1XYVA

Low temperature (100k) crystal structure of flavodoxin mutant s64c, monomer, semiquinone state
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
147
structure length
147
Chain Sequence
AKALIVYGSTTGNTEYTAETIARELADAGYEVDSRDAASVEAGGLFEGFDLVLLGCSTWGDDCIELQDDFIPLFDSLEETGAQGRKVACFGCGDSSYEYFCGAVDAIEEKLKNLGAEIVQDGLRIDGDPRAARDDIVGWAHDVRGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Redox properties and crystal structures of a Desulfovibrio vulgaris flavodoxin mutant in the monomeric and homodimeric forms.
pubmed doi rcsb
source organism Desulfovibrio vulgaris
molecule tags Electron transport
molecule keywords FLAVODOXIN
total genus 50
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2004-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1xyvA00
1XYVA 2OHHA 1BU5A 1AG9A 3G5MA 4R81A 1T0IA 1AKWA 2BZSA 2MT9A 3NHJA 1AMOA 4NULA 2ZKIA 5F51A 4CF6A 2N1MA 3LT5A 2Z98A 2WC1A 1XT6A 3NFRA 4U7FA 1DX9A 3OX3A 2ARKA 3F6SA 1WSBA 3NHWA 2FZ5A 5F12A 1H69A 3K20A 4YQEA 1TLLA 2A5LA 3OVMA 3NHKA 2XODA 4N82A 4PU0A 3L9WA 4QOHA 1D4AA 2Q9UA 1BVYF 3ESZA 4N9QA 1AKUA 3TE7A 2QWXA 1ZWKA 1J9GA 1NNI1 1RCFA 1YOBA 3TEMA 6NULA 5LJIA 1CZOA 2HPVA 5JROA 3D7NA 4D02A 1X77A 1QRDA 3JSXA 3NHUA 4LTMA 3ZHOA 3N3BC 5LLDA 3QFRA 2D5IA 3GFQA 3KLBA 3S2YA 2V9CA 3KAPA 1VMEA 1FX1A 4M0CA 3FVWA 3OJWA 5EMNA 3ESYA 1QHEA 2V5VA 3KAQA 4YALA 3W77A 4DY4A 3W78A 1AHNA 4C14A 3W7AA 5B3LA 4PTYA 1KBQA 4GI5A 2Z9DA 1AZLA 2OYSA 2MOKA 4U7HA 5F4BA 1CZUA 2RG1A 3B6IA 1YCFA 1QR2A 4QOIA 3FW1A 1F4PA 1KBOA 1TIKA 2FZVA 3NHFA 2X2PA 4Y7CA 3F6RA 4N65A 1AKVA 4FGJA 1FLAA 5FA6A 1C7EA 4ESEA 5EAIA 3TZBA 2QX9A 4FX2A 1YCGA 1ZWLA 1E5DA 5TGZA 1SQSA 1FLVA 3OX2A 5LMCA 3HLYA 3NHYA 4QOFA 5LBTA 3GFSA 1CZLA 1DXOA 3NHPA 5NLLA 3P0RA 3U7RA 3W79A 2Z9BA 1C7FA 3OWHA 3F90A 1CZRA 4ZVLA 1RLIA 3OWXA 4Y9RA 2QMZA 2R96A 4ICIA 1J8QA 1FTGA 1SG0A 3FNIA 2XOEA 3ES9A 3GAMA 3QE2A 5BUCA 1JA1A 1I1OA 3R6WA 3LCMA 1H66A 1T5BA 1FUEA 2HNBA 2BPOA 3HA2A 4ZVNA 1OBOA 2QMYA 4H6PA 4DILA 3F2VA 3HR4A 2OHJA 4LTDA 1CZNA 1JA0A 1J9EA 2AMJA 4ZVKA 3B6KA 1YCHA 2FX2A 3NHLA 5B3KA 2HNAA 4LTNA 3UXEA 1AKRA 1XYYA 3NLLA 4LAFA 1CZHA 3B6JA 4PTZA 5NULA 1DXQA 2MTBA 2KLBA 2V5UA 2R97A 3N3AC 1XI2A 3L9XA 4QODA 1FLDA 4H2DA 5ULLA 4C0XA 1WSWA 1OBVA 4C76A 4F8YA 1V4BA 2F1OA 3EDOA 3RPEA 2BMVA 3FX2A 4YAUA 4YAWA 1RLJA 1AKTA 2M6RA 3K1YA 4XDHA 2FOXA 5FUQA 2FVXA 1J9ZA 1D03A 2QX8A 4J8PA 4BMPB 2BN4A 4QOEA 4HS4A 1YRHA 3U7IA 5LVAA 2W5UA 1FLNA 3UXHA 3GFRA 4ZVMA 3OJXA 2FCRA 2X2OA 1D04A 2BF4A 1RTTA 3FJOA 4QOGA 2FDXA 4YAFA 4C0WA 1FVXA 3O2NA 4DIKA 1B1CA 4CETA 4FGKA 5A4KA 1CZKA 2Q62A 3KEGA 4XDGA 3ESXA 3N39C 3O73A 4HEQA 4NLLA 4Y9UA 4QOJA 3SVLA 3NHSA 4GQIA 4S24A 4YAOA 1GG5A 2OHIA 2FLVA 3B6MA 4GR9A 2MWMA 2QR2A 2GSWA 1AKQA 5LBUA 1YDGA 2QX6A 1QBGA 4FGLA 1OFVA 2B3DA 3NHRA 5EA2A 3OX1A 3QFCA 5FX2A 4OXXA 5LJLA 4LA4A 4BMOB 1YKGA 2FAXA 2KQUA 3EYWA 4U7GA 2QX4A 2M6SA 1ZX1A 2Z9CA
