1XYNA

Structural comparison of two major endo-1,4-beta-xylanases from trichodrema reesei
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
178
structure length
178
Chain Sequence
ASINYDQNYQTGGQVSYSPSNTGFSVNWNTQDDFVVGVGWTTGSSAPINFGGSFSVNSGTGLLSVYGWSTNPLVEYYIMEDNHNYPAQGTVKGTVTSDGATYTIWENTRVNEPSIQGTATFNQYISVRNSPRTSGTVTVQNHFNAWASLGLHLGQMNYQVVAVEGWGGSGSASQSVSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural comparison of two major endo-1,4-xylanases from Trichoderma reesei.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords ENDO-1,4-BETA-XYLANASE I
total genus 42
structure length 178
sequence length 178
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 1994-08-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1xynA00
3VHPA 1W2UA 3AKPA 4IXLA 1F5JA 5K7PA 2B45X 3B5LB 1NLRA 4XQ4A 1HV0A 1HIXA 2BW8A 2B46X 3WP6A 3MF6A 4XQWA 2DFCA 3WQ0A 1YNAA 2DCZA 2BWAA 1XNCA 1OLQA 3VHNA 3WP5A 4HK8A 3WX5A 2NQYA 1HV1A 2DFBA 2QZ2A 3VL9A 2JICA 1BVVA 3MF9A 1XNKA 1H4GA 3VZJA 1KS4A 1XYNA 3VHOA 1UU4A 4H7MA 3AMHA 3B7MA 2VUJA 1OLRA 1XYOA 4S2FA 4NPRA 3WP3A 3VGIA 1PVXA 5EJ3A 2Z79A 4S2DA 3WQ7A 3RI9A 2VGDA 2QZ3A 2DCKA 2VG9A 3WP4A 1QH7A 3AKTA 1XNDA 1BK1A 1H0BA 1UU5A 3RI8A 2DCYA 3AMQA 1H1AA 3WR0A 4S2GA 3HD8B 3AKRA 2BWCA 1M4WA 3WXPA 1XYPA 1OA3A 2DCJA 5K9YA 4S2HA 1UU6A 1XXNA 3ZSEA 1XNBA 1OA2A 1BCXA 3MFCA 1KS5A 1T6GC 2C1FA 3MFAA 1H4HA 3VZKA 1QH6A 2NLRA 2B42B 3WT3A 3VZOA 1C5HA 2JEMA 4HK9A 3AKQA 3VZLA 3O7OA 1ENXA 1IGOA 2D98A 3M4FA 4XPVA 3AMPA 2BVVA 3WY6A 1TE1B 2VULA 4XQDA 3AMNA 3VZNA 1H8VA 1REEA 1REFA 3EXUA 1AXKA 4HKOA 1REDA 3AMMA 3WQ1A 3LB9A 3VZMA 1UKRA 2D97A 4HKLA 3AKSA 5HXVA 1C5IA 2F6BA 3VLBB 4HKWA 2JENA 3VL8A 1OA4A 3LGRA
chains in the Genus database with same CATH superfamily
3SMHA 1SCSA 1XRUA 2OT7A 2W5FA 3VN4A 4EN8B 3MYXA 4XBLA 3ZVXA 1X9TA 4XABA 5LK7B 1GOHA 4TTGA 1JU3A 2Y34A 4UFIA 2WC2A 1U5IA 4ET7A 2VVEA 5C9AC 1DZRA 4N53C 2JE8A 4WM8B 3LQCA 3MPPG 2E63A 2CGOA 3LEIA 1GQPA 3RVHA 2W94A 2GMEA 2Y38A 1BBT2 2D6LX 5FZHA 1VRH1 3I4IA 3PL0A 2XVGA 4LOTA 1S2EA 1MACA 4XJUA 1DQ5A 2CYFA 4GWMA 5JI7A 3R4SA 4OQ9A 4IERA 4MHUA 3OPZA 1NLQA 4XHBA 1OD5A 5F9TA 4MGYE 5K0UA 4B8EA 1W6MA 1ZRDA 1YI9A 2P34A 2QQKA 3NNGA 4UFHA 1M06G 4AR2A 1KD7A 1V00A 3EQEA 5LWBA 1RUF2 2WN3A 3OUJA 2XUEA 5ABJA 3NKTA 1SFPA 1YQ5A 3ZSKA 2Y6HA 5ANQA 3KSCA 3NVCA 3WNLA 3VKMA 1LOGA 4LIVA 3N35A 1RUNA 2K2SA 2RDRA 1HJFA 4HG6B 1DYKA 5FREA 4PBOA 1PGW1 3DPRB 2XLFA 5A1LA 3G7DA 3V64A 1E5SA 5E1RA 1WCKA 5EJ1B 5E88A 1RXFA 3OGGA 1SG3A 4MGZE 2YPDA 1VRH2 2P4EA 3HN3A 3NWKA 1L3JA 2DVGA 4UW5A 5KC6A 5DUUA 3W5MA 4EZHA 2Y0OA 1APNA 3R6SA 5FMCA 1ZRFA 3LDRA 2BGCA 1YJKA 2P3IA 1YWKA 5FZIA 5T5PA 2W1QA 3AJZA 4DNYA 5A32B 4Q4V2 1O6UA 3PVEA 1DQ6A 1GZCA 1N3QA 2JB8A 2RS13 3KF3A 4TSVA 1CAWA 2LTNA 4W50A 4YFWA 4J25A 2SLIA 3N7JA 4MXWA 3THDA 3AVRA 4AI9A 3J7MA 4IEWA 1QY4A 3DKQA 3GCXA 2ZZQA 1LU1A 3OSDA 3ZFGC 4LBLA 3N9LA 4I01A 5DAWA 2A6WA 4CUGA 1KRIA 1NG0A 4PT6A 2A75A 1RITA 1LTEA 1YLLA 1LHOA 4E8DA 1CAWB 4GMP0 1RUC2 1F15A 3F95A 4JTNA 5EYYA 1VBE3 3AMNA 3ENRA 3QH7A 3KB5A 4L8QA 1NA1C 1BEV1 1H30A 2BZDA 3N7KA 4E9KA 3PJQA 3HWJA 1H2KA 3OEAA 1DCSA 4NHYA 4YVSB 4DEQA 5IAXA 1CAVB 2HWB1 4H55A 2BQPA 1VLNA 3H7JA 3GZAA 4M3CF 3O1PA 1WMEA 1JOBA 1NKGA 3IMMA 5JXJA 3FMGA 1ENQA 1Y43B 2ARAA 3BU7A 5FZ0A 3WZ1A 2CAVA 4MOAA 2JJ6A 1VBA1 1UPSA 3RGBA 2HBTA 2B45X 2MPFA 3B5LB 3LD8A 3FE5A 4NWWA 1NX9A 1RUJ3 4QPGA 3VBOB 3WDXA 4AFMA 3HNBM 2K0GA 3BCWA 5LA9A 4YWAA 2VNVA 5A7QA 2XL7A 3KF5A 3P3NA 4QDQA 2DVBA 3H8OA 2AR6A 1NT0A 4R4XA 2OYZA 1DGRA 1YNAA 4QHOA 3C7OA 3RS6A 1UX6A 1XQNA 2TNFA 5T55A 2WYFA 4LJHA 3B02A 5DUVA 4GD4A 4AHZA 1EUUA 1LHNA 3MI8A 4QB2A 2VOTA 2DF7A 2TEPA 5T5OA 5D1IA 3PIGA 5APAA 4P9YA 1QDOA 4EN9B 1LRHA 3JB8A 4IV1A 2O1QA 2WO1A 2E51A 2XHKA 1Q8PA 1CZVA 1HB2A 2ZPXA 3KQ4B 2UY9A 2BERA 3PUQA 4XOGA 1JHNA 2WQ4A 1WLTA 4KMQA 1I9RA 3AVSA 1JH5A 5M0TA 4RSUA 3TN93 5CA6A 2IZWA 2VXRA 3LOBA 1AR72 1O8PA 4K6BA 4BIOA 1NUKA 2WWJA 1OLRA 5IAVA 1OFSA 5JCTA 4O9EA 2R30A 5BV6A 1AR83 1IS5A 4JKMA 1WD3A 4QPWA 5FP3A 1OKOA 4RL7A 1R093 1V9U3 4D6SA 1TVGA 3M8LA 3OB8A 2QKDA 5FPLA 2QFEA 2R043 2VZTA 2DCKA 1W6QB 1V6MA 1DP0A 5ANNA 1PZ8A 1UU5A 2F17A 3SH3A 2WYSA 4HN0A 5KXCA 5A33B 4UF0A 4MSVA 4NIAA 4I0AA 1GANA 1OA3A 1VALA 1YQ6A 1K5MC 4MGTA 1QXPA 4ZU7A 1SZBA 1AR91 4FCAA 2B9VA 2WRAA 3I3DA 3VBOC 1S0DA 3NV4A 4XUOA 3JBG1 1PO13 2DURA 3GM8A 4P14A 2G4IA 2RS11 4XFCA 1T6GC 1AZDA 4DRVA 2UYAA 3A21A 3AM2A 2RVAA 4W6YA 2ZX3A 4XURA 1C5HA 2GZWA 3IZOA 3KV9A 3MIEA 1NQJA 3POGA 2PLV3 5BPXA 4E27A 2D3SA 2RM21 1JW6A 1PIV1 4XIOA 5I0SA 5J09A 4FO9A 1NOVA 3E6BA 4CCCA 3C2UA 1NE4A 2UURA 1U5XA 1FV3A 1FPN2 3AX4A 1SCRA 3IDAA 1HX6A 3OBRA 4JX0A 4XF4A 3DYOA 4P9GA 3UGHA 3THTA 1O91A 1TME3 2BRTA 2ZGSA 4BDVB 3WCSA 3ZYIB 1G9AA 1FI2A 1MS0A 3AYAA 2EAAA 4HSLA 2VQ0A 2Y6LA 3QCWA 2YBKA 3DCQA 4OMDA 4AEDA 4Y20A 1S0FA 2E32A 5J98B 4GQ7A 4JC1A 3J8F3 1AYN1 5LEJA 4XDPA 4OUMA 1CONA 1VBB1 2JDAA 4BPZA 3MPBA 4P5YA 2IFWA 4XBQA 1H9PA 4Y20B 5GALA 3BOPA 2AENA 1ODNA 3VL8A 3C7HA 5LW9A 2CDOA 2ZMLA 3P1IA 1UXXX 2LM3A 2ZKNA 2OZJA 2Z4FA 1GLHA 3MUY1 2HYKA 1KEXA 4B29A 4BHPA 3CZJA 1J59A 3ZR5A 5CZKA 4IL7A 4K8FA 1QGLA 3POIA 