2VDIA 1UR3M 1VCGA 1WUEA 3GSMA 4I5XA 4KH2A 4CNOA 4HPXA 5D9MA 3LBMA 1DKWA 4O8AA 1UG6A 2FDMA 1TTQA 1A5UA 3HTWA 5I00A 1ZBCA 2TSYA 3WF1A 1H11A 2XVLA 3W88A 2X41A 3BZJA 3B4YA 4I6VA 1W9UA 1VFMA 1WDQA 4PTDA 5RUBA 4E2VA 3T07A 3HZ3A 3OGVA 4LSBA 4CD4A 1OX5A 2RDUA 4UB9A 3VDHA 4RCXA 3QQ0A 5FJPA 3AI0A 4QIUA 4GNJA 1Q3NA 4DJFA 4JTQA 3T4CA 3MUXA 3PZMA 3QHMA 4H01A 4CCDA 4YTQA 3BJSA 4JFTA 2WNWA 1N8IA 2UBPC 3BMXA 2J6VA 3HBLA 1NOWA 2ZXQA 1XRTA 4LAUA 3AYSA 3ZJ7A 5E70A 2BY1A 1UBSA 2VEKA 1WZMA 4LY8A 3E0VA 3W81A 5JBFA 3M5ZA 3AMKA 1FCUA 4E38A 1UBPC 3N34A 3WQPA 3CZEA 1E6ZA 2HVMA 2BLEA 2QDDA 1B57A 4W8BA 1O5KA 4HMNA 2DUZA 3GXMA 2TODA 3F1QA 1GOQA 3HF3A 3FJNA 4QM1A 3GHRA 2PP1A 3LBOA 4LF1A 5A6BD 4NZFA 1MW1A 3TCEA 3HV9A 2OT0A 3W7JA 2WPGA 3SFWA 4UR9A 4XKYB 2PZNA 1UUQA 1U1HA 4IG2A 4G56A 4PULA 4LC8A 4AZGA 2NV9A 3IGXA 3WKZA 2INFA 4IPPA 2X1IA 4IUGA 4PTWA 3N15A 3VGBA 3H2OA 3QEZA 5EKYA 4HSHA 3GG0A 4N7QA 5I24A 4ZO8A 3KVKA 3VE9A 1MMFA 2QF7A 1Q6QA 5FOOA 2YBVA 5ABHA 2EBNA 3V18A 2P3ZA 1E6QM 2JKAA 2O9PA 3C2FA 2C1HA 3LGDA 1VFHA 3O2LA 2P50A 3IRDA 2RKXA 5LIWX 3N1AA 3ENLA 4ZB2A 5A94A 3O6DA 4HT3A 2E1DA 4F0SA 3EPOA 3EMZA 2XINA 4HHLA 3LZ5A 4JTFA 4HOZA 2Z24A 2XVGA 4ZL1A 1WZLA 5D05A 2ZRZA 4QJ3B 3QPEA 5LGXA 1F76A 3UWEA 4HJFA 3FAWA 2OKTA 5H91A 1JGIA 2GSEA 4RJEA 1K1DA 1UKTA 1XIIA 3SJ3A 1XISA 2UY4A 3QGKC 2PDQA 3LCIA 1AUSL 4N9CA 3TNOA 3M0XA 3WLJA 3AIBA 5A2AA 3NGFA 3IJ6A 1V02E 4KESA 2C19A 2V5LA 1UPMB 4LRTA 4IP4A 1YE4A 3WLKX 3BMWA 2XWDA 1W8SA 3A12A 4HA4A 3LCGA 4QS6A 5BXRA 3VUPA 4MNKA 3QRHA 1PAMA 2YR1A 4J35A 3RNDA 4DWSB 3L5MA 4QROA 3AHVA 4UTKA 1CB2A 1LCOA 1RCQA 2NXGA 2YYTA 3KRSA 2D69A 2G4JA 2NXHA 4JHZA 2ZWYA 2AOSA 3A6OA 3T40A 4J40A 2A1YA 1QI4A 2HNHA 4PMVA 4C7FA 2Y8KA 2YL8A 3ITYA 3HA1A 3PTQA 4JQ4A 1L6WA 4UUIA 4GYFA 2ZZ3A 3ZJ8A 2PE4A 3DHDA 1LT8A 3GM8A 1M1BA 3AU2A 3CIVA 3C0SA 5LHEA 2WM1A 3AS0A 3CMFA 4CNSA 3S5OA 3UESA 3R8HA 3QM3A 4GUGA 4DNMA 2XSBA 3ZLGA 2INZA 1Z7AA 3LHZA 4KRTA 1LQAA 1QOPA 2VTFA 3AHTA 3G18A 5LIUX 3LTYA 5ECVA 4NP7A 3M16A 3QSRA 4AVOA 2WZMA 4GH1A 4XKYA 2PUZA 1JNDA 2QIIA 4H9XA 3UVAA 4IZGA 1XBZA 1XDLA 3CZLA 1MQPA 5DXXA 3L5LA 1W9XA 4K1WA 2RDTA 3H7RA 4XZLX 1PHWA 4FOUA 4G1KA 4RNHA 2V38A 2YW3A 5A6TC 2FLIA 1NJJA 3W02A 2QCGA 2CBJA 3MMUA 3UZJA 5A6KA 1G9HA 3WQ5A 4PRWA 2A0NA 3OP2A 2CXEA 3ONCA 3ITCA 1UZHA 1QPKA 3P0XA 1XGDA 3DKLA 2XG9A 3Q37A 1NIUA 2A4AA 3W23A 1KBJA 4LEFA 4GFSA 3BLLA 1PKMA 1W32A 5G1YA 3S9ZA 2E5BA 3LHTA 5AC4A 3C52A 2OELA 1OFAA 3ALGA 5HR7A 5JH2A 3BLEA 2ZDRA 3KL5A 3EX3A 1EXBA 3GC2A 3V0UA 1UWSA 4AD1A 3RHGA 3RK8A 2B81A 3TONA 1QPRA 1ZAJA 4R33A 1POKA 1ONEA 5KZ6A 4KERA 3GBDA 3S1XA 4WDUA 4AZ6A 1W1ZA 3VIJA 4O4WA 3M47A 3QZAA 3BVJA 4X0NA 3AIEA 5I3HA 5H8UA 3PZVA 2VP8A 4LYQA 3S6OA 3SN0A 3SB0A 3E0FA 3PPCA 1H7OA 4L1XA 5CSUA 3HGJA 3EPMA 1L6SA 2VDHA 4GPNA 4UXDA 4YHEA 3BE7A 4UTTA 3G3DA 4JIRA 4L1GA 4GI6A 1TTPA 4FNUA 3SFKA 2Y70A 4Y9OA 2B7PA 4DWSA 3LV5A 4E8DA 4FNPA 3CQ0A 4C91A 1T41A 4L6OA 3EKLA 5CG7A 3WENA 3TJXA 1LYXA 5CZTA 4ZQCA 3V1PA 1F7BA 2UWFA 1XSJA 3BAXA 1HN1A 1M03A 2YB4A 4J4KA 4R7WA 3WD4A 2W62A 2WK2A 3W82A 