chains in the Genus database with same CATH superfamily
3QFSA 4XYEA 4DLXA 4BZWA 4RXUA 1J1UA 2NPOA 3RRJA 2FWIA 3C3YA 4K1LA 4WKPA 2P9YA 4J3NA 3WLTA 2AR7A 4E5PA 3T3NA 4PGFA 1GUFA 1JHZA 1QCDA 5ALPA 5AVJA 1Y8CA 3K4HA 3V2GA 4MLZA 3OHPA 4KITB 2JCYA 1QK3A 3AZOA 1IN4A 1RJ9B 2IUEA 1VIDA 1B0ZA 3LXMA 1S2OA 2CFRA 1TNDA 2ZM5A 1SMKA 2WUFA 1Z15A 3JVDA 4FX5A 2GXQA 3NYRA 1SCUB 4P3XA 3T0GA 3ASZA 1N3YA 4IAOA 5EZ5A 1RCFA 3LDHA 5A9TA 3ZEAA 5HJ5A 3GHHA 3HCEA 3K09A 1KNQA 1OX4A 2PSDA 3AM3A 3R3ZA 3TLGA 1KRHA 4GC5A 2VPYA 2TMYA 2OUKA 2OPHA 3HJAA 4DDTA 5ICCA 5BSWA 5K4AA 4FOOA 3WBJA 2F55A 4B80A 1R9JA 2ZUSA 3FSGD 3WGJA 1Z38A 4Q16A 4JS0A 1H2RS 4AS3A 2EP5A 3ZU6A 3M1AA 3K0SA 1K6EA 3BTOA 3KLMX 2B20A 5ITVA 2IV3A 1BDJA 3KBOA 3R5SA 3NTVA 3EXAA 4IIJF 3HCCA 5J23A 1M0WA 2WDZA 5IUJC 2EIHA 1YBAA 2QS9A 1D2MA 1II0A 2ZRBA 4BPRA 1EFLA 3PHGA 1MJFA 4PO9A 4QJ5A 4P5PA 3KJXA 2AJ8A 5T4EA 2R96A 2B1JA 3Q88A 3AVVA 1HRDA 1N7IA 1I9GA 3H1EA 4OYHA 5CFZA 3KB6A 4BUJA 3I01A 2FQXA 1YZYA 3HJBA 3PJRA 3EQ7A 2VP5A 2BP7A 2GYYA 2N75A 1I0IA 4DR5B 4KR9A 4EKYA 1KNXA 3WQSB 4B3FX 4JP3A 4JLKA 4YLEA 4H15A 4G9EA 1SBQA 5CM2Z 1LPSA 4JB3A 1W2GA 5B53A 1CIPA 1DXQA 3SAJA 1T2NA 1U9ZA 1G8HA 4GPEA 2R5NA 2WHEA 4M54A 4ENSA 3EX7C 1N36B 4ER3A 3DLIA 1TO1E 4IS2A 2XDWA 3H2IA 3W2TA 4RMJA 1U8FO 3L8FA 2VQEB 1N2OA 3C3PA 3NGXA 4I1RA 5I7RA 4YJGB 2PMEA 1G64A 2HSZA 5TPZD 4MVJE 3MSCA 3GEBA 5J5CA 3M81A 5C7YA 1R18A 2QYOA 4IJ6A 3KQUA 4NEHB 1T3SA 5CX4A 3B8HA 5FB3A 2HQRA 1WM1A 4JP1A 2YYAA 3EFBA 3TVTA 2ZJ2A 1MAVA 2R2GA 3C6XA 1G3RA 3RS7A 3UA3A 3K9BA 1NQTA 4N12A 2BP7B 4OLAA 4PYIA 3JXEA 1LSOA 1R6AA 2DQZA 3D8RA 3TLZA 4YHBA 5D3ZA 1GTL1 1T9DA 1E79D 1R8YA 4CIDA 2PRSA 4P84A 3M5DA 1R4MB 2WR8A 1R0BA 3KDSE 2OO7A 4GC9A 4OLJA 4PQGA 2QA5A 3O38A 5K0ZA 2J4CA 1W94A 5AKXA 1A2QA 3OWOA 5JAHA 3O9ZA 1EM8A 1ZIPA 1O4WA 1JNYA 2QD3A 4KKVA 3EMVA 1AQ6A 2ZOSA 3CW9A 4Q3AA 4IMIB 5DCLA 1GCUA 4JJEA 3F8SA 2DHCA 3BQNB 3DZBA 5IC5A 2L17A 4JL6A 1MABA 1GPUA 3JQ8B 4U7FA 1G3MA 3LX8A 3IHLA 1GGHA 3UZUA 3GLIE 1UZUA 2JGAA 1H6DA 3PNQA 4MV1A 4OX9Y 2C94A 4WL0A 1QVVA 1UXIA 2INGX 2OV1A 2D59A 2QHXA 3ASUA 3WYEA 2ECQA 5M34A 3WK7A 4BHTA 5UKDA 2P5SA 1D1PA 3QWFA 4GVXA 1I2CA 1Z88A 4PCUA 1JIJA 2NO9A 3GJYA 2EZ8A 3QHAA 1I6WA 4J3JA 5ALUA 3WB2A 1SPXA 1U1DA 3C8ZA 1US8B 4OO3A 1Y37A 3WXMA 1R4MA 1W75A 4RHUA 2YUIA 3T38A 1YDHA 2UYQA 3GLHB 4US1R 5E7QA 3TZLA 1MZVA 1KZ6A 1XQ1A 4DM4A 2E5FA 3VZBA 1WMFA 1Z4LA 3D4IA 3ZCQA 4O4JF 1C41A 2NVWA 3FCYA 4ENPA 5LUAA 3G0HA 2Y1DA 1DAOA 5JTTA 3H2YA 5CVVA 5FA6A 3T35A 1C7EA 5BWNA 4LBZA 1TK3A 2R85A 1IK6A 1OA1A 1E7MA 4FMBB 5EXSA 3L8ZA 5TEVA 4UTPA 4JSRA 2GB4A 2P3LA 4YY3B 2DULA 3AVYA 4DIDA 4JKOA 4TGLA 2FJPA 1G19A 2J31A 4LDZA 3IVRA 4JLNA 4WJLA 3SYNA 1KO7A 2DPLA 4FGSA 4WESA 4DLLA 1OH7A 1COZA 4WKOA 2GTIA 3SM3A 2DZDA 3W8FA 4GDMA 2H08A 1Q44A 3GP3A 1XZEA 3GAMA 3NIGB 4QPJC 4OQXA 