4YRDA 3BIEA 1U12A 3LFIA 4WVMA 4NMIA 1XNAA 1RVF1 1HLCA 4N9IA 1IKPA 5KXEA 2CV6A 4XXAA 3O14A 5K4LA 3Q8BA 1PGL1 3WX5A 1HB3A 1JS9A 5L7OB 5FPAA 2DBIA 3ZFFB 3HVDA 3U4SA 3FLPA 4RGAA 4QDSA 1S4CA 3KV4A 2ADEA 2VXJA 3CKHA 5FQ0B 2ZTNA 4QXHA 5KHIA 3IKWA 4OHXA 1XNTA 4HONA 2Q8CA 3UNPA 4ZS2A 2OUJA 1ZBE1 4E2SA 2ERFA 5JOYA 4YZ4A 2WSVA 2BNOA 5A7WA 3ZR6A 2W39A 5CEHA 1RUG1 2QQUA 5H9RA 4DINB 2WNUB 1HB1A 1CR7A 4RHV1 5F32A 4JKKA 1I6XA 2DUQA 1ULEA 4GB31 4LBQB 2BUKA 4MYEA 2DU1A 4OULA 3ATGA 5A33A 4A45A 4LLOA 2BPA2 2W9XA 3AYCA 4QU2A 1RUI1 4LBMA 3CEWA 4P9IA 1CJPA 5FMOS 1W6NB 5HV4A 1VAKA 1W2AX 3I3BA 4AXOA 2O0OA 4COZA 4UFKA 2H6CA 1QF3A 1C8NA 2ID4A 3ZX7A 1AX0A 5EYXA 1ZBE2 4XCAA 4CPBD 1Z7S3 3ETPA 1QXJA 1RVF2 1W8WA 2ZGUA 3WF4A 4Q0VA 3WNMA 2LALA 2QQNA 4ZKTB 2VTXA 2RR12 1XJAA 5GZEA 1MEC3 2HEYF 5FOBB 1PHMA 4DXSA 1UX7A 5D8AC 3NNLA 1QQP1 4B1LA 2E26A 4Q2FA 5D2AA 2UWBA 4CU8A 3I3MA 2WNUA 4DO0A 5H9SA 2IXHA 2HWF2 3CU7A 1V6JA 2W47A 3MV01 5IK8A 3OGRA 5GLTA 2IXIA 4WVZA 4YGBA 4AVCA 3ZYJB 5A7PA 1H8VA 1O3QA 2VH9A 1W04A 1G9DA 2VQUA 1G8WA 2DDUA 2BOJA 2N7GA 2O8OA 4HSJA 4EWDA 5KHHA 3LB9A 1ZYBA 4CUCA 1UKRA 3PDQA 2VU9A 2VOWA 5LY2A 3K75B 2Q1ZB 4IGPA 1BQPA 4URAA 2RS52 3AKSA 4XF3A 4Y1XA 4UOJA 4BLJA 3ECQA 3O0VA 3NNMA 4KL1A 1OVPA 4ZY9A 5DXDA 5CAZA 1C5IA 1SFYA 4FPGA 3DXTA 4Y1VA 2JDPA 3VBFA 5FYHA 1QEXA 1OD3A 4YM3A 3PNAA 1F35A 1FMD3 3W58A 1PMHX 4QPIB 1ZZCA 3VD4A 2C26A 1I5ZA 1S2BA 4XEZA 3PVNA 5F3EA 3VKFC 1US3A 3FHIB 2XGXA 2XJPA 4OQ8A 4PDWA 2R072 5C8CB 4LO6B 1V6KA 1O5UA 2GNTA 1AJKA 3M3OA 1WMDA 3DL3A 1VMFA 4CDXA 1J84A 1FATA 3NRUA 3OYWA 4QMAA 4YZ2A 2DFBA 2E7QA 3B94A 3ACHA 4LO5B 1UYPA 3APBA 3VBHC 2DVDA 1LOFA 4GMP3 5DN2A 4BM8A 5A32A 4DOUA 3CHXA 4AAPA 4Q27A 1H4GA 2R32A 5C3SA 3L2YA 1PNGA 4OYUA 2J7MA 4Z2WA 2XLGA 4MXVA 2FCTA 4NIGA 3KGLA 1Q8VA 1LHWA 4LR4A 5FBZA 4CEWA 3BU0A 3VGIA 4HXCA 1C8M2 5A1FA 5JOWA 4FPOB 5EJ3A 4R9AA 1UY0A 2A3WA 2OPKA 1POV0 5HPOA 2CWMA 3D0SA 4MGQA 4AF9A 4RS5C 1UF2C 1SDDB 2D6NA 2MEV3 4RGKA 4GWIA 1OUSA 1F5FA 2B8MA 4JDNA 1PO23 1ZBA3 3L2HA 2W1SA 5GLVA 3BI3A 2D6OX 2DBNA 4Q8LA 2VNOA 5K9YA 1CPNA 1O4ZA 2Y8KA 3WDTA 3TEYA 4FFFA 1QHDA 4QX0A 2QBXA 4LEJA 5FPVA 3LDBA 4COYA 1Q5OA 2HWC2 5A7OA 1L7LA 3MFCA 1H6XA 2C1FA 4CCJA 4Y22A 1ZZBA 4RFRB 3VB9A 3WT3A 4MZUA 1DGWA 1RIRA 2C24A 3NQHA 3T08A 2FDKA 4XJAA 5FFOC 2QQJA 4KWJA 3ZXDA 4EROA 4QX3A 3OG2A 4G3YC 1F4AA 3HQUA 2VZPA 1J1TA 4GAZA 2YFZA 4NHKA 5DZGA 3AMPA 1PGW2 2PAMA 2VO5A 4IV3A 3WD5A 1CIYA 1UZWA 2G9FA 1X36A 2W91A 5FYSA 2A6ZA 3SH5A 1AHSA 2VZQA 3NAPA 2D5HA 5IW0A 4WM8C 1DQ2A 3A0NA 2IXCA 4O7XA 5FXZA 5JPNB 2IFRA 2WT2A 2DUPA 2WNVC 2CWSA 1BLZA 3JUUA 1HRV1 2HWE2 4RYDA 1OT5A 1AXKA 2G19A 1DF0A 4QAWA 1LENA 3ACLA 2UU8A 4QQOA 4XW3A 1AL21 3S6PA 2VMFA 3UETA 4BQYA 5C7GA 1EAH3 1NY72 1ZZ6A 3UGFA 3S5QA 3I2OA 1MPXA 1DDLA 2Q8DA 4G9SB 3WW4A 1YQ8A 5DG1A 1ENRA 3BGAA 3DV8A 4XDQA 1FPN3 1NXMA 3VHPA 2W87A 2E31A 4YZ3A 4AI1A 4CEYB 5A70A 5JMOA 2IWGB 1JYXA 1W6PA 3T0BA 4AHXA 2JG8C 3CBNA 4PDWC 1HV0A 2Y0IA 3VBOA 1HRI2 1ND2C 2ZGMA 4PLOA 3AP6A 4JQRA 3WP6A 1B35A 4OFGA 3WDVA 4EN6B 5JZGA 3MZHA 5JZGC 1LOCA 2XJUA 4AI3A 3J26N 2GNDA 4N90A 4Y26A 2W2IA 1EUTA 4INDA 3AYEA 5C5TA 2ILMA 4X6RB 2NP0A 1C1LA 1FOD2 1PM4A 1RMU2 2Q1MA 3IN9A 2VZOA 4M3CB 1AYM2 4R9DA 2BTVC 4P02B 4UFMA 2GSYA 2WLPA 1RHI3 1WGPA 4YW7A 1GZTA 1WZXA 2YGMA 3MIFA 5FLJA 4XUPA 3FUOA 4Z92B 1ND3B 3O1SA 3O5SA 4LBJA 5A3UA 1SPPB 1UOGA 1RUI3 1UY3A 3OD0A 2LROA 3SKVA 5JIUA 2RJLA 1OVSA 4M00A 4XJ8A 1AR63 3EJKA 2HBUA 3P3PA 3VHOA 4A3ZA 5CVRA 4EWEA 1DYOA 4KGGA 1XSQA 2P37A 4K3UA 3U37A 4B7EA 1GMMA 2WABA 2Q1FA 5IK7A 4GALA 4RS5A 5HI0A 4RR3C 1PO12 3RWKX 1RUG3 1YCIA 2XHNA 3BALA 3O0WA 4PLNA 1F31A 1PVXA 5FYBA 4AFDA 3POWA 5AFBA 2XQXA 4JGZC 3EHKA 1DHKB 2AYHA 4FOWA 4JKLA 1JZ7A 2MHFA 4QQLA 1HXS2 2XBO1 5IFTA 3IWZA 5JDBA 2BNMA 4Q4W2 4Z8BA 1BBT3 4N43A 4Y5Z0 3ROUA 1GWKA 4XILA 2QQMA 3E1F1 3TBDA 1UU6A 4ZS3A 4QB1A 3NSTA 3ZPYA 5AVAA 5FZ4A 3TEZA 4MH0E 2NPIA 3HIFA 1RUF1 3AP9A 1PMIA 4NPMA 3TNQA 1UCXA 1K5MA 1RGSA 5FYYA 4OI1A 3VBSA 2VCBA 3ZYFA 4XE9A 1LHVA 3ES1A 2NLRA 3DPRA 3KHBA 2BVBA 5EXOA 5H9PA 3T30A 3ZFGB 1IKQA 3K3NA 3GCWA 4CP9B 4PHZA 3ZKYA 4BLIA 3INAA 1ST8A 4MV2A 4XZUG 5DUXA 3B00A 4W8JA 4B1MA 2ZGKA 5KC5A 3GJBA 3MICA 3POJA 2CY6A 1AX1A 4NRPA 4FFIA 3W21A 5FLHA 4YPJA 3UJQA 2JX9A 1UD1A 1JZ5A 2IUWA 2WZR2 2X53S 4OHYA 3I2IA 5I93A 4AE2A 2R062 4AFAA 5JPMB 4BXFA 2YYOA 1MS3A 1REEA 2C9AA 2D6PA 3FBMA 4OLLA 3U1XA 1IPKA 5FUPA 4HT1T 4NJ4A 4C8DA 4HZFA 3IBMA 3OBTA 4CCLA 4BQ3A 1RB8G 1OLME 3AP4A 5FV3A 3WQ1A 3EBRA 1JZ3A 2D97A 1LOBA 2RS12 2FZ1A 1GV9A 1ZNPA 1H6YA 5FY0A 3UYJA 2NYYA 3CJIC 4I30A 1O3TA 1D4M3 2ZEZA 4K9SA 1GOGA 5A6QA 3LGRA 4QXBA 1W3VA 2DTWA 4A7KA 1JZ2A 4YW6A 4JGYC 4XQ4A 1QJX2 4CDQA 4FPFA 4R52A 3WF1A 4LT5A 2HLEA 1SLIA 3I97A 2VCAA 3UKNA 3VBUB 1LCLA 5FJKA 1D4M1 1CAUB 3ZIWA 1K12A 5JXGA 3VDAA 4PDWB 2WFF2 5HCFA 4CPBA 5CADA 1IS3A 2ENRA 4DXTA 4QPIA 2JD4A 1MZ6A 4YYOA 1KDMA 5JOZA 3H0OA 5EFUA 4B3NA 4CP2A 3UKVA 5G04L 5I0TA 2C9KA 4DPNA 3WV6A 3VDCA 3FLTA 4YNIA 4COWA 4BK5A 5KXDA 3ZXJA 4LLFA 2BGOA 3BVCA 2WN2A 4KU8A 1YQ2A 4TXWA 5FYVA 1E5RA 3ZXFA 5BNOB 2C0ZA 1CJDA 3IT8A 2ZHLA 1AJOA 4UXAA 4XUQA 2ORXA 1UWWA 2QQIA 2P3YA 2VOVA 3NMBA 4D94A 5C3RA 4YVWB 