2JIEA 4NAEB 3H2FA 1O66A 1F05A 4E8CA 1R7AA 3NEHA 2OTDA 5BYWA 2XGIA 3WDRA 1JRCA 1JYXA 2WJFA 2PRHA 4GOAA 4UCGA 3GG1A 3L68A 4OWGA 1KWGA 1HKKA 3NYZA 2GGHA 2J9YA 2E25A 3CL6A 4JEJA 4M8UA 1XPYA 4DXKA 3GU9A 3S9YA 4UOZA 2EPHA 3CTLA 3UYIA 4M81A 1THFD 4KGLA 2PTWA 4CN1A 3W2UA 5A8MA 3UWVA 1DWHM 3CPUA 3FDKA 2Q02A 3CS2A 3URAA 4FR6A 1XLGA 2BOFX 4IPLA 3LSBA 1TFVA 1S5MA 3LSCA 3S1VA 1IXNA 3E96A 1TJ0A 2W4XA 1EDGA 5HANA 4GZ7A 3KOWA 2NXIA 3TXZA 5H2ZA 4ZEPA 1HTIA 3TYBA 2C1IA 1JG9A 1WUFA 5F4WA 1K3UA 2YCLB 4RE4A 2GJNA 2QCEA 4ZE4A 1F07A 3EWDA 5FJRA 5JBEA 3MKKA 1BXCA 4NZJA 3KVJA 2XZ9A 1FDZA 2WHMA 1GG0A 2WWCA 4JQ3A 4BK9A 4WKAA 4MF4A 3ES7A 1BG9A 3N13A 1TX0A 1UP2A 2HTMA 2YXGA 3FXYA 1RD5A 6XIMA 4IQDA 4W87A 5A3HA 3WBXA 3ME3A 4NI3A 3R8GA 4S3KA 1GOXA 3BWWA 4FALA 3T55A 3UU0A 3WJXA 4TUFA 1TCDA 3DI0A 3M46A 1XLCA 4YTRA 5FCZA 3F4CA 1EP3A 4C6KA 2F9RA 3GG8A 4TMCA 1AMKA 1SFLA 4GXPA 3SR7A 4DUXA 3TA6A 5F1UA 3ID7A 4JKKA 4WOQA 3W25A 1MUWA 1XLAA 3QSTA 3QR3A 3UY7A 2BHZA 3NQFA 3VNJA 1FBAA 4DYKA 2VCAA 3TJIA 5T9CE 1KB3A 1FWAC 4O53A 4Z0JA 1LL7A 3A4WA 4PUUA 2VT0A 1X6NA 1NFGA 2W9MA 3MCOA 4CLMA 5EMJA 2QAPA 2QYGA 5XIAA 4TVCA 1XLJA 3BLOA 4D8AA 2UY3A 2VRQA 1VD6A 3RAOA 1BF6A 3W6YA 4CUCA 1RR2A 1E0UA 1FWIC 5GNXA 4JIQA 2JK2A 1OT2A 2CNCA 2TMDA 1M7PA 5EGRA 2PDCA 1JYWA 2KX9A 4AISA 4JXCA 1GYLA 2FGLA 1OC6A 2QJJA 4NAEA 5BRBA 4BF5A 4B3LA 3NGJA 1XICA 3KHJA 1TKKA 4EXBA 2P5NA 5A8NA 4IF2A 5CLTA 3UCCA 3ZJKA 1QR7A 3WF2A 1SPQA 1TUFA 2DGAA 3QYSA 1YEYA 4UFMA 5CAKA 2PU0A 2VUYA 3OTRA 5K9DA 1JFHA 1WBHA 4AXKA 2RAGA 1KRBC 5HQMA 3NZPA 2D3LA 5FD0A 5CAHA 3TEVA 3GW0A 4DI8A 4M0XA 2WMHA 1VIWA 1EIXA 3REQB 2GUYA 3THQA 5FAJA 4EF9A 2PURA 1EPVA 1PZ3A 3E0IA 1P1XA 1WXYA 2RFGA 3CIWA 5J04A 5CSRA 4QEEA 2FB2A 5IXEA 3H55A 4DLMA 3W53A 4MAVA 2ACSA 3WL1A 3IVSA 2PDLA 6TAAA 3UT0A 5HUOA 2GSHA 2YCLA 4PRTA 2X42A 5I3KA 3N3TA 4AY8A 1LG1A 1GJWA 4LB4A 3DC8A 3H2NA 5HWJA 3G6LA 3GNOA 4PEKA 3Q2DA 2ZX8A 3E1F1 3WEZA 1DTNA 3L0GA 5I07A 2GGIA 1E40A 1XC6A 4EK7A 2JE8A 4BF7A 3NQVA 2CIPA 2CFFA 4B16A 1NM9A 1EXPA 4QG9A 1HVQA 3MV11 1PZ1A 3LS9A 3RO6A 3PZQA 1T5AA 4DIAA 1VRXA 4D6GA 1KGUA 1B4EA 4QDMA 1CXLA 4DPPA 4J1OA 3OIHA 4Q8WA 3OZPA 3K1GA 3PBMA 4R5EA 2J7CA 2W5FA 2Y7FA 3T7VA 2QNEA 4JOMA 1L2UA 5EBAA 1BVNP 3EB2A 2GPTA 1YDNA 2WZEA 4K8GA 2Q09A 3LM7A 1NARA 1SVDA 1OFPA 2FPVA 1UH4A 2YCEA 4JIPA 3VD7A 3WLTA 3WYZA 4GY7A 1UMYA 2EAWA 1U30A 1SJBA 3XISA 3VU2A 2Y8UA 4JBRA 3DENA 6A3HA 3NCOA 4QNWA 4AHOA 3NPWA 3W7MA 2ZZ4A 1PYFA 2YL9A 4HNCA 1Z41A 1DP0A 4AYGA 1EKOA 5SWUA 3VD9A 1E3XA 3U3HA 3EGJA 2WXDM 1R3QA 1JCXA 4IMGA 2ZA2A 4HU0A 3FEQA 4N4PA 4QAWA 4Q22A 3A4XA 3S5NA 3UY8A 4A22A 1H3GA 3NQEA 2BG5A 4JYFA 1PWLA 4JNYA 4P8XA 3CEUA 4JFVA 3PP7A 3QYQA 3L12A 5CC6A 1UD3A 3FYOA 4KBXA 1VC4A 6PTDA 1KBLA 2PLMA 3T09A 3E2RA 3M7SA 3ELFA 5E6YA 2CZVA 2FJKA 2QGYA 2WANA 2Y85A 3PBGA 4X61A 4LU0A 3GAYA 3REQA 4FLOA 4Q4RA 3F2BA 4PSPA 4V28A 3EB4A 3UG8A 4RR4A 4UTWA 3OBKA 1H61A 3N19B 4F40A 4S38A 4PUEA 3DHUA 2VX4A 3MY9A 2X0YA 4AEFA 3TC7A 4N9DA 1J01A 5G2WA 4LS1A 1O5XA 4L4LA 1KFKA 2PBGA 4U4MA 1GWJA 3TYAA 3N3MA 1GPFA 