3FPBA 3BBPA 1RE1A 2BTQB 5JT1A 3JQRA 3V7YA 4EB3A 2WDPA 3M34A 1DEAA 3I9V1 2V7EA 1QQ6A 2Q8NA 1YK0A 1PUXA 1Q15A 5G41A 4CIXA 4MHSA 3RSOA 3N53A 1X94A 4KP7A 1U6JA 2YQ5A 2QZPA 2QTRA 4N5LA 4TMTA 5KWIA 2GH1A 5H70A 2D4HA 1G8GA 2Y71A 3FR8A 4O4JB 1QHYA 3I2FA 1J8DA 3H86A 5IYZF 1F4LA 1D5WA 2XAUA 3N2GB 3Q7EA 3BHNA 4MGEA 1K7YA 2WU0A 4NBUA 1JIXA 4AUEA 4IXWA 2I78A 1NVAA 3CF4A 2UVQA 2CHEA 3RVBA 2QD2A 3NNDA 3Q3HA 2R44A 4ZYZA 3QLTA 4D41A 3TIGA 3P19A 2XRMA 3EHDA 4ZGWA 4EEXA 2F62A 3VR6H 1F51E 3LQ2A 5J9FA 3CGWA 5EQDA 1PX0A 1VJ5A 4X54A 4F38A 2FPGA 4KC0A 4IDNA 3TO5A 4AQDA 4Y6RA 2QM7A 4LE0A 2JFBA 2OXIA 4DCNA 1CJUC 1G18A 1Y6RA 2R86A 3ZUPA 1C1XB 1EFKA 1THGA 4V03A 1KDYA 2V0GA 2WW8A 2GFQA 4L15A 2NPFA 2CCKA 1SVIA 4BKPA 3LBFA 3SFVA 3RT1A 5I7VA 1L7XA 1U80A 1EBUA 2QZJA 3JQBA 1Z6XA 3IIMA 3KUUA 5FPHA 4XYMA 3RJTA 3M3HA 3ANXA 5D6NA 4QDXA 1UPTA 3DR3A 3CZ5A 1TQ8A 2DMRA 3RUAA 4XYLA 4JQSA 4O2LA 2O2XA 4MROA 1T6ZA 2AZDA 5B7GA 1COWA 4KUEA 4F4CA 2Q2QA 3RKRA 2B1QA 3COSA 5DBOA 3DNMA 5HM6A 4HV4A 2VXCA 2JZCA 3FHOA 4R1PA 4CMCA 2IXEA 3KYDA 1DFHA 2EFGA 1ADYA 1M34B 4QVKA 1SULA 3JQAB 3R20A 2DQSA 3UK7A 4CTJA 1KEEB 3LYHA 2OQRA 4JL8A 5BN3B 1ZA1A 4IYRA 4M60A 1HG1A 4IX1A 2OBYA 4EHJA 1AUOA 1G6HA 2OG2A 2C54A 1BVYF 2FRXA 3E1SA 4A82A 3JZAA 4XSHA 5GONF 4UDYX 1KSHA 1ZN2A 3HUUA 1C1XA 2WTMA 1LNSA 2Q1TA 4GYJA 4L73A 5ITWA 3L0CA 1JHRA 1H0RA 4GOXA 3E9CA 1ZJJA 1FX1A 3FMPB 4Q9NA 4Q4AA 4PSUA 3ZYCA 4AL4A 4BFLA 4DVGA 3W78A 3MVEA 1FJGB 1KJJA 4IHKA 2MIIA 2C9MA 3AUSA 3JALB 2NXJA 3KHSA 4TROA 3ROTA 1XTKA 3QKSB 1W9HA 5CDSA 3GT4A 1RZVA 1UKZA 5JWRA 1NLZA 2DVMA 1IB0A 4XB2A 1R0XA 1P45A 1PR9A 2M9MA 2EX1A 3IAAA 1VE6A 3RVDA 1SK9A 1W5BA 4HWKA 1NDUA 4CTMA 1ZSNA 3LLVA 3E8SA 2O0MA 2AG6A 2VR1A 1QJCA 4YO7A 5FLKA 1V26A 1XKLA 3F8TA 2NTVA 3B48A 4LHYA 5K3BA 1EFRD 1U7ZA 1KEEA 4KR2A 2Y0BA 3HCRA 3HWX1 4JIGA 5EZYB 4ICIA 4ZQBA 3OBIA 4GFDA 4KO8A 3TRFA 1B41A 3UOWA 3WKCA 4M9CA 4FC6A 2GN8A 3I2GA 3FROA 1GXSB 1FUEA 2HK8A 4O4HB 4OK5A 1Y9JA 5E7JA 4UMEA 5EIEA 1MUUA 4H6PA 3LS2A 4RA6B 1ZSYA 3D02A 3C8UA 5EVJA 4UFOA 1AK9A 1T5OA 3E5MA 5FTJA 4TN5A 4E2XA 1YJ5A 1W8DA 2QUKA 3RIMA 1ECJA 4JA2A 3AETB 3FBTA 2WHQA 3LW8A 1OBFO 2XGOA 3QPUA 4JNCA 5CP8A 1Z4PX 3SBXA 1SOMA 5C7OO 3M33A 2BYTA 3IQFA 2DC1A 3GYBA 4Q9KA 2QTCA 4NH4A 1JIVA 1RRKA 4DRZA 4KFSA 4R9RA 3CISA 1X42A 4QAQA 3SZUA 4F72A 2F4VB 1C30B 4LJKA 1R12A 4INPA 1JYFA 2HX1A 2JVKA 4BN4A 4EHKA 1OX6A 2Q99A 3T0FA 4MAFA 1Z4JA 5I9IA 4ZZ2A 1FMLA 4MS1A 1K92A 2BF4A 3FPEA 4MUBA 3CZ4A 5A2GA 4M0MA 4B84A 2ECPA 2H52A 1ZMTA 1WVMA 1BWSA 3Q4GA 4LXTA 5AJZA 5FIUA 4B47A 1X7WB 3Q9UA 3MD9A 1UZMA 1C3VA 1GFSA 1YWGO 4ND4A 3TLJA 3T5CA 2BGTA 3PUJA 1WP9A 1GGKA 3KFVA 3O7MA 2W0SA 3OEYA 2P41A 5KCZA 2AF4C 3TW0A 4BBPA 2HCBA 3HU1A 3R75A 1L5YA 3EOAI 5U9CA 3ORRA 3A9UA 4MULA 3UJHA 4DMMA 4U2CA 5A5DA 2FI1A 3DL2A 5BW5A 1E2QA 2H8GA 3BHIA 5C0OE 6YASA 1YIAA 2D1YA 2ZCVA 5CLHA 4NBRA 2GLUA 4YJFA 