1P8JA 4QU1A 2VGDA 4UBGA 1W9FA 2QJVA 1OOPA 1S0CA 5FP8A 3K51A 5JLVA 1H0BA 1A8MA 4HPKA 4YLZA 3AMQA 4AFCA 3B01A 4BQ2A 5B4NA 3OD4A 1G9BA 4WBBA 2DUOA 3KGZA 4DUVA 3VD7A 4LBOA 5FPXA 2BP6A 1M4WA 1OFNA 5LRRA 2A3XA 5HCAA 3JD73 3AK0A 2ARCA 2JDZA 2VMHA 4LUKA 1GNHA 5DDJ1 4COVA 3POYA 4FT8A 1OUXA 3G6JB 1UXZA 5K8SA 1I3HA 3KT1A 1FX5A 1XNBA 4IEOA 3WDWA 3O1RA 2EIEA 1JBCA 3AL6A 4W6XA 1W9SA 4MGIE 1ASJ2 1NQDA 1B09A 1UY4A 1W0PA 2P1BA 3AZXA 4MADA 3HR9A 2B4KA 4QQPA 1AL0G 3OGJA 5EP9A 3V0BA 2FMYA 1ULCA 4CU9A 3JD71 2VZ3A 1MEC1 4IEYA 4LKFA 3IPVB 5FPUA 1PO22 2Q8OA 3VZLA 2VUAA 4NO4A 3WHUA 1FT9A 1WLWA 3ZM8A 1H8TC 4IGQA 3A0KA 1DLLA 1SLTA 4JHZA 3WY6A 1TME1 4A44A 2WA4A 3WW1A 1YC61 4FTEA 1R1A3 5AC93 3LOIA 3RYKA 4AVAA 1DQ4A 3SNMA 3KHCA 4FAHA 4Y22B 4XFIA 1KJLA 2D44A 3MIGA 4XBNA 4COUA 1JYVA 1PGSA 4MVTA 3T0AA 4LBQA 1IG3A 1VBE1 2XJTA 5FYUA 2GC0A 2EXKA 4XFGA 2WFPA 2HWF1 2Y33A 3Q8AA 3WW3A 3LIGA 3I2KA 3ALQA 3JQXA 1YFXA 3E97A 4JDOA 3POBA 4GH4C 5JVVA 2PQSA 2D7FA 5CFDA 3URFA 1LKNA 5T5LA 1KGYA 2YU2A 2HWB3 4QPGC 4BQ4A 3O1OA 4CCOA 2ZX1A 3I2HA 3E5XA 4JVAA 4NN0A 4QKBA 4QT6A 2OS2A 3KV5A 3M3IA 3ZFFA 5IVVA 3M1HA 1ZVFA 1FPN1 3HAGA 4QKNA 4AQ6A 5FY4A 5EQUA 5FIXA 5F3CA 3VUOA 5L36A 1RHI1 3TOJA 3DN7A 2JG9B 1OQDA 3RRDA 4FAGA 5B2GB 2DFCA 3WDYA 5LY1A 2RDSA 1EYBA 2VECA 4ORFA 4RN5A 4UW4A 4R4ZA 2VUCA 2LRPA 4QPIC 1OLQA 1V6OA 2WQZC 4IV1C 3VBSC 1VR3A 1RJ7A 2DV9A 4FSJA 4META 2XWJB 2QNKA 4BQXA 2ZEWA 1R083 1GICA 3RZZA 1W28A 3N9MA 4FPCA 3VDDA 1EV11 2AC1A 2DU0A 4I09A 4KBBA 4EN7B 4IW3A 3MGUA 3JCIA 2GDFA 1SLBA 2YU1A 4MUVA 1AYM1 4W65A 4H7LA 4HMZA 5FK7A 4UBHA 5FWEA 3SC7X 1RVF3 1NE6A 1SBEA 4IE4A 1PM7A 5A3TA 1KS4A 5JI9A 5L19A 4Q0PA 3U11A 3MIBA 3WUCA 3WNOA 4QM8A 4XFHA 5J36A 1ZA7A 4LA3A 2J42A 1QU0A 5T50A 3SH4A 2BV4A 2ORZA 2VNGA 4CEYC 3R4DB 1ZBA1 3ILNA 5F8PA 3ZXEA 4Y5TA 5FKCA 1FOD3 1OXCA 1VBC3 4XTPA 4KWKA 5CNAA 1ZX5A 3D5OA 5ACA2 3NL1A 3QH6A 4FOVA 1F2NA 2VCCA 2A73B 1VB2A 1GZ9A 1BMV2 5FYMA 4Y5SA 3WG1A 2R041 4TLFA 2QVSB 4YARA 3LEKA 5IVEA 2ZZJA 1E5IA 4C1XA 1CQ9A 1IOAA 4BISA 4AVVA 1AR62 2CGPA 1NCQB 2A6XA 2QQLA 4TN7A 3DGTA 1N1TA 2CGNA 4GIQA 4J1XA 2DYCA 1HQNA 3ORJA 4ONUA 3T1MA 2HWE1 5GLZA 5L9RA 1NCQA 2D6MA 2PQQA 5JSRA 4Y4YA 1FNZA 5A3PA 4Q4X3 3SEEA 5FRAA 1HDKA 3J8F2 3FFZA 3BN6A 4P9XA 1J3QA 5DPNA 1U5YA 5FCCA 4BU2A 3KCYA 2ZGLA 1H1IA 2J1SA 1N47A 1YUDA 4CCMA 4BMBA 2RS53 4BMEA 4V2WA 4P08A 4HK9A 3THCA 1DQ0A 4Q4W3 1K45A 4QPYA 4HLTA 4C0BA 1RUD3 5BY5A 1W2OA 2BVVA 2NM1A 1JMUB 1GFF2 4A3XA 1JYCA 5CIRA 2OQ6A 4EV0A 2ZMNA 3AZVA 5L9VA 5J37A 3UGGA 3B3QE 3VZNA 2RDNA 3RFRA 5CKQA 2FHRA 3FJSA 3K46A 2FCUA 4RQPC 5FY5A 5LRSA 2WZR1 2VBPA 4YW1A 2RMU1 3H42B 4RQPA 4BJ0A 5BNNC 3VDDB 1SFNA 3LFMA 4O61A 3AZWA 1RUJ2 2WT1A 4CA9A 2VW0A 4BK4A 3N36A 3P6BA 5C3QA 3ZXAC 1SACA 2YHJA 1PK6C 4Q0QA 1CZTA 1IG0A 1Q8QA 1QQP2 2IXJA 1RUC3 3J8F1 3M3EA 2Y64A 4CDWA 4ES9A 5C9AB 2XB6C 3O1MA 2ZA9A 1XSRA 4GULA 1UW8A 5FUNA 2MNGA 3VBFC 2RS31 1WKYA 2ET7A 3MLLA 4G4FA 4WVWA 3M7AA 1NCRC 1NZCA 3VKOA 4AQ2A 3FUQA 1KJRA 2JD9A 3RZLA 1XNCA 5ERLA 2Q30A 4F83A 4LQRA 4GZ9A 3WQBA 3A4UA 3VHNA 2JDKA 4K8RB 4QXCA 4P9JA 1LHUA 1D4M2 1OF4A 4I02A 5FZ3A 1K42A 2QZ2A 1RYYA 2ZEXA 1A6CA 3RJ2X 3ZFGA 1UZZA 3AZYA 3EYPA 4E4ZA 2XJSA 1W03A 1F4HA 1UY1A 2ARBA 1ASJ1 4QQHA 1Q8OA 4FOYA 4LULA 5L7OA 4JRAA 1W2TA 4KWUA 2QCSB 3PUSA 4I2OA 3SKJE 4KNCA 2R071 4YM2A 5JXIA 1CAVA 1R081 2QQWA 4BQ1A 1W8ZA 2W68A 2D43A 1DFQA 2FDFA 1NA1B 2K46A 2WINB 1X33A 3EMRA 3BODA 2P3JA 3JU9A 3ZDVA 3L9JT 2XJVA 4GB33 1BVP1 2V4AA 2ZAHA 1RUF3 2ZGPA 5F6KA 2J1UA 5F5IA 1QH7A 1Y4WA 3V0BB 5HCHA 5FP7A 3BPZA 5FBJA 5C4WB 2FMDA 1UYZA 2CAUA 3AKRA 2PN5A 1FXZA 1GNZA 1S0GA 3BOWA 5DUWA 5FZAA 4CDQC 2GN3A 1GUIA 3H3UA 4QX7A 3RZJA 5FZMA 1C3HA 3O1VA 1V6LA 2X8KA 5LBCA 2OXBA 4CE8A 3KVBA 1G86A 5FZGA 2R042 3NV3A 3V56A 4EN0A 2ZBJA 5D8AB 4Y3OA 1WD4A 3RWNA 5FY1A 2XH6A 4AEJA 4PF5A 3MW3A 1VBD2 3U14A 1C8M3 2GNBA 4YVSC 5J96B 1EAH2 1PX3A 1X50A 4D7SA 3WSOA 4HVQA 1ZRRA 3NNJA 1A78A 1HN0A 4PQQA 4FQZA 3ZFEC 3K2OA 4YVWC 3Q8CA 2FD8A 2X5IC 2JE9A 1ENXA 3RPQA 1N1YA 2W08A 3WF3A 1FAYA 2J1AA 3UV9A 4CP0A 4BA6A 1DBNA 2ES3A 5HCBA 2RV9A 4XFFA 3TAYA 3D8CA 3S5AA 3NAPC 4Y33A 4DY3A 1B35B 4QD2A 3HN1A 2VOKA 3ZN5A 5C33A 2YC4A 1PMJX 4HOOA 2D3RA 3VHRA 1HB4A 1MVQA 4QXKA 3H8UA 4FTSA 1REFA 3PIJA 4N9HA 5EPAA 3LA3A 1V0AA 1AL23 2PLV2 4NIIA 4UFJA 3KWVA 3HMYA 5ABJB 4FQ4A 4OHVA 2XKPA 3IAQA 1VB4A 2AEYA 2VVDA 4JQTA 1ZZ7A 1PIV2 3IDBB 2FQPA 2C5DA 2F6BA 2AREA 2ZGNA 4QWNA 2HJIA 1UIJA 3SITA 4PI0A 2WNEA 4IXLA 2CTVA 2VUDA 1LEMA 3HBZA 3QOPA 4CDUB 4D6RA 3RZKA 2Z69A 2P5BA 4KQ7A 4YG0A 3RNSA 4CDQB 3LEGA 3MF6A 1JZ8A 1ND2A 1UOJA 4JRLA 1YYNA 2JDYA 4N8MA 2YC2A 4NR1A 1FV2A 4IETA 1O4TA 1QXRA 3WNKA 2JG8B 4XACA 3JZVA 4HBNA 3IIIA 2XJQA 3WDUA 5BXXA 1VRH3 2NQYA 4ITCA 2WO7A 3OBAA 4FFHA 1JI6A 3VL9A 2QTWB 4GJZA 5DZFA 4AL9A 4A6OA 3PLQA 1NZIA 1WBLA 5DAVA 5I0DA 1EV13 1RUOA 4Q4Y1 4AZZA 3TN91 2V5DA 2W52A 3ILRA 3I54A 2X29A 3AB0A 3EB7A 3O1TA 3ZN6A 2EIBA 4QX5A 2VMCA 5JIAA 2D3PA 4AYUA 1AXYA 3ASIA 2Q4SA 1CIWA 1MS9A 3RMXA 1W8NA 3ZOIA 3AP5A 4QGLA 3QACA 1QNYA 4OVEA 2B39A 5BNNB 3WNXA 4LPLA 5KXBA 1G9CA 1AR73 1OMIA 2X5IB 2WBKA 3AKTA 5BNPC 2ZXQA 4J6GA 3RDIA 1DGRN 1OSGA 3B9IA 4C1WA 4S2GA 4ZU5A 