1XQKA 3SRFA 1C7SA 4LBSA 2GVJA 3BSHA 2OQYA 1B90A 3B05A 2PGEA 4H83A 5G4HC 4Q8OA 5HULA 1BLIA 2OT1A 2QR6A 3PUOA 1V5XA 4MADA 4EPKA 3W7GA 3PR2A 4MSSA 1U5HA 2P1FA 2VR5A 1WB0A 4IH3A 2J27A 4JTAA 5TD4A 2E7FA 4O1CA 4BWLA 2BHUA 1J6PA 3CUFA 3STFA 3ABZA 4XO7A 1E4IA 2OWCA 3MVTA 3L4ZA 1UZ4A 1GK8A 3GAKA 3QV9A 5KZMA 1VPYA 4I5RA 3QY7A 3ARRA 1R0MA 3CZJA 4XUGA 3TFXA 5EBUA 4P7QA 1KCXA 2VWSA 2NQJA 1X6LA 1HL8A 3KM8A 3M44A 5EMKA 4J7RA 1VFUA 1A53A 1K8YA 5D8ZA 2OGJA 1XQLA 1J0HA 4LCRA 3AU6A 3MSRA 5LIXX 1V6TA 3DG7A 5C55A 3OGRA 4Y9NA 3FDGA 1GYNA 7TIMA 4FLSA 1TQJA 3GIQA 4DJDA 4JL1A 3P5ZA 1YPXA 4OZOA 1W9VA 3N04A 3GXPA 4DO4A 3IPWA 3LXCA 2ZA1A 3NL3A 5D2YA 3MSDA 3MBFA 1UWAA 1NOUA 2VI0A 4HYVA 3N6JA 1DXFA 4GYJA 2EPKX 4IFKB 3EB3A 1H5YA 1CXEA 2D2OA 2OODA 1ZNNA 3S6TA 1SO3A 3U5UA 1ZS2A 4C65A 5AC5A 2BTMA 5A8OA 3IIVA 4D1IA 2J7DA 1AQFA 3I4KA 3SQSA 5I06A 3VZYA 3JR2A 1VBJA 1GVSA 2E6FA 4IGHA 1A5SA 3O6YX 2MUCA 3EXSA 1A4LA 2YCKX 4PTXA 2OYKA 2CLOA 3N2OA 1SYTA 5JIPA 3FKKA 3RIKA 1K8XA 3M0VA 2WW5A 3DFQA 2J8TA 3DUGA 2UV8G 2VEGA 1UQZA 1OK6A 2YX0A 1S1PA 3RPMA 3UPMA 2OSYA 3GDRA 3O63A 3EWWA 3RR4A 3G0SA 5FA5A 3KBWA 4PCPA 2ZUSA 4W84A 1O94A 3G2GA 4PUMA 3ARXA 3W0KA 2NUXA 1Y8BA 1E9YB 4XVDA 4ZSTA 3DFOA 4XTIA 1VEMA 5CH9A 1UC4A 1VF8A 4MPKA 4DO6A 1SZGA 2PWFA 5D38A 4DUWA 2CKRA 3PZOA 3RO8A 4DUOA 1FOBA 2ZZ1A 4IJRA 1RCOB 4IQEA 1WAWA 3BCFA 2JFEX 4B4FA 1HT6A 4DEFA 5AYIA 3VD3A 1CCWB 4NJIA 4R3UA 4XKMA 4WY0B 5EMYA 1KGXA 3XIMA 2QVNA 1V6XA 7TAAA 3N2MA 3CZGA 3YPIA 3BLDA 4ORIA 2DFAA 2CXGA 4H6EA 4IIBA 4PUNA 4P8WA 2Z1SA 5C6MA 4O14A 2A3EA 5BW6A 1J10A 2OR2A 3KOYA 1UROA 2XYLA 3Q65A 1V02A 4BZYA 4E4FA 3GK0A 1TZ7A 1IXQA 1JQXA 3IUHA 4AMAA 1ZUAX 3IIZA 2ZRUA 1FWEC 5EMUA 2GJXB 2VOMA 3NQ8A 4ALDA 3PN8A 1J18A 4UQAA 3L4WA 4FR1A 4H2HA 3M41A 1LDCA 4DELA 1JFXA 2BY2A 4IMCA 5HK4A 1A5MC 3UXIA 2Y5EA 5HINA 1W1YA 3R11A 3JUGA 1MZHA 4IMEA 3FHQA 2PDIA 2ZICA 4MNJA 1B3VA 2DSZA 5K9CA 1GTHA 1PO9A 2CERA 3IVUA 2X1RA 4J28A 2WOQA 4XZBA 1B54A 3SUTA 3BK0A 4Q4MA 4MLJA 3OBAA 4D8LA 4LFYA 5TBOA 1W1IE 3MP3A 2ZZ2A 5HJXA 2BGQA 4IFKA 1J79A 2D23A 3VGGA 3LCHA 3CZKA 2I16A 4XB3A 4DQWA 3HPSA 3KXQA 1TE1A 2VFDA 3UPBA 2J7FA 3MANA 3WK1A 4PMUA 4JD4A 2J8GA 1K02A 1VENA 3EOOA 3LNMA 3ARVA 1FXPA 1MI3A 5L9FA 3LTPA 3UERA 4ZMGA 6REQB 3W83A 2D20A 4B3KA 1KA9F 1GQLA 2NWSA 4KFNA 1D2KA 1QU4A 1DL3A 1M01A 4QR6A 1A4MA 1GPWA 2GOUA 4WIWA 1Q4WA 2XSAA 4JX5A 1XH1A 2HMCA 3ARSA 4IJCA 1YPIA 1P0EA 2PGWA 3GXIA 3W87A 3MJYA 5FEZA 1HKJA 1MEHA 1GVOA 4UMBA 1B4KA 4RLIA 1GJPA 1BYCA 4FF7A 1YMYA 1YXYA 1FH7A 3VGDA 1SJCA 4HNNA 3KWXA 1CI1A 3M1ZA 3W6MA 3AUOA 4PGLA 3R0DA 5CZKA 3AO0A 1QPNA 4UNLA 4Q7IA 2J47A 3DECA 4Y7EA 1RBLA 3GNDA 2E6AA 3WDJA 4DPQA 2UZ9A 4M24A 1XYFA 2XN2A 1ISVA 4DAFA 4Z1BA 4HJWA 3PK7A 1DHPA 1PIGA 1IGWA 2XFYA 1PHQA 3RCMA 1H5VA 4C6JA 1G7UA 5KZEA 3CAKA 4D6CA 3AWNA 1JXKA 3DXIA 1US3A 4NG3A 3MTWA 5I78A 3WQ6A 2HE5A 3VMPA 1O6IA 4PUKA 1J93A 4O13A 2X05A 1AG1O 3VCRA 4XD4A 5HPOA 2O9RA 1LJYA 4F0KA 3TTOA 4XD3A 3TYUA 1E56A 4IFOA 1HJSA 4GY0A 1AVAA 1SMDA 3ZMRA 2PDYA 4HD5A 5I3FA 1A0CA 1FH9A 4FIRA 2ISSA 2MANA 1AZ1A 