4MI3A 1DJOA 1HT2E 2IXFA 2PYZA 4NOMA 4ZXPA 1WV0A 5GJCA 1UP6A 4G0VA 2COEA 2XDAA 4H31A 4BFUA 3TLYA 1KHHA 1Q1QA 3MOIA 2Z3VA 1K97A 2H3HA 4CEJA 2C1EA 3LMKA 3PICA 1P4SA 4FCTA 3KZMA 4JL5A 4ZEOA 3FWYA 5HM8A 2X13A 4E3ZA 1M6EX 3ESZA 1HFEL 2X4DA 4EMSA 4EYGA 3PVZA 4FHCA 3ZE1B 4TMVA 1N2EA 2YN2A 1SXQA 2KW5A 4UDNA 3VUEA 4EWLA 4RDXA 4KHPB 3WIBA 1CQIB 5ES3A 3WLKX 1Y7PA 1VHTA 3JASB 1ISRA 4MS4A 4C4TA 2BHRA 2I55A 2MSWA 4CFSA 3AR8A 1DPFA 3KSBC 5J2UB 1S9HA 2AFVA 2IIQA 2OCDA 1UK9A 2PX3A 2AQHA 2VK2A 3IAS6 3ITKA 3MTGA 2F3UA 2V98A 1Q7TA 2R8RA 3R0JA 1SC3A 1FTWA 3SC3A 5B4VA 5HUJA 4OQQA 2OFOA 1OQAA 1BXKA 5DYWA 4B40A 3TEFA 2PUEA 1Z0AA 4MP3A 3W0LB 2ZW9A 2H8KA 3MCTA 3Q72A 1E3IA 1SH7A 4KR0A 1O9BA 4R2MA 1Y0BA 4LZOA 4TKUB 3ZU5A 1HTTA 4PC6A 1GKLA 1G8JA 2WM2A 4LSWA 1LJUA 6ABPA 2GM3A 3TSOA 2XUIA 3DDUA 1B42A 3EEIA 4XCVA 3TNYA 1NVXQ 3MK31 2JLUA 2QTZA 2ZYVX 2OBXA 3GNLA 1F2TB 3IBFA 3OQIB 5JXJA 5JBQA 2VNKA 4WZAB 3MMXA 3KS9A 1OVGA 4QPDA 4NKRA 4ARUA 3ZNPA 2JIZD 5JD6A 5MF6A 3AYZB 2V74B 1T13A 2A5GA 1CZNA 3DBIA 4LZAA 4ZVKA 2AC2A 1Y1KE 2HHCA 3A3KA 3DOJA 3HJUA 1KE2A 3RTEA 1IEWA 1T8RA 5JEEA 1PP4A 3OIFA 1L7DA 1M1NA 1Q16A 3B1FA 2B4QA 3CKYA 4QBTA 5F7ZA 1UWVA 3SICE 5ICSA 3ANMA 1RAFA 3HR8A 3BN3A 2UUAB 2H6EA 5AXAA 1WW2A 4A8TA 1JPVA 1YQTA 3BE4A 4XWAA 3SZLA 5FUQA 3VM6A 2XEXA 3HV2A 5A4DA 4J8PA 1ZMRA 4YJHB 4ZVQA 4CL8A 1DAFA 3I8OA 4IH4A 4AXXA 4U4AA 1SXPA 3DMHA 1DNPA 2CKMA 4MDYA 4YONB 4D79A 4ZP1A 5A5GA 2AN4A 3JPYA 4M1WA 1TU0A 2QTVB 4IIGA 5CFPA 2TYSB 4A0QA 4J3FA 3UW3A 2JEYA 2MSEB 1IBRA 2DT5A 1CUZA 3UAYA 2G0AA 5LQKA 3DL7A 3T1HB 1TT5B 2ZVDA 2GZDA 3O4GA 4QQKA 1V9CA 4NV1A 4WOJA 3W7VA 2R7AA 3JQBC 2WF5A 2FQ1A 1QF9A 1QE3A 4XPZA 2CUNA 1M1NB 1YDFA 4MRNA 1SVSA 5KDOA 1XTSA 3GD7A 3VR6A 3PEEA 2JD2A 3VVLA 1IUPA 1W88A 2ZJ8A 1T1RA 5JSYA 3UK0A 3LXXA 4CJXA 4C7MA 5JJLA 1AG9A 2FW9A 1RTKA 3L0ZA 4CM6A 2QSUA 2YJTD 3ZQ4A 5E3HA 4UJ3A 4FZJA 2ZBGA 1LFAA 4XH9B 5IZCA 4HRVA 4LWQA 1EUDA 2I6GA 2YW9A 4MQEB 4W5NA 2WC1A 4YRJA 2GPNA 3QUAA 1FL9A 1LV8A 3NIDB 3BH0A 4BQQA 3RU7A 2GM4A 4UPVA 3V7WA 1N33B 2VZEA 1U02A 4W1RA 3CURA 3CG0A 1FCJA 2D62A 4OXYA 1KRWA 3WBFA 3UA4A 3QUSA 2QTVA 4I81A 4Q7LA 2SCUA 3JYPA 4N9QA 1U7PA 3RYHA 4CKCA 1ZWKA 2OHXA 4XVCA 2G76A 4LSZA 3KKZA 4XUGB 3TSCA 1CZOA 3VPFA 3EVNA 3KZ1E 4YEDA 3SEFA 1W47A 2ENWA 4LY9A 3GCGA 3W7BA 3TLMA 3QFRA 5LLDA 1A8IA 3PK0A 2VNSA 3O5AA 3EPJA 4MR7A 3FVQA 5K05A 2O06A 3H5LA 1NOIA 4RYDA 4GI5A 2PR7A 4GZMA 3GNTA 2FWMX 5BN4B 3RSSA 5BWBA 4TWIA 4Y8VA 1IIRA 3PQ5A 4UUBA 2G1AA 3DXFA 3V6LA 4C0LA 1YCDA 5BQ3A 4M0EA 3OZGA 4YLGA 4I55F 2F8TA 1A9YA 2CXQA 2V6FA 2VH1A 1G5PA 3HCAA 4LKOA 4MKZA 4OMCA 4Q21A 3FLAA 4U2FA 3WK9A 5B2FA 2PCJA 4MVJD 1WZUA 1JN0A 3ANSA 2HRQA 4XJTA 1ZMBA 3QYPA 1PSDA 1SCNE 3C8MA 3E23A 3HRKA 4DG8A 5CXUA 1VCMA 4OD0A 5TNXA 5LQCA 4R8KA 2UUBB 4OLBA 4EUEA 5EYPA 1A9RA 4JYCA 1AGYA 2RI6A 4NBNA 4KQ6A 3Q8MA 3BHJA 4RE5A 1NTRA 2P67A 1X13A 