1GBGA 1S0IA 4XMAA 4OI2A 5D21A 3BTXA 3HD8B 4Z2AA 2RS51 3FZ3A 1W9TA 3WXPA 1OOPC 4CEWB 4JAAA 1LEDA 2ZGQA 4NHLA 4UW3A 5KR7A 4H2AA 2VR4A 5LCWL 4Q4V1 4YVSA 4ASLA 1SQ4A 2GMPA 1YXWA 4P9LA 5G05L 3VKLA 3FN9A 5FJHA 4WVVA 5E89A 2I45A 3H3LA 1A34A 3MFAA 3GZTB 1GU3A 1POQA 3ACGA 1ZREA 3PURA 5GZDA 1ZZ9A 1R1A1 3VV1A 4OMCA 2CHHA 4Q26A 4FFGA 3WG4A 4DFSA 2R0FA 5AC91 3I49A 3GZEA 4NHMA 1ULGA 4NHXA 5FP9A 2YMZA 5FYIA 1H2NA 5FO9B 2NMNA 3WOGA 2PMWB 1ULOA 5FYZA 3KVAA 5A3OA 3ZXKA 2E9QA 2YB7A 4CDXB 2F4PA 2PHRA 3U75A 3NJYA 1UL9A 2VMGA 4LUMA 4AWDA 4CRQA 4SLIA 3I8TA 1UZVA 1TMF3 1R092 1V9U2 2WWUA 2W0XA 1CX1A 3USUA 1CESA 4IE7A 4XZPA 3H9AA 2WZPP 3I3QA 4Q4X2 4IEQA 2W46A 3J4UH 4D0QA 5F3GA 1YFYA 2RM23 3ZMNA 4PIXA 1G6NA 3CJIB 1S0BA 1NA1A 2I07B 2AH2A 3S7EA 4HKOA 3ACFA 1OH3A 5E8AA 3RYRA 2AZ5A 5JOXA 1AF9A 3OJBA 3IB3A 1GP6A 4L97A 1QJY1 4LITA 4AFBA 4AVTA 3O0XA 4Y1ZA 1EPZA 1S1AA 2EIDA 3I59B 4UFLA 4F8AA 4HKWA 5BNPB 1N3OA 1EPWA 1RUE3 1GZWA 1RUJ1 1SDWA 1UYYA 2C6SA 1K3IA 2XWBB 2AACA 3O12A 4BH9A 2BDRA 3J7NA 3WHTA 1UY2A 3CZUA 3H1YA 3NO8A 3LCPA 2BYVE 4IEUA 4K1YA 4QKDA 4XMIA 5LA2A 1VBA3 1WCQA 4XTMA 5EJZB 1W6PB 5KHJA 4XQWA 1AUYA 1BJQA 4M01A 4E4DX 3HT2A 3QLQA 3R4UA 5FXVA 4JTOA 2ZOEB 1HXS3 5SV8A 1DQ1A 2BFUS 2RHPA 1A3KA 1XE0A 4D8MA 3MV11 2HWC1 4BB3A 1VPHA 3VD9A 4XUNA 1W6MB 3DXUA 3I2DA 3ZSJA 3BTAA 1PVC1 1WLDA 4P00B 1UMHA 1ZBE3 1JTZX 3X29B 2BNNA 4V2VA 1XOYA 3MIHA 4E8CA 1R64A 2JECA 3VZJA 4TWTA 1QJFA 3AMHA 4Q29A 2WZEA 4XC9A 2VZRA 4YGDA 5FP4A 1KQRA 1XYOA 2XPJA 3D4KA 1JYWA 4S2FA 5I91A 2WAOA 1DIWA 2A7AA 2IVIB 2VZVA 4I0BA 4M3CE 3T4HB 4UI9L 3WP3A 2J1RA 4B4PA 1VAMA 4WM8A 3SCFA 1AYM3 1ND2B 2Z79A 4CXXA 1US2A 2WFF1 2YV8A 1FYUA 1RL3A 1TQ5A 2YXSA 5FKBA 1BXHA 3D3AA 5FMOL 4CDWC 4PIYA 1GKBA 2VG9A 1V70A 4DUWA 3JQWA 4N43C 5CU1A 5I0RA 3U0ZA 4DZGA 2R0HA 1IS6A 4BOWA 1NXD1 1ULPA 5H9QA 4ZU4A 1X82A 1OQEA 2ZAAA 4DIQA 5F2SA 2YGLA 1NY71 3DYMA 4FPYA 5LBEA 4Q4V3 4A42A 4XHXA 2Y6KA 5FZOA 1OLMA 4JHTA 4YGCA 1X9PA 1W06A 5A7WB 2RMU2 3FHAA 3S7IA 1XB9A 4TYSA 3HPNA 1YO8A 3NW4A 3AP7A 5CB7A 4K20A 3VBHA 1UYXA 2UYBA 2HEVF 2R16A 2V4VA 3M2MA 4NAOA 1O3SA 2G9GA 2XQRA 1N1VA 2GH8A 5LASA 4A7ZA 1YJLA 4LBNA 1IGOA 2D98A 4WM7C 5DDJ2 1UQXA 4CZSA 1UAIA 5F37A 1S2KA 2VNRA 4I0WB 1DZTA 2YBPA 3WLUA 4IUGA 4I3GA 4Q5OA 2E6VA 4WV8A 1LNSA 2Q0AA 3AZZA 2GP3A 4LK7A 5C70A 4NUBA 4B4RA 1CD3G 3PU8A 2YDEA 3D6EA 3RQ0A 4YZ5A 3H50A 3RZMA 1MS8A 4XXPA 5FZ8A 2Y60A 4C90A 5J1XA 3ELNA 2WZ8A 1NYWA 5F3IA 1RXGA 3MO4A 4JGYB 5FMDA 3MUZ1 1BK0A 1ZRCA 1W0OA 1DYPA 2XJRA 2ZACA 3VLBB 2JENA 5B4XA 4AVBA 1GQHA 2VW1A 3ETQA 3VD3A 2XOMA 3OF1A 1W2UA 3ZDSA 3ZXGA 3DEMA 2VMDA 4FTBA 5J3UA 3OEBA 4CCDA 4F3JA 4YZ1A 1HIXA 1TG7A 4BXSV 2A1XA 2J1EA 1PNFA 2WS93 1HXS1 1ONAA 2PYTA 4DY5A 3SQOA 4NVPA 2ET1A 3VBFB 4YFZA 5IVBA 1PGL2 1S0EA 1RUC1 1WWYA 3MIDA 1C4RA 1AX2A 1WBFA 4LE3A 1NCRA 4AAXA 4GWJA 1D0HA 1QNWA 1L7QA 1TME2 5A6XA 4XF0A 1WCDJ 4KGQA 4MLOA 1FMD1 2JG9A 3K3OA 1CAXA 2EICA 5DABA 4AOCA 1Y9MA 1HV1A 4QGMA 1UO9A 3LA2A 4ISQA 2X05A 1H8TB 4QDRA 1J58A 2WS91 2WJSA 2VTFA 2JDHA 5C5UA 5DZEA 2W1UA 2EVXA 2ZMKA 3HOBA 4HFSA 4M0HA 3KS7A 1XYNA 4BQWA 5JSPA 4NIHA 4Q4Y3 2XR4A 1ASJ3 1WUVA 2GNMA 5LK5A 5J7MA 4K7JA 5JR7B 2OX0A 3A22A 5AFEA 5FZOB 4OI0A 3JB4C 4FVVA 3ZFEB 5A1AA 4LORA 4NPRA 4LOSA 4XIKA 3D82A 4GWNA 2QE3A 4UF0B 3WEZA 4RD7A 1VMHA 1WCSA 4KWLA 4CUAA 1A8DA 5FUIA 3AXEA 5JR2A 1GP5A 4Z07A 4CEWC 3OTFA 3RZHA 4XVHA 4ARXA 3S57A 3RI8A 3CDZB 1EV12 3KD4A 2J1VA 2DCYA 3N7LA 4OHWA 1H1AA 5FWJA 3LKJA 5FZCA 4EZ4A 1RUH2 4CDWB 5C9AA 1U0AA 3K77A 1W90A 3B93A 1JU4A 4RHV2 2E53A 2PLV1 4AQSA 1KFXL 4EWAA 1XXNA 1JN2P 1W3XA 3DUIA 1SLAA 4RQPB 4WZFA 3RJRA 4GJYA 2DCTA 1MZFA 2GH2A 1H4HA 1UKGA 4NE9A 3H1WA 2XUMA 5KHGA 1JODA 4X8NA 1LECA 5FPZA 4B7KA 3OY8B 1C8M1 3TYJA 5A3MA 3ZIXA 3GHNA 4EYUA 1IQDC 3ME2A 1MQTC 4AGVA 3TEWA 4Q4X1 5IATA 1ZA4A 1HRI1 4XPVA 2HWD3 4TLGA 3ZFEA 1ND3C 4BQ5A 2B7YA 3PHMA 4ES8A 2AGSA 4E2GA 1OOPB 3ZN4A 2E33A 3C7GA 4XDOA 4YM1A 1W05A 2RR11 1WCUA 2OW4A 3WG3A 4ASKA 1TNRA 4XQDA 4AEDC 5JUVA 3LA7A 2F4LA 4YW5A 3MW2A 5F1RA 1QDCA 4K1ZA 2HEWF 3W59A 5A3WA 4KH9A 1PK6B 3T3YA 5BNOA 3ZSMA 1DGWX 4LKSA 2GALA 4NROA 4QX2A 4A41A 5BNPA 1W0NA 2H6BA 5I8SA 3AMMA 1PZ7A 1IPJA 1CAXB 1WA6X 3GBWA 4XFBA 3I3EA 3AC0A 4IEXA 1COV3 3USSA 3ZYRA 1WW5A 3KT7A 2RR13 3NJVA 1YRZA 2IXKA 3FFQA 3ZYPA 1NCRB 1IPSA 1IQAA 2Y26A 5CFCC 2LS6A 1GP4A 4QM9A 1CPMA 5FO8B 4XAAA 3ZPOA 4LXLA 5GJ6A 1F5JA 3I2GA 4Q1PA 3V0AB 3PUHA 3LPFA 1O4YA 4Y4RA 5CKNA 3D0JA 1PVC3 1GSLA 5DAQA 4UYBA 2O14A 3LE0A 1RUI2 1ULFA 2ZEYA 1VE0A 4AHYA 1ENSA 5KHKA 3SISA 2TUNA 1AR92 3ZMOA 2J1TA 1B35C 4CCNA 1WW7A 3VBUA 2VE1A 2WL1A 1BZWA 5JSOA 2FDJA 3WP5A 2EALA 4Z1VA 4FXKB 3N7MA 2V72A 4N7UA 1J83A 4P5HA 2ZHMA 3HQRA 5FZ7A 1RUG2 3MW4A 5FY7A 2XLAA 2H0VA 1STMA 5T54A 3U4XA 2BBAA 5HV0A 1HQLA 4LBQD 5FK8A 5DQ0A 1JUHA 1N1SA 5I0UA 1HQWA 2SBAA 2WT0A 1VBA2 1Z78A 2PHDA 2UWAA 4HL0A 1ODMA 4K21A 1Y7BA 4AI0A 4F7ZA 2VTXJ 2FDGA 1NAEA 1CWPA 3KCCA 2GAUA 4RFT0 4NPLA 1W9WA 4I3PA 5FYCA 3N9OA 3GNEA 3T2PA 1OBNA 3ZYGA 2RS32 1VJ2A 1Z7S2 5ABJC 1VBC1 4PJYA 3RI9A 2O8QA 4CU6A 2BBVA 1PO21 3ILFA 1O3RA 3BYWA 2ZGRA 1MVEA 4RGGA 5GZCA 4CVUA 4U2AA 4ISRA 1QJX1 2XVKA 4ZHNA 1G9FA 2P6HA 3WR0A 2FBEA 5FZ9A 