1QDSA 1Q13A 4KEZA 4FO4A 4D6EA 4YTSA 2VFIA 3FSTA 3HG3A 1ZQ5A 2GJXA 4GH3A 2E8ZA 4FOKA 1V0NA 3SDOA 1P5BA 1LOQA 4JKMA 4WD0A 4MB3A 1SZRA 3KZPA 4I90A 3TMLA 4AB4A 1V3JA 3PWAA 1AJ2A 2R91A 3RMEA 3CAQA 1KXVA 1NDWA 1UB3A 4OFCA 2G37A 2D0HA 4TXEA 3P61A 4QRNA 1FHLA 4WDXA 2I9EA 2EKCA 5FKYA 2XFRA 4IL0A 3JZUA 1X8FA 2QAFA 5A69A 3GTIA 4LV4A 1V7AA 4EOUA 3G1VA 2D2GA 1DIKA 2IKGA 2I1OA 4MG4A 4RL3A 2VZTA 4ECLA 3SCPA 4GZEA 4PSRA 1C8VA 1PVNA 3W29A 3BW2A 1ODZA 4M3PA 1DQXA 2AL2B 1CGXA 4UQ9A 1SZFA 2PAJA 2YFNA 1JULA 4EACA 3EDJA 4MY8A 1WP6A 3KDOA 4GMEA 1XHGA 4N4QA 2NV1A 3MUZ1 3MI6A 4QJ1A 4HNTA 3ABSA 3HMCA 1P0NA 3R89A 4WJXA 1OYBA 3BARA 3MUAA 2V3FA 5G1MA 4GO9A 1QHOA 2GL5A 1FA2A 5FEXA 1QBAA 2PTXA 3SGZA 4Z1AA 3D6NA 3OEXA 5CKSA 3GB6A 4AZCB 3TW7A 1WX0A 3HQPA 1XIEA 5C54A 1BEUA 1L8NA 4M1BA 2C16A 3GFYA 2YW4A 2EG6A 3BO9A 5C5YA 3SRHA 5B7YA 3TOPA 2YBUA 6REQA 1FWJC 1GONA 4JAWA 1RQBA 5T91A 1SSDA 3VCCA 4UOQA 1Z89A 1NH6A 3NL6A 1JEZA 4ZOCA 3RJXA 3KZSA 1AL7A 4LYRA 1CIUA 1DEDA 2V5KA 3HJZA 4NJHA 1JCYA 3CUXA 3E12A 4UFHA 4EAMA 3UNDA 3GDBA 1P6BA 3BAKA 1R2TA 4BS0A 4UNIA 3AS3A 1W1VA 2RH9A 4PTVA 1ITUA 1E1EA 2HPIA 4R85A 1BKSA 4HZ8A 4NI8A 3SCRA 3VKJA 3M0MA 3HQ1A 3GVRA 2DZWA 3C0JA 1NF0A 1D7KA 1I45A 5DX7A 1JPDX 1ZTVA 1BSIA 3ZT6A 1F6PA 1D8WA 5KETA 4XBJA 2ZTKA 2PDWA 1R3RA 3GR8A 3LEPA 8CGTA 1SFTA 1HJWA 1NP2A 4IIEA 3OGSA 4IX2A 2GGJA 5D9PA 4ZO7A 1EUAA 4C1NB 3W72A 1DYSA 3OA5A 2Z1WA 4MGGA 4DBWA 2Z2BA 3TJ4A 1E15A 1QWGA 1XYAA 3WJWA 1R3WA 4WXZA 2HZGA 3W9ZA 1RLDA 1RJQA 4GYPC 9XIAA 2OKOA 1RAKA 3MDUA 4AEEA 1TZZA 4LWWA 3U57A 3TSDA 3OZOA 3IGHX 2F2KA 3TQVA 1AW5A 2PF0A 3TN6A 3VC6A 1S1RA 4MJMA 3RRAA 5XIMA 1EWDA 5AC6A 4AHQA 4WF7A 4KEMA 1WXJA 2VHLA 1XSIA 2G50A 3LCWA 2XH2A 1U5VA 2BXZA 3R13A 2V5JA 1WNOA 3P67A 4UR8A 3S2CA 4MWAD 1UD2A 4AIOA 3QW3A 5TIMA 3DDMA 3NO1A 4DZ5A 2CLIA 3AJXA 4O52A 4CCCA 3CO4A 2BXYA 5H8PA 1KC7A 4N02A 4Q32A 2AL2A 4UTIA 2B7QA 2GQAA 3ZM8A 7A3HA 3J7HA 5KEZA 3P80A 1RA0A 1S39A 3B0VC 3AYTA 3W2JA 1YPFA 1UR9A 3W26A 1S2CA 1F3TA 4OTKA 1RK6A 1EJWC 5C9RA 3R5EA 4MKVA 5HATA 2Y5JA 2QUNA 3G8RA 1DWAM 4AZCA 1LLZA 3VIIA 4E8GA 4GCAA 8XIAA 1XYBA 4MIMA 1CW2A 4XG1A 4AZ5A 4P61A 3WELA 1YDOA 2F6UA 1R3SA 1YYAA 1A3WA 2B4GA 1X39A 4W5UA 2A6NA 3QTPA 3A4AA 3H12A 3KVLA 3L4XA 3UVIA 4FLRA 4O1EA 2VFFA 2JIWA 2PC8A 1BQGA 1QAPA 3W7IA 1QRQA 4PCTA 1DVJA 2E68A 3S2LA 3L0NA 3R79A 4POCA 1LLOA 2NUYA 3SCQA 5I7GA 2AMXA 5CBJA 4PMRA 4GQGA 1QW8A 3LN3A 3LHYA 1LLWA 4HVXA 1CXFA 3TV8A 4PBEA 2F38A 3DN5A 1R47A 2O92A 3MYOA 4P7RA 3WK3A 2QQ6A 2Z1BA 1UA3A 3CUHA 1E9ZB 3NR0A 3G5EA 4O1AA 1ENUA 2OZ0A 3LHUA 1M3UA 3EX1A 3V16A 3CHCA 3UR7A 4PUDA 3AXIA 4R9XA 4HMEA 1MFVA 4B5NA 3EDDA 4RZ6A 3CYVA 4PCNA 4C1NA 3CV7A 3TTQA 4F48A 3VC5A 5FIPA 4M5PA 5AC8A 1QXLA 1PSCA 4XV0A 2I9UA 3HU7A 4XBSA 3B0UX 4A3RA 4CU6A 4IUOA 4LVAA 4C6DA 1ME8A 5HNTA 1RUSA 5IOBA 1RD6A 5DY2A 3E49A 3TNBA 1Q5MA 4J9JA 1JZ3A 1AW1A 4GG9A 3SW6A 4LGXA 4ZBCA 1YBQB 1EC9A 3NXLA 3T1GA 3TH6A 4MUPA 2NT1A 4UTUA 1IGSA 3KS6A 2OO0A 3IJ8A 2NLIA 5J5RA 4ERAA 4WOZA 3V5FA 3DU0A 3BOLA 2Z6IA 4JTLA 1OG6A 5AYZA 1Q45A 1SFSA 3KRUA 