2ADFA 4F2WA 1ZKDA 3N2ZB 3QE4A 4EW1A 3YASA 1W36B 1RHMA 2XBUA 3PLNA 1Y1TA 3GRPA 4WOKA 1FQOA 3AV3A 3L7YA 2B4RO 1UK6A 4MR7B 1PN3A 1QG6A 4MYRA 1MC1A 2EBUA 4G5FA 2UXDB 2IHYA 3NUQA 3GOQA 1A8QA 1MG5A 3HXLA 4DZZA 5BN4A 1G8YA 4DV4B 5AJTA 4EGCB 3VKFA 2R8XA 1K6MA 4GYYA 1A2BA 4ZVSA 5B6JA 4DSOA 4UCQA 3ZLJA 3U3KA 2QX8A 3AINA 3AG6A 1JVSA 1R64A 5I9MA 2LCQA 1W85B 3LUGA 2WEKA 2DY1A 1DBWA 2O2JA 2VKQA 3B8EA 4I14A 3JRNA 3O90A 4HGOA 3IJ5A 1ICEA 2EC5A 4ARCA 4E5NA 1FTYA 1ZHOA 1BROA 4GO1A 4RZQA 2AXPA 2HIMA 3UN1A 1IC6A 1EUQA 2C96A 4CV3A 1DARA 4BDTA 2O3JA 4BO4A 1BN7A 2WJIA 3UV3A 1OXBB 1WE2A 4EUKA 1S8OA 3IUMA 4AZSA 4Q82A 2QR2A 4MDHA 4F5YA 1PLJA 2HF2A 1X1EA 1EWVA 5BORA 2OM2A 3ZWOA 3M70A 4J1TA 4ZCMA 1M6NA 4NBVA 4OL0A 5DYTA 2IYFA 4RWZA 4N5IX 5DEIA 5JJKA 3TMKA 1U0FA 5TT0A 3RGGA 3OCCA 5HZKA 3GXOA 3BGVA 4MKRA 3W4IA 5JD5A 1O57A 3JR7A 1EVKA 1XYVA 3ZE0B 5BT8A 3F9RA 3SQXA 4ARAA 5B3JA 1GTMA 2OV8A 4ZTBA 1IUOA 4IX9A 5ADWA 2DBVO 1U4NA 1ZU5A 3N2EA 4MRSA 1CRWG 2X0RA 2PZLA 3DYBA 1OIWA 3L4KA 2NP6A 1FQKA 1Q3KA 3JCZA 3SC2B 1KP9A 1YZLA 1M2EA 1SFRA 3P2OA 3OLCX 2A92A 4Z3KA 3AY3A 5E1MA 2ZRHA 3OLYA 2ZXEA 3BFVA 4ZT7A 3ACCA 3LO5A 3C87A 1I7PA 1AV7A 2Q3FA 3IQGX 3UO8B 5JAUA 1F60A 1Z2EA 1E58A 2DUMA 3CZMA 5DWDA 5DGTA 4HWGA 4IUDS 3H9QA 1M54A 2Q6LA 1USUA 2QDXA 1E1MA 1P9RA 3LPAA 1JJIA 1YBVA 1GNSA 1M2VB 1FRQA 3RSQA 1JBQA 3OKFA 1NM5A 2J67A 1I3NA 1TZMA 1PWEA 4XYGA 1NE7A 1KU6A 3D2AA 4XWOA 1L2TA 3C3XA 2FRDC 1QQBA 4H0NA 3BE5A 3PKIA 3IEXA 2O7QA 1J25A 4HTAA 4QATA 8ADHA 2ZJ0A 1E3LA 4J03A 3MJRA 1XVIA 5EWLB 2Y67A 2XIJA 4KSBA 4BB0A 3J7TA 2Q3JA 1ECCA 1FLVA 4R3UC 1O08A 2XTZA 1DXOA 1I30A 1TA9A 2CBXA 4HLQB 1I7QB 4UDXX 4B2PA 1RKQA 1LA2A 1GDHA 2WJGA 3MEQA 3RC8A 1G2QA 3FYSA 4HAIA 3ZVRA 1ABFA 1NUSA 4KSCA 2ZJ1A 3P45A 4KQHA 4WUTA 5J63A 4YT4A 2AOVA 2P2DA 1AOXA 2EF1A 2JF0A 3HEAA 4XW2A 2NVUA 3PQFA 3QVMA 4EF5A 1JSLA 3D0OA 3AJ8A 1ZVMA 2WVAA 2REXB 5IAAA 2FPLA 2BRUA 3O95A 1LD3A 4HYTA 4MYTA 3CKKA 2N46A 1TM4E 5D1HA 1UKAA 2EYQA 3C8HA 2IHBA 2X9QA 3ELDA 3JD1A 3EW7A 4Z9FA 4WXRA 5C3UA 1DOHA 3HZHA 2QEQA 4MA4A 3U9SA 5CR9A 2O1EA 4PYRA 1F3LA 3DTNA 3M82A 4QJ3A 5LKAA 5LMZA 3M1IA 4P9NA 4KO4S 2JGMA 2ZIEA 3GGPA 1MGOA 3GWZA 3A9TA 4KN6A 4MR9B 1E2FA 4TUYF 3MWDA 1EQUA 2CY0A 5ITZB 4YCLA 1NYTA 3U48A 3PFBA 3T6KA 2BGNA 5CCBA 3A7DA 1XZGA 4Q6WA 1XZDA 3M9XA 1I1NA 1PNTA 2HPAA 3NNSA 4BQPA 4ARIA 1GUYA 3EGXB 3F7TA 1G8MA 2VJQA 2HBRA 2X19A 2O50A 2Q0SA 4JJZA 4Y2XA 5EXDA 2PNJA 1R5OA 5BQXA 4IJ5A 1BVHA 5A0VA 2QJWA 1P3DA 1SXJE 1PJCA 1WRBA 2JAQA 4WY2A 2RJNA 4QWMA 2VAMA 2ZYWX 3FKQA 4G0YA 1RBMA 4JZKA 3WGLA 2VYFA 3FTFA 3V4SA 4DVJA 1RQLA 2XAAA 3SP1A 1SXGA 2PXXA 1X1TA 1P5RA 2R68A 1GR0A 2WF6A 2WSYB 3DV0B 3N05A 4LSGA 5TF0A 3ZHBA 3ZXUB 3TMAA 1UM9B 3GG2A 3QNUA 2K4MA 2F4NA 3PRJA 4P82A 2ZRPA 3UWMA 2JLYA 1CY0A 1U65A 4NC9A 5BSEA 1THMA 2CLIB 3EZNA 4LEIA 4HFMA 5JSFA 1GGNA 1JQLB 1ZISA 2VS1A 3KQNA 1MABB 4H7HA 