3E6DA 4XJWA 2X10A 1W6OA 5C3PA 1W39A 5FR3A 4LHNA 4NRMA 1GNYA 5AVPA 5L73A 5CFDB 3DKWA 2ZX0A 2GC2A 4J1WA 3U10A 3ABZA 4AI2A 1AR71 4DQAA 1JOJA 4YG3A 1QJU3 2R6QA 1F9KA 3LPGA 1J3PA 4D3WA 2WDBA 3CL1A 1OH4A 5K0UB 5LBBA 4QHZA 5LA0A 5IT6A 4IEZA 2EXHA 1KXGA 1MQTA 2B42B 4L2NA 3I2FA 4AG4A 4EE2A 1JYIA 3CF6E 2BGPA 2JEMA 2QDRA 2RDQA 5JAXA 4R8HA 2HWD1 3AKQA 4PIZA 5CFCB 4LMFA 4YW2A 5T3NA 1LESA 3OUHA 4N43B 3O7OA 4X6QB 1GWLA 2JG9C 2DWRA 2D40A 2VM9A 5FZ1A 4N7IA 3S30A 3IIAA 1TE1B 1HJGA 2QQOA 3HNYM 4L11A 1RUD1 1Z0HA 4XETA 4BCUA 2VULA 1VBD1 3JBG2 5FY9A 3KLSA 3TNPB 5F2WA 2XKOA 2VAUA 4EQVA 2UWCA 4IV1B 4AK3A 3CNAA 4LIUA 2PHLA 1SHWB 4YM0A 3VKNA 2CDPA 3J7HA 2WZR3 4MGSA 4ZPIA 2PHWA 3PMEA 4HKLA 1OQ1A 3T09A 2HWF3 1H2LA 4GXLA 5DAPA 2NMOA 4E4HA 4C91A 5GZGA 1RTVA 3LF7A 1CN1A 4DS0A 1GR3A 1POV3 2A71A 1SMVA 4QPGB 4MO3M 2EF6A 4NOTA 2WIIB 4M3CA 5CBLA 1J1LA 4O65A 2VL4A 1DGLA 3CMGA 4Q1RA 3FBYA 2ZCWA 3LIHA 1AYN2 4R9CA 2YZ4A 2OQ7A 2R1DA 2WA3A 3AXDA 4Q0UA 2FZ2A 2BU9A 3KM5A 3LSEA 1IHMA 1TNFA 2R7EB 4MX3A 3WINE 4A7YA 2XL9A 2AUYA 3A7QA 4FXGB 1LB2A 3LDKA 4GA9A 1XC6A 4PCRA 4DEVA 4D69A 3UK9A 2YFUA 2WFF3 3NV2A 2P3KA 5D8AA 2CU5A 2D93A 5JXHA 4CTEA 5CG8A 1UU4A 3CO2A 2JIJA 1RUH1 2VD7A 4H7MA 3USUB 1YHFA 1S0JA 3ZKUA 5F7UA 1N3PA 1CAUA 2BOIA 2JXAA 2CNAA 2PTMA 2WWSA 4JGZA 3SHRA 4RR3A 5C4WA 4MXWB 1UZYA 2ARXA 3WQ7A 1FOD1 2Z5WA 5LA1A 1DLCA 3KZ4C 2YBSA 2Q5TA 3T2QA 2IVJA 3NAPB 4Y24A 4OZXA 2CSGA 5FAXA 3SCGA 4E4SA 5C71A 4FP3A 3BTYA 4FP2A 2VPVA 3PUAA 2FCVA 1D7PM 2IC1A 2BWCA 4Q4Y2 1XYPA 3OPTA 4D7TA 1I1EA 4QX1A 1T2XA 5CFCA 3GJAA 1AVBA 1BBT1 1QJU1 4XUTA 1VBE2 5LATA 5IVJA 3DECA 4Q4W1 3RMYA 4CU7A 4LBKA 4AQTA 3W20A 1OA2A 3N9QA 3K4ZA 4P9WA 2XONA 3IM0A 1X7NA 4EJRA 2FDIA 3TEXA 2EAKA 3TN92 1SBDA 2X5IA 5EV7A 3HBKA 4SBVA 1BEV2 4PQ9A 1VRBA 3VZOA 1QIQA 2KD7A 5GLUA 2OZ6A 4QX8A 1OKQA 5IHRA 3I7DA 5F6LB 3GBFA 1W6OB 2A6YA 2P17A 3BTZA 4ZXEA 3RZGA 1ACCA 3GZUC 3BPSA 4KU7A 4CP9A 3GXUA 3CQOA 3TRSB 3ZN6B 5CKMA 4WM7A 4YG6A 4BZ4A 2V5YA 2VZ1A 4CUBA 5C6CA 1KFUL 1C57A 1LJ7A 3EO6A 3R05A 3EXUA 3CJXA 4WZCA 1K5MB 1JOPA 2PFWA 3N9PA 1SEFA 2GMMA 1BEV3 1RINA 1LULA 1TMF1 2NZ9A 2VQTA 3MEPA 1CVNA 3SLIA 1R1A2 5AC92 2FDHA 4FPJA 5C8WA 1SLCA 1RUE1 5A7SA 1C1FA 3POSA 2JG8A 2G1MA 2PXJA 1IS4A 1HW5A 1X8EA 1AXZA 1NCQC 2XVLA 3C3VA 3PU3A 4QB6A 3QD6A 2RG4A 3E5QA 5CFDC 5KWRA 2GU9A 4JV4A 2I74A 5K7PA 3ACIA 4QQ2A 1NLRA 1RMU1 1OI6A 2WAAA 4ATFA 1JYNA 2JIGA 1FNYA 2BW8A 2YC0A 3LZZA 4IQPA 2B46X 5A7NA 4OI4A 3C8XA 3TB0A 4LK6A 2R061 1UOFA 4CDUA 1T6BX 2W92A 4RR3B 3WW2A 2E7AA 2P6CA 5JMCA 1YIFA 2D5FA 4OUEA 1QJY2 5C8CA 2BFUL 2EA7A 3F2ZA 3BIWE 5BNQA 5FDBA 4XFAA 3LSDA 1JZ4A 4HK8A 2YG0A 2ATFA 4DUXA 4YSFA 1RC6A 2WKKA 2WNOA 4W4ZA 4Y1YA 1BVVA 1XNKA 2VCMA 3P5BA 3MHZA 3O1UA 1ND3A 1UOBA 4QKFA 3GBGA 1RUH3 2MEV2 4MG2A 1E5HA 1KDKA 4H3WA 1H1MA 5FMBA 1UMIA 1YIPA 3B7MA 4O9GA 4XF9A 3H1MA 2XBO2 4XYXA 4CP1A 2V73A 1MS5A 4OHZA 3UKTA 3HJRA 1RHI2 1PK6A 3LWCA 3OPWA 4GMP1 4S2DA 3W9AA 2GP5A 4FPKA 4DMIA 3VD5A 5A6YA 3NKGA 4LO4B 3C7FA 5FXXA 1W8OA 2BEOA 1D2SA 3A23A 2Y6GA 1Y3TA 1ULDA 3PTYA 4KI5M 2UY8A 4L92A 3VBRA 4NAMA 3I2JA 5DMYA 1SBFA 1OPOA 2KM2A 3OBZA 5ACA3 4FBFA 3M3CA 5GZFA 1WLCA 2ZHNA 1MS4A 1TEIA 3ST7A 3S0MA 2KA3A 2W1WA 2DVAA 1R082 2IXLA 3OY8A 4ZXKA 3RG0A 3T2OA 4AEMA 4U36A 4URTA 1R1ZA 4GH4B 5FPBA 3AJYA 1D2QA 3H3ZA 2E7TA 4OUSA 2ZABA 3VBUC 4CDXC 3WUDA 1QH6A 1XE7A 1CZSA 1W9YA 2RE9A 1QOTA 3FWEA 4HVRA 2NN8A 1LGCA 3CLPA 3PJYA 4HVOA 5J48A 2R49A 1YI7A 2ZJCA 4C0HA 2HWE3 4ATEA 1O5LA 2WLQA 4IV3B 2ZS6B 5SV5A 3PUIA 1LOFC 2I2SA 1W2NA 1W8UA 2D6KA 4D7YA 5L7OC 3TWIA 2EIGA 1UNBA 2PHTA 2PHUA 2ADDA 4KG8A 5EZWA 2A6VA 4AI8A 2A3YA 2WR9A 4L99A 4AGGA 4L0PA 3UT0A 5DG2A 1OHFA 1MQTB 1UZ0A 5CISA 4FPLA 4IE5A 4KG0A 2RMU3 1YQCA 3HEIA 3PVOA 2WUHA 2WSUA 3HQXA 4LO7A 3T4VA 3JD72 1O8SA 4CXWA 2QQPA 1RUD2 1EAH1 2JWPA 3SXWA 1HRI3 1REDA 2GC3A 5GM0A 3UESA 3OCPA 3C7EA 2ZGTA 2P2KA 2OUHA 3OUIA 5DAXA 1UN1A 2AEZA 2QQVA 4HETA 3N3HA 4UW6A 4CSWA 1MZ5A 5C4WC 2QDNA 3DF0A 5HXVA 1GQGA 4ZZ8A 2B9UA 3Q8FA 1COV1 1ZZ8A 4FPHA 5I8YA 5JWPA 1Q56A 1OA4A 1RMU3 1WW4A 4RA0A 5FQ0A 3AKPA 5FZEA 4L9BA 4PLMA 1W99A 1F8VA 2LW8A 2WQ8A 1BKZA 2CL2A 3K48A 3FC0A 2B5HA 4YW4A 3BB6A 3JXSA 1LU2A 4UT5A 3E6CC 3GF6A 3RSJA 3WQ0A 1JYTA 1K5JA 1H9WA 4GB32 3WF0A 3LEMA 5FZDA 2RS33 4OCTA 1JZ6A 3VDDC 2A70A 2WNVB 2JKBA 2C4XA 4IGOA 1PZ9A 5GKAC 3WF2A 4BE3A 4XCBA 2ZX2A 1AR81 2VC9A 2YUEA 3KV6A 1E57A 4H14A 4A2UA 2PHFA 2DVFA 2HYXA 3IDCB 4IV3C 1AR61 4XF1A 3AFKA 3H8XA 5EIYB 1C28A 4BWOA 4A4AA 5C3OA 4NRQA 3OYWB 1BYHA 2R1BA 4IE6A 1QJX3 5FZ6A 1OF3A 4LHKA 1D4VB 4DB5A 5LEKA 1RJ8A 4AEDB 1FMD2 1QJU2 2Z42A 2VQAA 1HKDA 5F5CA 5T52A 1UIKA 3R0RA 4Z82A 1GWMA 2DTYA 2MEV1 3THPA 3GGLA 4HPKB 5DDJ3 1WMXA 1W8HA 2JDNA 3B69A 2VZSA 3MDPA 1UPIA 2QZ3A 3OGVA 4M4PA 3WP4A 3V0AA 3AYDA 2R073 3KCXA 2WS92 4JCKA 4CCKA 1XNDA 3W5NA 2OPWA 2EXJA 3PTRB 4LTAA 5ACA1 1EY2A 1CX4A 1GOFA 3KMHA 2PELA 2VOXA 4PF1A 2DCJA 4HANA 4PI2A 1R091 1V9U1 4LHSA 1GYKA 3K4AA 4S2HA 1D0GA 4XAEA 3FL7A 3GDBA 4N53B 4N53A 1PO11 5T5JA 1LOEA 2X09A 1UMZA 2KXLA 2Q8EA 3T2TA 1VP6A 1SLLA 3VBHB 5A3NA 1QJZA 4Q0SA 5IJRA 1AR82 1BCXA 2XBO3 4M4RA 1KS5A 4BYYA 5FY8A 3FLRA 3MBWA 5IK5A 3U78A 5FZKA 1V6NA 5FLIA 1VBB2 