2CWNA 3UETA 1GYMA 4ERGA 3T2OA 4NVTA 1JDFA 1VHNA 3ZVHB 4K38A 1NU5A 3E0LA 4BI6A 2D2HA 1Q4NX 5JQ9A 4JY8A 1WBJA 4J3SA 3AHXA 5DCBA 2DJLA 2WNQA 2DW6A 1W31A 5IFTA 1MQQA 2X1TA 4UOJA 2HDJA 3VNLA 1CBGA 2I14A 3PBYA 3HG5A 3P2VA 3ANUA 2G3NA 3R10A 4IISA 3VDAA 1EX5A 3UCQA 3WX7A 4R34A 4IIFA 4GQBA 4D8ZA 3WUBA 4MZYA 3VA8A 1WQ5A 3HQOA 5EB8A 3R58A 4GRSA 2YFOA 4LPCA 4O19A 5TQLA 5AY7A 3CIXA 1E51A 3MMWA 5DY3A 2WJZA 4IQLA 4WCJA 4HK5A 4DBDA 1DWIM 5LIKX 4BI5A 1JUBA 4K36A 1J96A 5FF4A 1VFSA 5A1AA 1W3HA 3GNXA 3OPSA 1IT8A 4LH8A 3H6OA 3NYDA 2IQDA 4JX4A 2RDWA 3A9IA 3D46A 1E55A 3TWBA 4L4PA 4EX4A 4MMWA 2ZC8A 4GVHA 3PB2A 4ADTA 1EYWA 2V63A 1V77A 3BAWA 3QV7A 2HBVA 4J3ZA 4B2DD 1QASA 5AYXA 2EGZA 2IKIA 3VXGA 3F2CA 1GQNA 1RZMA 3SRDA 3PUGA 3R43A 2G8ZA 2BHYA 2GZXA 5HWNA 3EDKA 3R6IA 1QW7A 2OZ8A 2OXNA 4NNCA 1T96A 1M6JA 3OVQA 1SGJA 1VBUA 4CEUC 1KV5A 2Y88A 4EAYA 3PAOA 3UGVA 4J3VA 3DBPA 5G5IA 1HVXA 5EYWA 3C5QA 3UD6A 2FB3A 1H51A 4HCLA 2FZ9A 1LF1A 4C90A 4GX8A 3EA3A 3L5AA 3RXZA 2NQ9A 2I5QA 2Y61A 4GISA 4MYAA 1B9ZA 5HMFA 2EEXA 3R0UA 3VNDA 2X8RA 4QSFA 1MEIA 4CNPA 4IX0A 2VENA 3NZGA 4KT2A 3W85A 1H1NA 3POCA 3B97A 1ISYA 3LQGA 2C18A 3WLPA 1JCLA 3NQ7A 3NQDA 1TMQA 3VDCA 5A5WA 1ME7A 1AFSA 4UCFA 4Q6JA 1YBQA 3NG3A 3LLXA 3OLDA 4GXMA 3U7VA 1I9CB 3HM7A 1KLYA 2IW0A 3UXLA 1KO0A 1PZ2A 2DUXA 1XYMA 2HPMA 1EHNA 1LQ2A 3ARQA 5BOEA 3FFSA 1AH0A 4S3EA 3T8LA 2PLJA 2WSRA 4AIEA 4HKPA 3MYPA 4JL2A 2EQDA 2VZUA 4NIRA 1E0TA 4LV9A 3ZVHA 2IPFA 1Q6EA 2PD9A 3WJZA 1ZRQA 1GTEA 3ANYA 1XCWA 3EXTA 1XH0A 2H8ZA 3V5OA 2IPWA 2VFHA 5CPNA 4O4VA 4W8LA 3B0YA 5DT5A 4FXJA 4GWEA 1X1NA 4LY4A 4H4IA 4U2ZA 4TX9A 4XZHA 2G5WA 2QZRA 4K68A 2W63A 1KQZA 4HB7A 3NPVA 2JKPA 4JTCA 3GX9A 4AY7A 1XCXA 3ALFA 5AZ0A 3W1UA 1G0CA 1Q6FA 5AYYA 4HP5A 1EP1A 3TC3A 3TIMA 1DBTA 1NWRA 4D6HA 4W8AA 4AC1X 2EPLX 3ZYZA 1J11A 4B3ZA 4AIBA 3R7MA 3M0IA 3I68A 1OF6A 1TJPA 2PPGA 4JKLA 1YHTA 4CU8A 1UP0A 2R82A 1FWTA 5FJJA 2BXVA 1EGZA 1ICPA 3NM3A 1KM1A 4IPJA 1Q65A 1MSSA 1F61A 3R12A 3CHVA 2OLSA 3PTKA 4GQQA 4Q8UA 3DYOA 2FYMA 4WHBA 3NDYA 3ZLHA 3NXFA 4B92A 4H00A 4JTJA 3MWAA 1SR0A 1KFEA 4LBUA 3UXDA 1U1JA 2QUTA 2Y7EA 3GKFA 4CN6A 1UZDA 3WLQA 3MDWA 3VZZA 5D33A 2JBMA 3L4VA 1PIIA 4GIEA 3V0TA 3WBEA 1VPXA 5I79A 2PP0A 1TTJA 2D73A 3K8MA 1C8XA 2QDHA 1CNVA 3WMLA 3P6LA 3KLLA 1BGAA 5BXTA 1DQUA 4LCQA 6TIMA 3WF0A 4D71A 3HURA 2HROA 3Q58A 1V6VA 3QHNA 4TX6A 4K3ZA 3THDA 3IGSA 5ABFB 3LERA 1KFBA 3RITA 1H0GA 3ISIX 3MCMA 4X0VA 1E0WA 3M0YA 3Q94A 1UPPA 1QATA 2XU2A 2Z0IA 1XINA 4NJJA 2Y7DA 3IIOA 3VD5A 1FWHC 3BC9A 3NZRA 4DYJA 3AYVA 4I9JA 3STEA 4GCXA 5EMLA 3VIPA 3I6EA 4XZNX 4QJ4B 1BQCA 3VDGA 1QPQA 1PCKA 1VZWA 3QJAA 1U5JA 4K1GA 4LC6A 4AEOA 4KRUA 4ZODA 4Z17A 3MJMA 3TVAA 2LLEA 4EPBC 1XBYA 4A3QA 4CNTA 1X98A 1OZMA 2Y1HA 5EPDA 1B3ZA 5KSWA 3K4AA 3MO7A 2VRJA 3ZWSA 2OFJA 4GHRA 4QBXA 4WGHA 4E0CA 3LI0A 2P76A 1K4GA 5F2GA 5A8GA 2Z29A 4GQRA 3AXXA 4V2XA 2FZBA 4UR7A 4PBFA 1EGVA 3GTFA 3BXWA 4PMNA 4WDWA 3IWPA 4Z08A 1B1YA 1ME9A 3WJSA 3QQ1A 3MHFA 1JZ5A 1RPKA 2BWGA 3NQCA 2Z1KA 2FGBA 3NOYA 2KAUC 1B2YA 1UIPA 5GJPA 3WQ8A 2XWEA 1VYSX 4QG6A 2NV2A 