4HDAA 4RXTA 1VJ1A 1U2EA 2W6JA 4NJMB 2PO5A 1BCSA 4JY7A 5JLAA 4EG0A 2VSYA 4MQLA 5CB8A 3U3ZA 1TEZA 2X22A 3B5JA 4BLQA 4GX2A 4QLBA 3FCCA 3TSZA 1ID1A 3VNVA 1R5JA 2IITA 1TEVA 1LDNA 1MPTA 2ISSD 3EGCA 3EGXA 5HR5A 2B98A 4C7JA 1CR2A 1QH1A 4E0BA 4UBLA 1BCRB 1CRQA 4B4KA 5KOHA 4PPFA 3FTCA 1RAHA 2ODWA 1LKZA 2A5YB 3C48A 4YRBA 1NUAA 3I9KA 2VYNA 3IDZA 5DN9A 4Z5XA 1DE0A 4ETMA 3PXXA 2PMFA 3BTUA 2PU5A 4E1VA 3HVUA 3O4RA 1OROA 3I2YX 2X42A 3BH7A 4H1HA 1BJKA 2V4ZA 4MV0A 3GLHA 2IBTA 1TUBB 4OQMA 3HJNA 2I1LA 3NDRA 1JI3A 1UM9A 2Q5IA 2X1LA 5DBIA 1N6LA 3TBFA 4O1IA 3DD1A 1SG6A 1NVVR 3PCTA 5TQ0A 2VG8A 3IMCA 4DB2A 1S2LA 2GZRA 3I1YA 1AV6A 5BSUA 2W22A 3ZBPA 1R88A 1RKUA 3FYUA 1SVLA 2NG1A 2Q4DA 4KFTA 2G04A 3FW1A 1QIFA 4C0SA 1AT1A 2DWUA 2AX3A 1MJGM 5ALGA 4WK2B 4BNLA 1QH8B 2XNCA 2QI9C 3SDBA 3UKJA 1QBKC 2XD4A 2ZBRA 4RC9A 1D8TA 3OZDA 4PC2A 5KHAA 2YASA 4WESB 3I5XA 3Q41A 2JIZA 5DCUA 3VHXB 4X60A 1U3WA 3G88A 3LOPA 2A0UA 1MB0A 5AHWA 3WMWA 4WASA 4U39A 1KFCB 4PG5A 1JEYA 1PT7A 3C5CA 1RSZA 2PH3A 4OBWA 4LV8B 4YP5A 2CDAA 1W52X 3K0FB 1ZRMA 3OA0A 3W5HA 2RHHA 4J4BA 1YZQA 2P30A 3ITDA 3PE4A 4L16A 5G0SA 2YXDA 1JFLA 1BKYA 4ZZ3A 4D7AA 3AHGA 4G8DA 1X0XA 1TC1A 2E4AA 2H2GA 4DPKA 4RTMA 1Q1ZA 5J4VA 1QP4A 2OL4A 4ID3A 4KDEA 1YQUA 5EIAA 1A77A 1EGAA 3OQBA 5E6UB 4F8YA 3OE7D 4UQOA 3LUBA 5LXTA 1O96B 2GK7A 2EP8A 2GTHA 3EMKA 1LVGA 1DKPA 2X58A 4K6HA 3GO4A 3NWJA 5JI2E 1JA9A 3QWBA 1KK1A 4UHEA 3WQRA 3ZJ4A 3EHEA 5ELLA 4QIHA 3S29A 2JFZA 1Z3IX 2WUDA 3O8LA 4LYEA 5G4KB 2XHZA 4OEHA 3EZ7A 3LPDA 4V2UA 2P3QA 4MB2A 5C80A 2GEDA 2QTGA 4R5HA 4DLZA 4DIKA 2BWJA 2X5KO 4IEIA 3QWIA 1SBNE 1MT0A 1N8TA 3PL5A 3C8DA 1JEYB 1PV4A 2E2WA 1YGPA 3KXLA 3PBKA 3ESRA 1D09A 1I1QB 5AKYA 4B7AA 4M87A 1EVZA 5L9AA 3K0FA 4L3VA 1VJ0A 1AUVA 1Z6GA 3NWEA 3WSTA 1DRVA 1W5FA 3B1XA 1J07A 1YOVB 4GGPA 4B3IA 3H2SA 4CKWA 1TCCA 5FPKA 3ELBA 4KXNA 2C4KA 3SC4A 3RTCA 5CK4A 2I2DA 3NHRA 4AZVA 2ONZA 3CH7A 3H2ZA 3IBSA 3K5PA 3OH8A 5E7MA 4U5XA 3SD7A 2IHKA 5KYUA 4BGUA 4NRDA 3WGIA 2XCIA 5CFMA 3G2OA 3NC0C 3PWTA 1A7KA 3FMVA 3IMKA 4G56A 4GBGA 5AW2A 2OHHA 2P77A 3GJQA 4R6XA 2I3DA 3FZEA 4P80A 4YJ3F 1YJXA 5LB2A 1WVGA 2V03A 2ZROA 4J07A 4DV5B 4HNGA 4F71A 4LHEA 4D99A 1I7SB 4CHGA 4YRZA 2D1FA 3Q2OA 4O1MA 4DXAA 3WISA 2BE7A 4HDOB 4QGGA 3VOTA 4G1CA 3QGMA 5CFRA 1MA3A 3INNA 1I9CA 1TZCA 4W1SA 5LIRA 1L4KA 2PL3A 2JFQA 3BA1A 3FUXA 2AGVA 2J0VA 4NHEA 1KH2A 4LY0A 4M1YA 2D2XA 2CF5A 2IYEA 3I6BA 3OTQA 4JEIA 2VZ0A 4B75A 2ZUEA 2Q4BA 2O2SA 1Y6GA 2WAAA 4RHFA 1KO5A 3HN2A 1HXHA 1YOVA 5CDUA 5HX7A 4XQ9A 4A0FA 1ZIOA 2XJ4A 4FSDA 2B78A 2NGRA 4KG7A 3QKSA 4YGXB 4XUDA 1KJIA 5AT1A 4B4UA 4TKVA 3IQIX 1XALA 1BYIA 4E2YA 3K9WA 5HCUA 1YVUA 3OETA 2I9PA 1GUBA 2CFCA 3QVWA 2VNHA 3BB4A 1S7CA 3A58B 1O87A 4MKIA 1Q21A 2HMTA 4QYXA 2FRDA 1UBNA 2PRZA 3DXXA 2O2HA 3RFFA 7AT1A 1YUNA 3RG2A 1XWFA 3ITEA 1V48A 2XUOA 4DSTA 1G5IA 5EJIA 3VGJA 4ZQGA 2PS9A 1NXOA 2C5LA 7REQA 