1TMF2 5A3LA 3UL2A 5C8CC 1LGBA 1X8MA 3HT1A 1PIV3 4CYDA 1QJEA 2Z2SB 1LGNA 1LR5A 3NV1A 5IUQA 3ZXLA 3ZYBA 1KITA 3OGSA 4V1PA 5K0UC 4OZOA 5L9BA 1JXNA 1G7YA 3IDEA 4ZONA 1YFUA 1XPWA 5FO7B 4YW3A 1BHGA 5GLWA 1I5PA 2GC1A 4QGNA 2XXZA 5FZBA 5LB6A 3ZSLA 3H7YA 3WG2A 1QOOA 2A5ZA 3SCHA 1W6QA 2VW2A 5FTTC 4X8PA 2JB4A 1QWRA 2HWB2 2VZUA 5BNOC 5FZFA 2YY1A 2XMLA 1ZRIA 2OIIA 3FHQA 2JKXA 1AYN3 4JDMA 3NJXA 1QMJA 4IDZA 2PAKA 2WNVA 3VZMA 4M0NA 4XJ9A 2KR2A 3LAGA 5FXWA 4LO8A 2R063 5E16A 3DYPA 4QHBA 3MLJA 4PBPA 3N4MA 4FPEA 3J7LA 4LKDA 3WVJA 3HNMA 4IEPA 4IEVA 5I8TA 1H2MA 1VBC2 1MS1A 1L7RA 2PA7A 4AGRA 4AHWA 3NJZA 5KBFA 1W6NA 1QKQA 2ZHKA 3POFA 2EXIA 1Y9QA 3GHMA 3VDBA 2ETEA 2Y6JA 3IAPA 5HBAA 4WM7B 3VBRC 5IVCA 4LE4A 2PAEA 2V09A 1JHJA 2VY0A 1DG6A 4Q8KA 3T0DA 2DCZA 2BWAA 2WO3A 3POEA 1BMV1 4NWVA 4KBZA 5EHDA 2XG3A 1Q3EA 1Q8SA 2L9LA 3IMNA 2BJSA 4FOQA 4AVSA 3GYDA 1QOSA 1IZ3A 2JICA 1LODA 1O7FA 2H0BA 3MF9A 2HWC3 3J9SA 3OOXA 1ZBA2 4RHV3 3PVBB 4FI9A 4CXYA 3VBSB 4DRRA 5E6HA 1GZWB 2YROA 4IE0A 4JZRA 4W6WA 1H8TA 5HXMA 4LKEA 3H8RA 2W3JA 3ES4A 3I59A 1VAVA 3WCRA 4B4QA 5IVFA 4CCEA 1YFWA 4MHRA 1TZOA 2VUJA 1MR5A 2GN7A 5FZLA 3RYPA 2TBVA 2G9ZA 4WVMB 4Y1UA 1WA4A 4DXRA 4XJZA 2VMEA 2ZGOA 2ZX4A 3CJIA 3V65A 4A6SA 2XDVA 3BUCA 1VIWB 3IPVA 1Q43A 2YPJA 1LAJA 3M70A 2RJKA 4NIDA 1PVC2 5FYTA 2HH9A 1BK1A 4LA2A 1DZQA 1J3RA 1S55A 3ITQA 1URXA 2PHXA 4JGZB 5CYYA 1Z7S1 1OC1A 3K4DA 1AR93 4GH4A 2LUWA 4CDUC 4DXZA 4RS5B 2OKXA 4JGYA 3QBQA 5F39A 5F5QA 5IFPA 4UAPA 1AL22 1NLSA 2OVUA 5ISLA 3JBG3 1OURA 5IVYA 3ZFFC 4D6QA 2JDMA 2ZKLA 2VBDA 2W95A 3Q9OA 3KT4A 5EWSA 3ZSEA 3ON7A 1OPMA 2HKXA 1COV2 3U07A 3T1LA 3VBRB 1SPPA 1WMFA 1Y9GA 4UWDA 5F5AA 4R9BA 4ARYA 1WW6A 5FOJB 5IYYA 3BKZA 3B9CA 2JDUA 3AL5A 3VZKA 1XBFA 2K9ZA 1U5ZA 4HN1A 2Y6FA 5IWFA 3UJOA 1PX4A 3WNPA 4E2QA 2QUOA 4YGEA 3NNFA 1HRV2 4YVWA 2WNUC 2OA2A 1HN1A 2RJ2A 4K40A 4MGKE 1LOAA 3DPRC 5LZ6A 3ZO0B 2J22A 5TSWA 3M4FA 3FX3A 3WNNA 1W8TA 2VBBA 5BUVA 3Q8EA 3ZYHA 3KQRA 1W8FA 3CIHA 4BIFA 4LHLA 1V6IA 4AW7A 3AFGA 3N9NA 5JZGB 4ASMB 2JE7A 1DU3D 1RUE2 4IESA 3SEPA 2VJXA 5LBFA 5BNNA 2VMIA 4GKXA 4LNVA 4AEKA 5BYNA 1QQP3 5CG9A 1ALYA 2VVFA 4CEYA 4GKYA 2WO2A 1MEC2 1QJY3 1VMJA 1O59A 1VBB3 1ZM1A 3E5UA 5A80A 1JUIA 1HRV3 5A6ZA 3ZLIA 1EP0A 5IK4A 4ZZ5A 1MZEA 1CGPA 1VBD3 3M3QA 3GALA 2HWD2 1YEWA 2RM22 4TZDA 1XE8A 1XU2A 1XU1A 3MLKA 1POV1 3PMSA
chains in the Genus database with same CATH topology
3SMHA 1SCSA 1XRUA 4EN8B 3VN4A 3MYXA 4XBLA 3ZVXA 5LK7B 2WC2A 1U5IA 2VVEA 5C9AC 1DZRA 4N53C 4WM8B 3MPPG 2E63A 2CGOA 2Y38A 2GMEA 1BBT2 2D6LX 1VRH1 3I4IA 2XVGA 1MACA 4XJUA 1DQ5A 2CYFA 4GWMA 5JI7A 3R4SA 4IERA 3OPZA 4XHBA 1OD5A 5F9TA 4MGYE 5K0UA 4B8EA 1W6MA 1ZRDA 1YI9A 2P34A 1M06G 1KD7A 1V00A 3EQEA 1RUF2 5ABJA 3NKTA 3ZSKA 3KSCA 3NVCA 3VKMA 1LOGA 1RUNA 3N35A 2K2SA 5FREA 1DYKA 4PBOA 1PGW1 3DPRB 2XLFA 3G7DA 3V64A 5E1RA 1WCKA 5E88A 3OGGA 4MGZE 1VRH2 3NWKA 4UW5A 1L3JA 2DVGA 5KC6A 5DUUA 2Y0OA 1APNA 3R6SA 1ZRFA 2BGCA 1YJKA 2P3IA 1YWKA 5T5PA 3AJZA 4DNYA 5A32B 4Q4V2 3PVEA 1DQ6A 1GZCA 1N3QA 2RS13 4TSVA 1CAWA 2LTNA 4YFWA 4MXWA 2SLIA 3N7JA 4IEWA 1QY4A 2ZZQA 1LU1A 3ZFGC 4LBLA 4I01A 2A6WA 1KRIA 1NG0A 2A75A 1RITA 1LTEA 1YLLA 1LHOA 1CAWB 4GMP0 1RUC2 5EYYA 4JTNA 1VBE3 3AMNA 3ENRA 3QH7A 3KB5A 4L8QA 1NA1C 1BEV1 1H30A 3N7KA 4E9KA 3PJQA 3HWJA 1H2KA 4YVSB 1CAVB 2HWB1 4H55A 2BQPA 1VLNA 3H7JA 3GZAA 4M3CF 1WMEA 3FMGA 1ENQA 1Y43B 3WZ1A 3BU7A 2CAVA 2JJ6A 1VBA1 1UPSA 2B45X 2MPFA 3B5LB 4NWWA 3FE5A 4QPGA 1RUJ3 3WDXA 3VBOB 4AFMA 2K0GA 3BCWA 2XL7A 3P3NA 2DVBA 2AR6A 4R4XA 2OYZA 1DGRA 1YNAA 3RS6A 1UX6A 1XQNA 2TNFA 5T55A 4AHZA 3B02A 5DUVA 1LHNA 3MI8A 2DF7A 2TEPA 5T5OA 5D1IA 4P9YA 1QDOA 4EN9B 1LRHA 3JB8A 4IV1A 2O1QA 2E51A 2XHKA 1Q8PA 2ZPXA 2UY9A 4XOGA 1JHNA 2WQ4A 1WLTA 1I9RA 1JH5A 3LOBA 4RSUA 3TN93 5CA6A 2IZWA 2VXRA 1AR72 4K6BA 4BIOA 5JCTA 1OLRA 1OFSA 4O9EA 2R30A 5BV6A 1AR83 1IS5A 1WD3A 4RL7A 1R093 1V9U3 3M8LA 2QKDA 2QFEA 2R043 2DCKA 1W6QB 1V6MA 1PZ8A 1UU5A 3SH3A 4HN0A 5KXCA 5A33B 4MSVA 4I0AA 1GANA 1OA3A 1VALA 1K5MC 1QXPA 4ZU7A 1AR91 4FCAA 3VBOC 1S0DA 3NV4A 3JBG1 1PO13 2DURA 4P14A 2G4IA 2RS11 4XFCA 1T6GC 1AZDA 4DRVA 2UYAA 3AM2A 4W6YA 2ZX3A 1C5HA 2GZWA 3MIEA 1NQJA 4E27A 2PLV3 5BPXA 2D3SA 2RM21 1JW6A 1PIV1 4XIOA 5I0SA 5J09A 4FO9A 1NOVA 3E6BA 3C2UA 1NE4A 2UURA 1U5XA 1FV3A 1FPN2 3AX4A 1SCRA 3OBRA 1HX6A 4XF4A 4P9GA 3THTA 1O91A 1TME3 2ZGSA 3WCSA 3ZYIB 1G9AA 1FI2A 1MS0A 3AYAA 2EAAA 4HSLA 2VQ0A 3QCWA 4AEDA 4Y20A 1S0FA 5J98B 4GQ7A 4JC1A 3J8F3 1AYN1 5LEJA 4OUMA 1CONA 1VBB1 4BPZA 3MPBA 2IFWA 4XBQA 1H9PA 4Y20B 5GALA 3BOPA 2AENA 3VL8A 2ZMLA 2LM3A 2ZKNA 2OZJA 1GLHA 2HYKA 4B29A 4BHPA 1J59A 4IL7A 4K8FA 1QGLA 4YRDA 1U12A 4WVMA 1RVF1 1HLCA 4N9IA 1IKPA 5KXEA 2CV6A 4XXAA 3O14A 1PGL1 3WX5A 5L7OB 3ZFFB 3FLPA 4RGAA 5FQ0B 2ZTNA 5KHIA 3IKWA 4OHXA 2OUJA 1ZBE1 4E2SA 2ERFA 5JOYA 4YZ4A 2WSVA 2BNOA 2W39A 1RUG1 5H9RA 4DINB 2WNUB 1CR7A 4RHV1 1I6XA 2DUQA 1ULEA 4GB31 4LBQB 2BUKA 4MYEA 2DU1A 4OULA 3ATGA 5A33A 2BPA2 4LLOA 3AYCA 4QU2A 1RUI1 4LBMA 3CEWA 4P9IA 1CJPA 5FMOS 1W6NB 1VAKA 4AXOA 2O0OA 4COZA 2H6CA 1QF3A 1C8NA 3ZX7A 1AX0A 5EYXA 1ZBE2 1Z7S3 1QXJA 1RVF2 2ZGUA 4Q0VA 2LALA 4ZKTB 2RR12 5GZEA 1MEC3 2HEYF 5FOBB 1PHMA 