3USZA 3CLWA 4W7WA 1W2PA 1QK2A 2ZADA 5C70A 1NQKA 3MT1A 2D2JA 1UJQA 3LYEA 2VVNA 2A21A 3ZZ1A 1P7TB 4C1LA 4RPPA 4S23A 2Y89A 4MNMA 1UOKA 3WNMA 4DJED 2V2CA 4GD0A 4GC4A 3ZWTA 5H6HA 3H2EA 5BXPA 4H2CA 1K9DA 4JHMA 5CSYA 3TCSA 2VCCA 2ZX7A 1H60A 2WYSA 1IZCA 1R6WA 1FQ0A 3EX6A 3JS3A 3NL2A 1IR1A 3EOSA 4HHPA 4LVDA 4NY2A 4JR5A 3TR9A 2V3DA 4IWWA 5FESA 1RVGA 4J3WA 1YNYA 3ITOA 3HFTA 2DZVA 3BH4A 4FEZA 3QZ6A 1OFQA 2F84A 4BHYA 2F6XA 3TKFA 2AKMA 4OOZA 1VLWA 2BX7A 3BGAA 4X2RA 2WSYA 1GW1A 2FZDA 2V8ZA 1FP9A 2ONEA 3CMJA 3GC5A 4HHHA 3GR7A 3EWBX 2DUAA 1RY8A 5HNUA 1E6NA 4B9YA 3DI1A 5LNRA 1W9PA 4EE9A 1A49A 3QY8A 5JUVA 3DHPA 3T0DA 1GKRA 4OKDA 3O16A 5C9UA 1UJPA 2QCNA 2XISA 1XGZA 3B4UA 5ABFA 4XAGA 5HBFA 1H62A 2RUSA 3L4YA 1H50A 5IDZA 2OMAA 2Q71A 1UKOA 4JTRA 1JDAA 5I0DA 3GRIA 4OHQA 1NDVA 3NTYA 3QPZA 5C71A 1PKYA 3KRBA 3PNZA 2ZDSA 3VTRA 5A95A 2YDQA 3BSMA 3WNNA 1OCJA 3T0AA 4J3TA 3L0KA 3UJ2A 1I6NA 3M6YA 3VINA 3BG3A 3G1HA 1AD4A 1NFPA 3A3WA 2H8XA 4WZHA 2C91A 4KFOA 5LNUA 3NL5A 1IWAA 1EZWA 4C60A 4HTBA 2XFFA 5D32A 1RBAA 4AZHA 4LAZA 5D30A 5A8QA 1PXGA 2J7BA 2NZLA 1PTGA 2VGGA 2BB0A 1UD8A 3WNKA 3ZIZA 2GJLA 4ZO6A 3BG9A 4GKLA 3IRSA 4PC8A 3GXTA 4GE8A 4FXSA 1VEOA 4RKAA 5C2GA 1N8WA 1IEVA 2CLMA 4E2DA 2J62A 2QV5A 5ENLA 3SN4A 3THCA 3WLNA 2HRWA 1SW0A 3VIHA 4M6PA 1H4PA 2CCRA 5LA2A 3IAPA 4D1JA 1UR2A 4ACYA 3IEBA 5CZ0A 3FSUA 2QLYA 1TPB1 5M2FX 2GVLA 3AMGA 4HGXA 4J27A 5LNVA 3C4UA 3TR2A 7CGTA 3NOEA 3AIVA 3EOUA 3BOFA 3ICJA 1P7TA 3AFBA 4CQDA 1VFFA 5AOUA 1F8IA 1OABA 3GD6A 2GOKA 1MO0A 3CL7A 3FYPA 4RNJA 3G6MA 4K37A 3VIOA 1J8VA 3C3UA 5J5DA 3M43A 1M65A 3A13A 4XAYA 5AFDA 1P43A 4XZMX 3BDKA 4DWDA 3N9RA 4MB1A 3SY8A 1OGBA 1KFCA 1GCYA 1UZ1A 5AECA 2PC4A 2CLEA 3EWYA 3W74A 1UR4A 2C71A 2HVOA 2QF8A 5FSDC 2XIIA 5JMUA 4ZTYA 2ANUA 5T26A 1BXNA 2XDFA 3RYSA 1TWSA 3IVTA 4S3CA 3TOYA 4XX6A 2WCAA 3NQ2A 1SU5A 1CLVA 3SAZA 2ZRXA 1JPIA 1AJZA 2WMGA 1EOMA 4P8VA 1M7JA 3TUUA 2PGFA 2DZPA 3RRXA 3I3DA 4XAPA 4US5D 1X6UA 2YIHA 5HXMA 3GC4A 3C8NA 3QC3A 2PA6A 1K77A 5AHFA 1PX3A 2PBOA 3OLGA 3PVFA 1AA1B 3M0HA 3M07A 3LOTA 1KKOA 4MB5A 3G1XA 2YPIA 4QE1A 4D6IA 1B5TA 1ADOA 3SQMA 5I6SA 1NY1A 3LK6A 1F3WA 2PU1A 3UWYA 1G69A 3PTMA 2GGEA 1GHRA 2HJPA 3VO0A 3DFNA 1TTIA 3CHDA 3B9DA 1QNRA 4B5TA 4B91A 3KL3A 2GVGA 4YVPA 5HMEA 4KIRA 2WC7A 1V0LA 3STCA 1CXKA 4L56A 4FK9A 2OSWA 1E71M 1HO4A 4L4MA 3PBVA 1XIGA 1NF7A 3O07A 1O1HA 2YLAA 1QT1A 4X22A 1Q63A 4H9TA 1XJBA 1J9YA 1FFQA 1EDTA 3BICA 2WBKA 1D8CA 1FWGC 4JTIA 4K39A 4LX4A 1V08A 3H4GA 4C6IA 1Z69A 1H41A 3CT7A 4UTJA 4F2BA 1UR1A 3P3BA 1V4YA 2G41A 2GLKA 1KGWA 4EPDC 4TV5A 3S42A 4E3TA 1VBHA 1RQHA 3EKZA 1XYCA 1WZAA 5FF3A 1ZENA 3AIQA 2IXUA 4C7GA 2FTPA 3RX3A 3GHUA 1W56A 4GYPA 1PV8A 2OOFA 4XIMA 5J8LA 5BWAA 1XIDA 3WN6A 4HYWA 5E9XA 1RJPA 3PF3A 3GZ3A 4YWIA 3STPA 5AVNA 1ICSA 2FZNA 1TV4A 1ZB5A 3WEMA 2VQTA 3LD5A 3U0HA 3IIPA 1TPFA 4S2CA 3CWNA 2PDNA 3NDOA 2QPXA 5BMXA 1JZ6A 4UIOA 3S2MA 3K30A 1O60A 4LYPA 3FA5A 3DGBA 3SUUA 4C1KA 3LQLA 3MHGA 2QCDB 3W07A 4M6VA 1L6YA 2Y5SA 3DFTA 2DDXA 3OZYA 3QMSA 1OZQA 3GYCA 3LUTA 3W7EA 1BRLB 4NNAA 4F0RA 3SGUA 4DBUA 