3IVXA 2VHUA 4NDZA 5AD1A 1PR1A 2WJZB 1D2RA 1AE1A 4L76A 4XGKA 4NMMA 1WBDA 4WJKB 5FP0A 1GXSA 1QYXA 2GUWA 2WJPA 1EHYA 2EFEB 3E9EA 2IVZA 3LH5A 4KLNA 4ZO6A 3LY5A 3FYTA 4QXQA 2OO5C 3EZ9A 1YVDA 1E5VA 2J87A 3TR0A 3ZK7A 1J39A 5ERGB 5AMXA 1L7BA 1P5ZB 1MX3A 3PFFA 4RZHA 4URUR 4DIMA 3GH3A 4DQXA 4DJFC 1SD2A 4YMSA 2B1RA 4BKMA 4JGBA 4P31A 3VX3A 3KLOA 1Z5VA 3U4MA 3H04A 4C43A 3C74A 3LI2A 3G1UA 4TKVB 1T15A 1H4TA 4I7EA 4KFUA 2OV3A 4R84A 4MW4A 3UMCA 3ZE7A 1NI4B 4CQNA 2ANBA 2KLBA 5DP1A 3INGA 1UC4B 4Y1FA 5K0SA 4IFEA 3KFLA 3B89A 1C30A 1U31A 1UWCA 3MTAA 3N8NA 4MINA 4RVNA 1C9YA 3DNFA 1NBWB 1FFBA 1P80A 1N9KA 2VPWA 2VNJA 3R09A 4U00A 4ZVVA 3W8DA 4BAGA 3RIYA 5B58T 4GPD1 2HWUA 2ZRQA 3PE3A 1RC0A 4TLCA 1ZHHA 4UHKA 1SKYB 4B9EA 2AN3A 4HGYA 4N6GA 4YWHA 4JB2A 1NBHA 2QZZA 3CKLA 3AI7A 1WLSA 5ALKA 2I2AA 2X2OA 2QGFA 1IVNA 2GJKA 3KE9A 2ZWMA 3GLTA 2ZBVA 4RK6A 1ARZA 1RHRA 1XQ9A 4F45A 5IN4A 4RVHA 2X9LA 3QLJA 1FZTA 3OPQA 2BTOA 4QPNA 5DCWA 3SF8A 4XRGA 3W05A 1N5OX 2C0CA 3UMBA 1G9SA 1Q7BA 1TZBA 2JCVA 5B5SA 5IG2A 5ILGA 3SX2A 2OY0A 1PYDA 5DK6A 1H1LA 4ZJYA 1V6CA 1Q5PA 1MQ8B 4AJEA 1M5UA 1I94B 4XA8A 2W70A 3CW8X 4EUFA 3BJEA 3KUXA 4WW0A 1Z34A 4EVIA 1EK2A 5DNUA 1EX6A 4I4CA 4UHDA 4AG6A 1XRQA 2XGMA 2G25A 2P4EA 5B1SA 4NULA 1B26A 5THKA 3F7MA 3GLKA 4L4SA 4DYVA 4EKNB 3AIKA 4UHCA 3SFZA 1IHUA 3BCHA 2WVJA 3PR1A 1EE2A 3CNOA 5EUCA 3H17A 3WOVA 1MXFA 3NVDA 2RHOA 3NBFA 3LXRA 4OGKA 4RAQA 5CIQA 3DFFA 2OCGA 3ABQB 5ALWA 3PP8A 1DRJA 2QVGA 1J5EB 4B3GA 5HKOA 1CQIA 2QRVB 3S4YA 3LLSA 3JASA 3SF8B 4OI2A 1GN9A 2JBWA 1PG0A 2FR8A 1TAGA 3N3BC 2XT9A 5FWXA 1U8EA 2WOOA 1EK6A 4XJSA 3L8DA 1NWHA 4MS3A 4RK5A 1XDBA 4MJLA 2PZAA 2O3RA 3ROQA 4ZFNA 3FSJX 4EDHA 4CBVA 1SHUX 2GBCA 3W3ZB 1WXGA 3T7SA 4S0XA 4MVWA 4Z4HA 4ARZA 3HXOA 3ELWA 5T4HA 3CH6A 1U5BB 3UMJA 4OGWA 3HDJA 5BV8A 5JW6A 2NU8B 4ATNA 5FV7A 1H5QA 2IWHA 1NM5C 3WRVA 2EYUA 5JH7A 1L7PA 1XAIA 3KU1A 3NHYA 4KAXA 4ARSA 1A9ZA 1YI8A 2BEUB 2IYOA 3HBAA 4PO3X 3QW4B 3FCSB 1LDBA 2FF5A 4MEBA 3B82A 1T5SA 4D46A 3DWFA 3D2CA 4NCXA 2J5QA 3L0DA 3L0SA 3MAGA 5IN5A 1ODJA 4O2AA 1A69A 4KX3A 2GZ3A 2ZYAA 3DAGA 5J4LA 3KETA 3V8MA 4E6EA 2P11A 1W5AA 4IHJF 4TV8F 4U9UA 3EARA 3AF3A 3RT9A 1I1OA 1PJ4A 1FP4B 4Q03A 2R7MA 5FWXB 1PZXA 4QPPA 3BG5A 5BP7A 3OZAA 1VKHA 4W7HA 4R31A 2HRCA 4W8GA 1NXTA 5IEJA 4V1CA 1S3IA 1JKFA 1XYGA 2H31A 1ZVKA 1YI1A 2PX0A 4FEGA 1DVRA 4KVFA 3RJ5A 1J8VA 2XXAB 2J6IA 2Y1KA 1CUFA 4Y2HA 5J1TB 3E5HA 3W5VA 4BKUA 1U5BA 5CB4F 1CHDA 1V9SA 3FX2A 3U62A 1HT1E 4JIMA 4K2AA 1F8GA 3IHTA 1TJ3A 2PUWA 3R5XA 1TM3E 4R8MA 1ST3A 1INLA 4GMKA 3BKXA 3X1ZA 4D3YA 1MQ9A 5EI5A 4BATA 4D3XA 2C58A 4DMHA 2DLDA 2PAAA 4J0CA 4L72A 4DUZB 1Y3AA 2B35A 1SU4A 1XD9A 2HJWA 3THWB 2F1JA 3NHBA 4LJYA 3FPLA 4NV3A 4TT8A 1HMYA 1L8OA 2XB4A 3QVLA 5LXTF 3B9QA 4Q48A 4RD4A 1FP4A 2A35A 4RBNA 1B3BA 2OHIA 3FDJA 4P35A 4MWGA 3UWPA 1N5RA 3K92A 5HCIA 3UXYA 4BE9A 4F8EA 2HT1A 3DPUA 1R6XA 