5D8AC 1QQP1 4Q2FA 2UWBA 2WNUA 5H9SA 2IXHA 2HWF2 3CU7A 1V6JA 5IK8A 5GLTA 2IXIA 4WVZA 4YGBA 4AVCA 3ZYJB 1H8VA 1O3QA 2VH9A 1G9DA 1G8WA 2N7GA 2O8OA 4HSJA 4EWDA 5KHHA 3LB9A 1ZYBA 1UKRA 2VU9A 2VOWA 2Q1ZB 1BQPA 2RS52 3AKSA 4XF3A 4Y1XA 4BLJA 3ECQA 3O0VA 4KL1A 5DXDA 5CAZA 1C5IA 1SFYA 4FPGA 4Y1VA 3VBFA 4YM3A 3PNAA 1FMD3 3W58A 4QPIB 1ZZCA 1I5ZA 1S2BA 4XEZA 3PVNA 3VKFC 3FHIB 2XGXA 2XJPA 4PDWA 2R072 5C8CB 4LO6B 1V6KA 1O5UA 2GNTA 1AJKA 3M3OA 1WMDA 3DL3A 4CDXA 1FATA 3OYWA 4QMAA 4YZ2A 2DFBA 2E7QA 3B94A 4LO5B 3APBA 3VBHC 2DVDA 1LOFA 4GMP3 4BM8A 5A32A 4DOUA 4Q27A 1H4GA 2R32A 3L2YA 1PNGA 4Z2WA 2XLGA 4MXVA 3KGLA 1Q8VA 1LHWA 4LR4A 5FBZA 4CEWA 3VGIA 1C8M2 5JOWA 4FPOB 5EJ3A 4R9AA 2A3WA 2OPKA 1POV0 2CWMA 3D0SA 4AF9A 4RS5C 1UF2C 2MEV3 2D6NA 1F5FA 2B8MA 4JDNA 1PO23 1ZBA3 3L2HA 5GLVA 2D6OX 4Q8LA 2VNOA 5K9YA 1CPNA 1O4ZA 3WDTA 1QHDA 4LEJA 4COYA 1Q5OA 2HWC2 3MFCA 2C1FA 4Y22A 1ZZBA 3WT3A 4MZUA 1DGWA 1RIRA 4XJAA 5FFOC 4KWJA 3ZXDA 4EROA 4G3YC 1J1TA 4NHKA 5DZGA 3AMPA 1PGW2 2PAMA 4IV3A 3WD5A 2G9FA 1X36A 2A6ZA 3SH5A 1AHSA 3NAPA 2D5HA 4WM8C 1DQ2A 3A0NA 2IXCA 5JPNB 2IFRA 2WT2A 2DUPA 2WNVC 2CWSA 3JUUA 1HRV1 2HWE2 1AXKA 1DF0A 1LENA 3ACLA 2UU8A 4QQOA 4XW3A 1AL21 3S6PA 1EAH3 1NY72 1ZZ6A 1DDLA 4G9SB 3WW4A 5DG1A 1ENRA 3DV8A 4XDQA 1FPN3 1NXMA 3VHPA 4YZ3A 4AI1A 4CEYB 2IWGB 1W6PA 4AHXA 2JG8C 4PDWC 1HV0A 2Y0IA 3VBOA 1HRI2 1ND2C 2ZGMA 4PLOA 3AP6A 4JQRA 3WP6A 1B35A 4OFGA 3WDVA 4EN6B 5JZGA 3MZHA 5JZGC 1LOCA 2XJUA 4AI3A 3J26N 2GNDA 4N90A 4Y26A 4INDA 3AYEA 2NP0A 2ILMA 4X6RB 1C1LA 1FOD2 1RMU2 2Q1MA 3IN9A 4M3CB 1AYM2 4R9DA 2BTVC 2GSYA 2WLPA 1RHI3 1WGPA 2YGMA 4Z92B 5FLJA 3MIFA 3FUOA 1ND3B 3O5SA 4LBJA 1RUI3 3OD0A 5JIUA 2RJLA 4XJ8A 4M00A 3VHOA 1AR63 3EJKA 3P3PA 5CVRA 4EWEA 4KGGA 4B7EA 2P37A 4K3UA 5IK7A 4GALA 4RS5A 5HI0A 4RR3C 1PO12 1G9CA 1RUG3 1YCIA 3BALA 4PLNA 3O0WA 1F31A 1PVXA 4AFDA 3POWA 5AFBA 4JGZC 3EHKA 1DHKB 2AYHA 4FOWA 2MHFA 4QQLA 1HXS2 2XBO1 3IWZA 5JDBA 2BNMA 4Q4W2 4Z8BA 1BBT3 4N43A 4Y5Z0 3ROUA 4XILA 3TBDA 1UU6A 3NSTA 3ZPYA 5AVAA 4MH0E 2NPIA 3HIFA 1RUF1 3AP9A 1PMIA 3TNQA 1UCXA 1K5MA 1RGSA 4OI1A 3VBSA 4XE9A 1LHVA 3ES1A 2NLRA 3DPRA 5EXOA 2BVBA 5H9PA 3ZFGB 1IKQA 4BLIA 3INAA 4MV2A 5DUXA 3B00A 2ZGKA 5KC5A 3MICA 2CY6A 1AX1A 5FLHA 3UJQA 2JX9A 1UD1A 2WZR2 4OHYA 2X53S 5I93A 4AE2A 2R062 4AFAA 5JPMB 2YYOA 1MS3A 1REEA 2C9AA 2D6PA 3FBMA 4OLLA 1IPKA 4HT1T 4HZFA 3IBMA 3OBTA 1RB8G 3AP4A 3WQ1A 3EBRA 2D97A 1LOBA 2RS12 2FZ1A 1GV9A 1ZNPA 2NYYA 3CJIC 4I30A 1O3TA 1D4M3 4K9SA 3LGRA 2DTWA 4A7KA 4JGYC 4XQ4A 1QJX2 4CDQA 4FPFA 4R52A 4LT5A 1SLIA 3UKNA 3VBUB 1LCLA 1D4M1 1CAUB 3ZIWA 4PDWB 2WFF2 5HCFA 1IS3A 2ENRA 4QPIA 2JD4A 1MZ6A 4YYOA 1KDMA 5JOZA 3H0OA 5EFUA 4B3NA 4CP2A 3UKVA 5I0TA 4DPNA 3WV6A 3FLTA 4YNIA 4COWA 5KXDA 3ZXJA 4LLFA 4KU8A 3ZXFA 5BNOB 1CJDA 2C0ZA 3IT8A 2ZHLA 1AJOA 4UXAA 2VOVA 4D94A 4YVWB 2VGDA 4UBGA 2QJVA 1OOPA 1S0CA 3K51A 5JLVA 1H0BA 1A8MA 4HPKA 4YLZA 3AMQA 4AFCA 3B01A 3OD4A 1G9BA 4WBBA 2DUOA 3KGZA 4LBOA 5FPXA 1M4WA 1OFNA 5LRRA 2A3XA 5HCAA 3JD73 3AK0A 4COVA 2JDZA 2VMHA 4LUKA 1GNHA 5DDJ1 3POYA 4FT8A 3G6JB 5K8SA 1I3HA 3KT1A 1FX5A 1XNBA 4IEOA 3WDWA 1JBCA 4W6XA 4MGIE 1ASJ2 1NQDA 1B09A 1W0PA 3AZXA 4QQPA 3V0BA 3HR9A 1AL0G 3OGJA 2FMYA 1ULCA 3JD71 4IEYA 1MEC1 3IPVB 1PO22 2Q8OA 3VZLA 2VUAA 4NO4A 3WHUA 1FT9A 1WLWA 1H8TC 3A0KA 1DLLA 1SLTA 3WY6A 1TME1 2WA4A 3WW1A 4FTEA 1R1A3 5AC93 3LOIA 3RYKA 4AVAA 1DQ4A 3SNMA 4FAHA 4Y22B 4XFIA 1KJLA 2D44A 3MIGA 4XBNA 4COUA 1PGSA 4MVTA 4LBQA 1VBE1 2XJTA 2GC0A 2EXKA 4XFGA 2WFPA 2HWF1 3WW3A 3JQXA 3ALQA 1YFXA 3E97A 4JDOA 4GH4C 5JVVA 5CFDA 2D7FA 3URFA 1LKNA 5T5LA 2HWB3 4QPGC 2ZX1A 4NN0A 3E5XA 4JVAA 4QT6A 3M3IA 3ZFFA 3M1HA 1ZVFA 1FPN1 3HAGA 4AQ6A 3VUOA 5L36A 1RHI1 3TOJA 3DN7A 2JG9B 1OQDA 3RRDA 4FAGA 5B2GB 2DFCA 3WDYA 1EYBA 2VECA 4ORFA 4UW4A 4R4ZA 4QPIC 1OLQA 1V6OA 2WQZC 4IV1C 3VBSC 1VR3A 1RJ7A 2DV9A 4FSJA 4META 2XWJB 2QNKA 3RZZA 1R083 1GICA 4FPCA 3VDDA 1EV11 4I09A 2DU0A 4KBBA 4EN7B 3MGUA 3JCIA 2GDFA 1SLBA 4MUVA 1AYM1 4W65A 4H7LA 4HMZA 4UBHA 1RVF3 1NE6A 1SBEA 1PM7A 5IK5A 1KS4A 5JI9A 5L19A 4Q0PA 3U11A 3MIBA 3WUCA 4QM8A 4XFHA 5J36A 4LA3A 1QU0A 5T50A 3SH4A 2VNGA 4CEYC 3R4DB 1ZBA1 3ILNA 1FOD3 1VBC3 4XTPA 4KWKA 5CNAA 1ZX5A 3D5OA 5ACA2 3NL1A 3QH6A 4FOVA 1F2NA 2A73B 1VB2A 1GZ9A 1BMV2 3WG1A 2R041 4TLFA 2QVSB 4YARA 2ZZJA 4C1XA 1CQ9A 1IOAA 1AR62 4AVVA 2CGPA 1NCQB 2A6XA 3ZXEA 3DGTA 1N1TA 2CGNA 4GIQA 4J1XA 2DYCA 1HQNA 4ONUA 3T1MA 2HWE1 5GLZA 1NCQA 2D6MA 2PQQA 5JSRA 4Y4YA 1FNZA 4Q4X3 5FRAA 1HDKA 3J8F2 3FFZA 4P9XA 5FCCA 1J3QA 1U5YA 3KCYA 2ZGLA 1H1IA 1N47A 1YUDA 4BMBA 2RS53 4BMEA 4HK9A 1DQ0A 4Q4W3 4QPYA 4HLTA 4C0BA 1RUD3 5BY5A 2BVVA 2NM1A 1GFF2 4A3XA 1JYCA 5CIRA 4EV0A 2ZMNA 3AZVA 5J37A 3B3QE 3VZNA 2FHRA 3FJSA 4RQPC 5LRSA 2WZR1 4YW1A 2RMU1 4RQPA 5BNNC 3VDDB 1SFNA 3AZWA 2WT1A 1RUJ2 2VW0A 3N36A 3ZXAC 1SACA 2YHJA 1PK6C 4Q0QA 1Q8QA 2IXJA 3M3EA 1QQP2 1RUC3 3J8F1 4CDWA 5C9AB 4ES9A 2XB6C 2ZA9A 4GULA 1UW8A 3VBFC 2MNGA 2RS31 2ET7A 3MLLA 4G4FA 4WVWA 3M7AA 1NCRC 1NZCA 3VKOA 4AQ2A 3FUQA 1KJRA 1XNCA 2Q30A 4F83A 3A4UA 3VHNA 4P9JA 1LHUA 1D4M2 4I02A 2QZ2A 1A6CA 3RJ2X 3ZFGA 1UZZA 3AZYA 4E4ZA 2XJSA 2ARBA 1ASJ1 4QQHA 1Q8OA 4FOYA 4LULA 5L7OA 4JRAA 