2XHYA 1XLBA 1I2OA 1T8XA 3DFPA 1NAL1 2ISDA 4D2JA 1HUVA 2IPGA 4WVXA 2C79A 3GHSA 5GVJA 5E9AA 5TF0A 1SR9A 2BOEX 1E4LA 1XLFA 2CITA 4HNUA 3WLHA 1K7EA 1B3XA 1JJKA 1GOMA 2JF6A 1HKVA 4CU7A 1JIBA 1ESWA 4H8UA 1W37A 3H70A 2QS8A 1R38A 1VRDA 3U2ZA 3B9EA 3U5YA 4CQAA 3BJTA 4RNIA 2CLKA 1OYAA 4AG0A 2A7NA 4ZSUA 2CZEA 1DIOA 4A3UA 3MCNA 1PB0A 1LM1A 1E1CB 1JI1A 4FOJA 1YNQA 3WQGA 2DW7A 4XZIA 1NSJA 3P84A 5FL1A 5JVLA 3H2CA 5BRQA 1KM6A 4R7OA 1Z48A 2PDXA 1M9HA 3ZR4A 3CASA 3MUCA 3K46A 2X2GA 3N2XA 3OQ8A 1FUYA 2DZSA 4JN6A 2VD8A 4I9TA 2HCVA 5BXSA 2A3AA 4GLEA 1MYRA 3A21A 1UWUA 2ZXBA 1ZGDA 1MXGA 4H7CA 4WJ8A 2Z26A 3LNPA 2TYSA 1ELSA 1Z44A 1XL9A 5JBDA 4MM1A 4ZQOA 3VIMA 2RJHA 3IV3A 3OU8A 1KNWA 2NVDA 4GI4A 3HFYA 3DG6A 5CEWA 3N6QA 3WMCA 3IJLA 5CLWA 4UQEA 5LA0A 3KWSA 3BTNA 3QY6A 1EJTC 5DO8A 1G94A 2CZ5A 3QW4B 1F8MA 2X7VA 1YDYA 1UC5A 5AC7A 5K4ZA 2DV0A 3CNYA 3S1UA 5M17A 3W2KA 1Y5VA 3W76A 3C2EA 1XBVA 5I3GA 4D72A 4GNVA 7ENLA 3W38A 5A6BA 1F3XA 1W3KA 3MP4A 3TQ0A 3ZR6A 2UY5A 5AVHA 1VYPX 3WF4A 2O56A 1K7FA 2DZUA 1OT1A 4AY1A 1DJWA 1CXHA 2Y7GA 5MF5A 4GIRA 5D4YA 2DZXA 1L8PA 6ENLA 1W5NA 1Q6RA 4ZOBA 1PYMA 3OJGA 3SCTA 2QJMA 4KCWA 4WKFA 3KTCA 5KITA 3TSBA 1K6AA 2ZX9A 1L0PA 4HK6A 4ZTXA 5EL1A 1K6WA 6CGTA 5DMMA 3NIYA 2XJ7A 5DN1A 1XD1A 4PZVA 5CG0A 2R14A 5C8BB 1KTCA 3FJ4A 3NURA 2B0MA 2QCDA 1XIFA 1IWPA 1OADA 4IP5A 1RV8A 3LV6A 4CGTA 5C2XA 1BRLA 4G5DA 4F9DA 3BCJA 1CGVA 2Y6ZA 4DZAA 3AXHA 4MDPA 3E2VA 3RJYA 5HNNA 1HG3A 4TVDA 1AZ2A 4ICCX 3L23A 3AWOA 3R25A 2CLPA 3V75A 1N55A 1XDMA 2BGSA 3N4EA 2HVNA 3TMQA 3FHAA 1BFNA 3APTA 3PFRA 2QCFA 4O15A 4O17A 3V7PA 1O12A 4ASTA 4BEQA 2P3EA 2WWDA 1R2SA 3PWGA 1ITXA 3WCZA 1E1CA 2V0TA 3OVRA 3W1RA 1H0IA 5FF2A 2VX5A 3G24A 2C7FA 4H9YA 3F03K 1V3KA 3E5BA 1A5OC 1OFDA 1PCWA 2BOGX 1TPEA 2I57A 2VR2A 4Y9PA 2BSLA 2G3JA 3EWCA 1DJIA 5F4XA 2ZCGA 3EOLA 2J7EA 4UQBA 3SGGA 2J74A 2GWNA 1D3GA 4Z1YA 5BOFA 3UWUA 1W5MA 1YE6A 1I0DA 4UQCA 3VOGA 3PJUA 2ACQA 3KBMA 5AB3A 1YTEA 2TPSA 4KCTA 3DC0A 4Q4QA 3WQEA 5D04C 1TIWA 3BG5A 3WQVA 4UTHA 1OINA 3ITGA 4BKNA 5HNRA 3C56A 1W3JA 5D37A 3PTDA 5FAGA 4P2VA 2ZOXA 4M29A 3CT2A 1W6TA 5FL0A 1XKJA 3NVTA 1FHDA 4Y6GA 2HK0A 2WJEA 1M7OA 3UG5A 2D1ZA 3N9KA 3DKJA 2HXUA 4HPGA 4O0QA 5DRCA 3GH5A 5DFAA 4L9XA 3UJFA 1A80A 5HAOA 4P8UA 3GY1A 3LENA 1C90A 1XH2A 3B0PA 1EFZA 3QZEA 2XIMA 1F6KA 1O68A 4PTNA 3MHUA 1TE6A 2Q3OA 1HXJA 4JIHA 4TX8A 5DMNA 3B8TA 1V93A 1JI2A 5AYBA 1W9BM 4F0MA 2BVWA 3RPDA 4Z2IA 5IFPA 2EO7A 5G2IA 2VO5A 3ECQA 3K5XA 3ZXWA 1ZALA 1IE7C 3MB9A 3LPGA 3IARA 4BCEA 5D02A 3A5FA 3F4WA 2YA0A 3GO2A 4PRRA 3CPRA 4IL2A 4A3YA 2C14A 3GVGA 3O0KA 2YLLA 3WNPA 5HMDA 3IANA 4E4PA 3FXGA 3OQEA 5DLCA 2O55A 2Y0FA 4MZ8A 4JTKA 4QP0A 4RW5A 2EHHA 1TV3A 4IM4A 1IXOA 2H3BA 1F4HA 1W5OA 3LX9A 1K03A 3ZLFA 4JNZA 1XUUA 5HQLA 1O5RA 3FVDA 3IAQA 4L65A 3BQ5A 3KTSA 1KBBA 3L67A 2FVLA 1BG4A 3NVDA 2I7GA 1R7OA 2MNRA 4S3GA 3HO8A 3U4FA 4N6EA 8TIMA 4FP1A 3RU6A 4DF1A 1X8CA 5HJYA 3SUSA 1AH3A 4K8EA 4IXHA 1S38A 5HR6A 2FJUB 3H4WA 2VGBA 4G2DA 3U8GA 2AMGA 3FVMA 2ODOA 2XVNA 2ADAA 3ABRA 5D03A 3IUDA 3T2QA 1LL6A 2ISWA 4ILSA 2W61A 4R9OA 3SEPA 2DQXA 1TR1A 3ATZA 2H9AB 1TWIA 1GVFA 4M6QA 5I2UA 1YXDA 1HJVA 3EX2A 2GVYA 2HWGA 3F5KA 1EJSC 3AIUA 4L9YA 1I8JA 1ADSA 1LRTA 2H6RA 4GBDA 2DZAA 4B4HA 2XZ7A 3VOHA 5D9NA 4AD5A 1SW3A 1J0JA 3K4WA 4IGMA 4C6FA 3IUIA 4RDVA 2VD9A 2C8NA 5CC5A 3MC5A 4MNLA 1FCQA 1XLIA 3EDEA 3UJSA 2PWEA 5AZ1A 3ZR5A 3SY5A 3T8QA 3CQIA 3WFZA 3TYDA 1XLLA 3TDFA 1IXPA 4Z2HA 1ML1A 5CPTA 1V03A 3W7CA 4Q8TA 4MDOA 5A8PA 3UJEA 3KOZA 4DO7A 4LQ1A 2J79A 1JAKA 1BD0A 4J3UA 3SZ8A 4Y8FA 1E43A 2G97A 2J4GA 4RW3A 1IZKA 3C2YA 3TLLA 2WLYA 5U7SA 4WQ6A 3PNUA 3M0LA 4MWAC 3EXRA 4AC7C 1AODA 1SW7A 3GG7A 2JGYA 2DVXA 1BHGA 1GGOA 4LVGA 1FWNA 4BY3A 1C3FA 3QXBA 1HJXA 3C2OA 1VGAA 4KCUA 3LRKA 4ZOAA 3W7OA 3CV6A 2DIJA 5DBUA 3M6DA 4O1BA 5LNWA 4H9VA 1DIDA 5I09A 3MA8A 3SSZA 4JX6A 5A2CA 2XTKA 4WSJA 1OF8A 4DNHA 4DN1A 5M3WA 1NFBA 3PJWA 1Q7QA 3ABQA 3GVVA 2QJNA 2JALA 7PTDA 4IIHA 5C2CA 3W84A 1WKFA 5C0QA 3A9BA 2Z1VA 2EXOA 3DEQA 2ON3A 1K9EA 4H9UA 2OEMA 4NAFB 1Q2SA 2BBFA 4AXNA 3SUWA 3WQDA 1KXHA 4LYKA 4A3HA 5CZSA 2AAMA 2D24A 3UW6A 4Z42C 3SADA 2GQ3A 4O11A 1GG1A 4N6FA 3UG3A 3CC1A 3UPWA 2EJAA 3F2DA 3KFTA 1OSEA 1ZLPA 4U5IA 2FFIA 1MQRA 4E2BA 3WD2A 3CZ8A 2GWGA 1T0OA 1ZCCA 3FNDA 1TV5A 1TREA 1E6PA 4U5KA 1GOWA 3GDLA 3V36A 2YZ5A 4MUZA 4TOQA 3URBA 1KM3A 2P10A 3OA3A 4UTLA 2PI6A 3W7LA 1YNPA 1VCVA 4GUHA 4JYEA 3VPLA 4YTUA 2XPKA 3TZNA 5AN7A 2ZZ5A 1I1WA 2H9AA 2YBTA 4AWUA 3M9YA 1W5QA 1UASA 1TPC1 1PUDA 4LALA 5G4WA 4K7VA 3PULA 4N9EA 1CYGA 1FHUA 2PLKA 1XLMA 1VLIA 2PGRA 1IR2A 4URIA 4NILA 3RM9A 1Y65A 3TE9A 4HN4A 3P0WA 3T4WA 3EA2A 4MWAE 3WDQA 4CEXC 4ROPA 3VOJA 2WPBA 4ZGYA 1D7FA 2CKSA 3JRKA 3TN4A 2WSPA 1UR0A 2ALRA 4AVNA 3QBUA 3U4AA 2YXXA 1WO2A 1D3CA 2BP1A 4OV4A 1Q7MA 8A3HA 4DRSA 4GIAA 3W6LA 1BTMA 1W0MA 1OCNA 2FPYA 1XDJA 3N11A 1RQEA 2EKGA 3CMGA 3PPHA 4BA0A 3LCXA 3N18A 2D0GA 1EO7A 1YW1A 3GXNA 3GW3A 3I3BA 4RPQA 2POTA 1B30A 2ZIDA 4HZ7A 3WFAA 4JTGA 3SBFA 4QFUA 5FJOA 1DIEA 1FHVA 4UMAA 3W22A 5IRPA 3OB8A 3WLMA 4RDYA 3W71A 4ZZ9A 3F5LA 4X9SA 4OBTA 3E74A 4R53A 4KMQA 2ISFA 1EL3A 3F5JA 1LWHA 3MKVA 2FIQA 5L6UA 2A5HA 3N17A 4B5XA 2R6OA 1DJZA 3P8JA 4M6UA 3TWAA 1LZOA 4G7FA 1P0BA 1UCWA 1GHSA 4PYSA 4HCDA 2DSVA 2XH0A 3R1ZA 3SSJA 2QKFA 3L9CA 4DM1A 3NAVA 4A21A 2J78A 3AHZA 2PDFA 4NAFA 4QTGA 3GR4A 3TTYA 2VC5A 4ZA0A 5CPMA 2ZZ6A 4YU1A 3TU9A 4AX6A 1PWMA 4EF8A 1OEPA 4RV8A 2R1MA 3JZEA 4TO8A 2XN0A 3TYEA 3VCNA 4KFPA 4OECA 3N12A 4AAJA 1CDGA 3KP1A 1QNVA 2YB1A 4ZCWA 3VUSA 3VM5A 2HSAA 2ABAA 3SIMA 1L6FA 2WCSA 3L2MA 1EB3A 1VFTA 1BPLB 4LXFA 4CKQA 1X1OA 1RLCL 1EHAA 2DT3A 5JIWA 4EANA 3CGTA 1XUZA 1CGUA 2J7GA 4TQTA 1U1UA 1Y0EA 3KCLA 4IIGA 1FWFC 4E4UA 1OD0A 1QPOA 3DFHA 3GDMA 1I75A 1TRDA 1FWCC 2VMFA 3M7WA 1XKYA 2P0OA 4AD2A 1IIHA 3EEGA 4Q33A 5E5CA 1F2JA 3KCOA 3W73A 1GW9A 3S4TA 2E40A 1CECA 2O7SA 4A6GA 3K13A 3KOXA 1RALA 1TWDA 1JCNA 3T0TA 2P8CA 3KEHA 1S5NA 1IEXA 4P7NA 6ALDA 3NSMA 2P8BA 3HN3A 2OCZA 1AL8A 3TK7A 1KFJA 4PH6A 4MFDA 2WO5A 3W4RA 2XIBA 3STGA 4GUFA 2ZVRA 3W7QA 2VJXA 2YDSA 1S2TA 4O50A 3WL0A 5AKQA 1V51A 3H8AA 1GVEA 1P0DA 3VIKA 5LIYX 1S2UA 2IXVA 2Q01A 2E09A 3ABOA 1C29A 3WH6A 4YIWA