2QCSB 4I2OA 4KNCA 2R071 4YM2A 1CAVA 1R081 4BQ1A 2W68A 2D43A 1DFQA 1NA1B 2WINB 1X33A 3BODA 2P3JA 3JU9A 3L9JT 2XJVA 4GB33 1BVP1 2ZAHA 1RUF3 2ZGPA 5F6KA 1QH7A 3V0BB 3BPZA 5C4WB 2FMDA 2CAUA 3AKRA 2PN5A 1FXZA 1GNZA 1S0GA 3BOWA 5DUWA 4CDQC 2GN3A 3H3UA 1C3HA 1V6LA 2X8KA 1G86A 2R042 3NV3A 3V56A 4EN0A 2ZBJA 5D8AB 3RWNA 1WD4A 2XH6A 4AEJA 4PF5A 3MW3A 1VBD2 1C8M3 2GNBA 4YVSC 5J96B 1EAH2 1X50A 4D7SA 4HVQA 1ZRRA 1A78A 4FQZA 3ZFEC 4YVWC 2X5IC 2JE9A 1ENXA 3RPQA 1N1YA 2W08A 1FAYA 3UV9A 4CP0A 4BA6A 1DBNA 2ES3A 5HCBA 4XFFA 3TAYA 3D8CA 3NAPC 4DY3A 1B35B 4QD2A 3HN1A 2VOKA 3ZN5A 5C33A 2D3RA 3VHRA 1MVQA 4QXKA 3H8UA 4FTSA 1REFA 4N9HA 3LA3A 1AL23 2PLV2 3HMYA 5ABJB 4FQ4A 4OHVA 2XKPA 1VB4A 2VVDA 1ZZ7A 1PIV2 3IDBB 2FQPA 2C5DA 2F6BA 2AREA 2ZGNA 2HJIA 1UIJA 3SITA 2WNEA 4IXLA 2CTVA 3HBZA 1LEMA 3QOPA 4CDUB 2Z69A 4KQ7A 4YG0A 3RNSA 4CDQB 3MF6A 1ND2A 4JRLA 1YYNA 4NR1A 1FV2A 4IETA 1O4TA 1QXRA 2JG8B 3JZVA 4HBNA 2XJQA 3WDUA 5BXXA 1VRH3 2NQYA 4ITCA 3VL9A 5DZFA 3PLQA 1WBLA 1RUOA 1EV13 4Q4Y1 3TN91 2W52A 3ILRA 3I54A 2X29A 3AB0A 3ZN6A 4QX5A 5JIAA 2D3PA 4AYUA 1AXYA 3ASIA 2Q4SA 1CIWA 1MS9A 3RMXA 3AP5A 4QGLA 3QACA 1QNYA 4OVEA 2B39A 5BNNB 3WNXA 5KXBA 1AR73 1OMIA 2X5IB 3AKTA 5BNPC 4J6GA 3RDIA 1DGRN 1OSGA 3B9IA 4C1WA 4S2GA 4ZU5A 1GBGA 1S0IA 4XMAA 4OI2A 3HD8B 2RS51 3FZ3A 3WXPA 4CEWB 1OOPC 4JAAA 1LEDA 2ZGQA 4NHLA 4UW3A 4Q4V1 4YVSA 4ASLA 1SQ4A 2GMPA 1YXWA 4P9LA 3VKLA 4WVVA 5E89A 2I45A 3MFAA 3GZTB 1ZREA 5GZDA 3VV1A 1ZZ9A 1R1A1 5AC91 4Q26A 3WG4A 4DFSA 2R0FA 4NHMA 5FO9B 1ULGA 2YMZA 1H2NA 2NMNA 3WOGA 3ZXKA 4CDXB 2E9QA 2F4PA 2PHRA 1UL9A 2VMGA 4LUMA 4AWDA 4CRQA 4SLIA 3I8TA 1TMF3 1R092 1V9U2 2W0XA 3USUA 1CESA 4XZPA 3H9AA 2WZPP 4Q4X2 4IEQA 3J4UH 3ZMNA 1YFYA 2RM23 4PIXA 1G6NA 3CJIB 1S0BA 1NA1A 2I07B 2AH2A 3S7EA 4HKOA 5E8AA 3RYRA 2AZ5A 5JOXA 1AF9A 3OJBA 4L97A 1QJY1 4AFBA 4AVTA 3O0XA 4Y1ZA 1EPZA 1S1AA 3I59B 4F8AA 4HKWA 5BNPB 1N3OA 1EPWA 1RUE3 1GZWA 1RUJ1 1SDWA 4YW3A 3O12A 2XWBB 4BH9A 3WHTA 3NO8A 3H1YA 4IEUA 4XMIA 3LCPA 2BYVE 4K1YA 1VBA3 4XTMA 1W6PB 5KHJA 4XQWA 1AUYA 1BJQA 4M01A 4E4DX 3HT2A 3QLQA 3R4UA 4JTOA 2ZOEB 1HXS3 5SV8A 1DQ1A 2BFUS 2RHPA 1A3KA 2HWC1 1W6MB 3I2DA 3ZSJA 3BTAA 1PVC1 1WLDA 1ZBE3 1JTZX 3X29B 2BNNA 3MIHA 2JECA 3VZJA 4TWTA 3AMHA 4Q29A 4YGDA 1KQRA 1XYOA 2XPJA 3D4KA 4S2FA 5I91A 1DIWA 2A7AA 4I0BA 4M3CE 3WP3A 4B4PA 1VAMA 4WM8A 3SCFA 1AYM3 1ND2B 2Z79A 2WFF1 2YV8A 1FYUA 1RL3A 1TQ5A 2YXSA 4CDWC 1BXHA 5FMOL 4PIYA 1GKBA 2VG9A 1V70A 3JQWA 4N43C 5CU1A 5I0RA 3U0ZA 4DZGA 2R0HA 1IS6A 4BOWA 1NXD1 5H9QA 4ZU4A 1X82A 1OQEA 2ZAAA 2YGLA 1NY71 4FPYA 4Q4V3 4XHXA 4YGCA 2RMU2 3S7IA 4TYSA 1YO8A 3NW4A 3AP7A 5CB7A 4K20A 3VBHA 2UYBA 2HEVF 2R16A 3M2MA 1O3SA 2G9GA 1N1VA 2GH8A 1YJLA 4LBNA 1IGOA 2D98A 4WM7C 5DDJ2 4CZSA 1UAIA 1S2KA 2VNRA 4I0WB 1DZTA 3WLUA 4I3GA 4WV8A 2E6VA 2Q0AA 3AZZA 4B4RA 1CD3G 2YDEA 3D6EA 3RQ0A 4YZ5A 3H50A 1MS8A 4XXPA 4C90A 3ELNA 1NYWA 4JGYB 1ZRCA 1W0OA 1DYPA 2ZACA 2XJRA 3VLBB 2JENA 4AVBA 1GQHA 2VW1A 3ETQA 3OF1A 1W2UA 3ZDSA 3ZXGA 4FTBA 5J3UA 4F3JA 4YZ1A 1HIXA 1PNFA 2WS93 1HXS1 1ONAA 2PYTA 4DY5A 4NVPA 2ET1A 3VBFB 4YFZA 1PGL2 1S0EA 1RUC1 3MIDA 1C4RA 1AX2A 1WBFA 4LE3A 1NCRA 1D0HA 1QNWA 1TME2 4XF0A 1WCDJ 4KGQA 4MLOA 1FMD1 2JG9A 1CAXA 4QGMA 1HV1A 3LA2A 4ISQA 1H8TB 1J58A 2WS91 2WJSA 5DZEA 2EVXA 2ZMKA 4HFSA 4M0HA 3KS7A 1XYNA 5JSPA 4Q4Y3 1ASJ3 1WUVA 2GNMA 5LK5A 5J7MA 4K7JA 5JR7B 5AFEA 4OI0A 3JB4C 4FVVA 3ZFEB 4NPRA 4XIKA 3D82A 4GWNA 2QE3A 4RD7A 1WCSA 4KWLA 1A8DA 3AXEA 4Z07A 4CEWC 3OTFA 3RI8A 4OHWA 1EV12 3KD4A 3N7LA 2DCYA 1H1AA 3LKJA 1RUH2 4CDWB 5C9AA 1U0AA 3B93A 4RHV2 2E53A 2PLV1 4AQSA 1KFXL 4EWAA 1XXNA 1JN2P 3DUIA 1SLAA 4RQPB 4WZFA 3RJRA 2DCTA 1MZFA 2GH2A 1H4HA 1UKGA 3H1WA 2XUMA 5KHGA 4X8NA 1LECA 5FPZA 4B7KA 3OY8B 1C8M1 3TYJA 5A3MA 3ZIXA 3GHNA 3ME2A 1MQTC 4AGVA 4Q4X1 1ZA4A 1HRI1 4XPVA 2HWD3 3ZFEA 1ND3C 2B7YA 3PHMA 4ES8A 2AGSA 4E2GA 1OOPB 3ZN4A 4YM1A 2RR11 3WG3A 2OW4A 1TNRA 4XQDA 4AEDC 3LA7A 4YW5A 3MW2A 5F1RA 1QDCA 4K1ZA 2HEWF 3W59A 4KH9A 1PK6B 5BNOA 3ZSMA 1DGWX 2GALA 5BNPA 5I8SA 2H6BA 3AMMA 1PZ7A 1IPJA 1CAXB 4XFBA 3GBWA 3USSA 4IEXA 3ZYRA 1COV3 1WW5A 3KT7A 2RR13 1YRZA 2IXKA 3FFQA 3ZYPA 1NCRB 1IQAA 2Y26A 5CFCC 4QM9A 1CPMA 5FO8B 5GJ6A 1F5JA 4Q1PA 3V0AB 1O4YA 3D0JA 1PVC3 1GSLA 1RUI2 1ULFA 4AHYA 5KHKA 1ENSA 3SISA 2TUNA 1AR92 3ZMOA 1B35C 1WW7A 3VBUA 2WL1A 1BZWA 5JSOA 3WP5A 2EALA 4Z1VA 4FXKB 3N7MA 4N7UA 4P5HA 2ZHMA 1RUG2 3MW4A 2XLAA 2H0VA 5T54A 3U4XA 1HQLA 4LBQD 1JUHA 1N1SA 5I0UA 1HQWA 2SBAA 2WT0A 1VBA2 1Z78A 2PHDA 2UWAA 4HL0A 4K21A 1Y7BA 4AI0A 4F7ZA 3KCCA 2GAUA 4RFT0 4I3PA 3GNEA 3ZYGA 2RS32 1VJ2A 1Z7S2 5ABJC 1VBC1 4PJYA 3RI9A 2O8QA 2BBVA 1PO21 3ILFA 1O3RA 5GZCA 2ZGRA 1MVEA 4RGGA 4U2AA 4ISRA 1QJX1 2XVKA 1G9FA 3WR0A 2FBEA 3E6DA 4XJWA 1W6OA 1W39A 4LHNA 5AVPA 5L73A 5CFDB 3DKWA 2ZX0A 2GC2A 4J1WA 3U10A 4AI2A 1AR71 4DQAA 1JOJA 4YG3A 1QJU3 2R6QA 1F9KA 1J3PA 4D3WA 3CL1A 5K0UB 5IT6A 4IEZA 2EXHA 1KXGA 1MQTA 2B42B 4L2NA 4AG4A 1JYIA 3CF6E 2QDRA 2JEMA 5JAXA 4R8HA 2HWD1 3AKQA 4PIZA 5CFCB 4YW2A 5T3NA 1LESA 4N43B 3O7OA 4X6QB 2JG9C 2DWRA 2D40A 4N7IA 3S30A 3IIAA 1TE1B 4L11A 1RUD1 1Z0HA 4XETA 4BCUA 2VULA 1VBD1 3JBG2 3TNPB 3KLSA 2XKOA 2UWCA 4IV1B 4AK3A 3CNAA 2PHLA