3H11A 2O2EA 3D7KA 2LKDA 2QZSA 2DFLA 2CMKA 4QUIA 2QRGA 4QHSA 4PPYA 4WLFA 4NE9A 4MGHA 1VPWA 1ZBDA 4N48A 1FS4A 2AMFA 1NXSA 4B5LA 4L6IA 5BNTA 4DA6A 1HZZA 1EUDB 4ZXFA 4GPTA 1WDMA 4AQ7A 1H9AA 4Y2SA 5DNDA 2GJAA 3Q0TA 2CVZA 4C7XA 5ALFA 1LZLA 4WNYA 1FUUA 2JIMA 2JRLA 3CCFA 1EWQA 1SA0B 1R6BX 3BCUA 1MO2A 2X0JA 3R7BA 3RS5A 2WHXA 1T8UA 2ZXFA 3DG9A 2XA2A 4BUCA 3FTDA 4YCCA 7ABPA 1Q22A 2WM3A 3DFIA 1LGYA 2V7XA 2IPXA 1O6FA 3CE6A 2PKQO 2VAWA 3PNBA 4X8OA 2WAOA 4B34A 5JXWA 1B93A 2R7NA 4JMLA 1ND5A 2PU7A 2AW3A 2Y1GA 2Q9UA 4AZ3A 3NEJA 5BNIA 3PGVA 3C1OA 3QXXA 4AF8A 1LPNA 5EP3A 4C89A 4LY3A 3COJA 2Y76A 3KO8A 3EF3A 1O94A 3KKNA 3TJMA 4AX4A 3EXHA 4R1TA 1YQ9A 1XPUA 2APJA 1AXGA 3GLUA 1PVOA 1N6NA 2B37A 2V7QD 3KELA 1YZVA 4FCWA 2A57A 2XYRA 4Z86A 5FULA 4Q4HA 1K7XB 2D2FA 3OJFA 1FU7A 3PGLA 1NURA 1P7WA 2HJHA 3CX6A 4IXDA 4WT7A 3WMEA 4D96A 4DIOA 4DM7A 1Z22A 1E2PA 2OENG 3FKSA 2Q28A 3GJ0A 1EGVB 1FMJA 1DWQA 1AO3A 1L8XA 2E4WA 3AC0A 4WK6A 3QVUA 3U56A 4NENA 4ZVOA 3GHYA 2ODNA 2X76A 1M67A 1NN5A 3K73O 1G1AA 1V8FA 1CZLA 3MRTA 3PGXA 4HN9A 4NAVA 5A3RA 1YS1X 1T9CA 4KRXA 5EWMB 5GWXA 2YZNA 2IOFA 3L5OA 2NUBA 5JMOA 1MW8X 2JLAA 3UF0A 5JRDS 5HQ3A 3PA8A 2IY7A 2OFFA 4NCAA 3DFMA 2I6TA 1K5GA 3ITNA 2WYUA 4NPAA 3FSRA 3DQZA 3G2NA 3JQGB 1E9FA 1CUXA 1W35A 1HLPA 3IS3A 2B8TA 3GBVA 3UFXB 2CC2A 2YMMA 3EXHB 4DWOA 4LNAA 4TQGA 1QS0B 2H7YA 2VF4X 2XUQA 2R25B 3AY6A 2UYOA 2IYRA 3AY7A 3VBCA 1G59A 4A0RA 2P9TA 2G6TA 1C0EA 3HHEA 1WPQA 1VJRA 3SJ7A 3ZWDA 2AOUA 1FRFS 4LTNA 5LDDC 1XTPA 3F4KA 3MXTA 2YV4A 4CDGA 1E3EA 3AP3A 2JIBA 2GJ8A 2WT4A 1ZDMA 2XWJI 2PRJA 3EVFA 4FDMA 3FAKA 4Y2JA 1ISGA 2RBKA 1MDBA 3JATB 3T5DA 3V4ZA 4D0NA 3ER8A 1NC1A 1SCUA 5K0CA 1G7RA 1P9LA 2IZ5A 1KQOA 4N18A 4YP9A 5IM5A 1Y9AA 4HB0A 1TW3A 1JSRA 3BS4A 4D56A 3VA7A 1SBTA 1J24A 3I5AA 1QHXA 8OHMA 5JADA 3NKLA 3GZJA 4U6QA 2GA9A 2QUJA 4OFBA 4PYJA 2DWOA 4YP6A 4CMEA 1ZJ5A 1ZM2A 2PUGA 4YAEA 2YL2A 1PEKE 4KQCA 1KO1A 1PQ4A 3QIAA 3WKEA 4I9NA 1F20A 1YL7A 4PZPA 1WV1A 1FVOA 4GI1A 4P38A 3UFXA 2I76A 4IIBA 2BFMA 3AEKB 2V4MA 5L4NA 3RUPA 2IE0A 3MSXA 2VTBA 3OX1A 1SD1A 2CE7A 3IA7A 1W0KA 1NI3A 3TNDA 2XKKA 1SCKA 1VMDA 2OCIA 3C98A 3HABA 1JE0A 2VQSA 2RHWA 5EJ7A 4UBKA 1AF7A 1NDHA 2XITA 4D4GA 1JH9A 4EP1A 5KKAA 2VRBA 3SK0A 4URVR 5KTYA 2PE5A 1G98A 2IH5A 1NYLA 4DKJA 4A1OA 1ADCA 1EWYA 2R11A 4MHOA 4Q3EA 4UW9A 3SC2A 3TTWA 4DWJA 4YT2A 5JBNA 2GETA 2HREA 4TX1A 2RGDA 3GFFA 3GJ6A 1DGQA 2BFCB 5HZGA 3PTZA 2BMWA 1ITZA 2J3JA 2PT7A 3K20A 4G9GA 1A71A 4IOMA 4BRSA 5JZVA 3NVKI 3Q87B 5KMGA 1EUYA 2YIMA 1SB9A 1UBHS 1QIKA 1BS2A 4EL0A 5HJ7A 4HVCA 2BMFA 3RJZA 3FOCA 5EIBC 1ZZGA 1DT5A 2JA2A 4TWZA 5JNWA 1FSZA 2HPVA 5A5EA 1QP8A 5TY0A 2FN8A 2G7ZA 3L6DA 1N25A 2P6MA 1XPOA 3AEKA 3B3JA 3Q3EA 3G17A 2X86A 1F2UA 1E7SA 3VPCA 2J3LA 4I50B 1M6VB 1NU6A 2FYTA 3G3EA 4YJGA 1LK5A 2H48A 2H2IA 3UUWA 2C2MA 3B6IA 4EW6A 4JOBA 1HLFA 3KD3A 1W49A 3NFYA 4LYAA 5GIPE 1R3UA 4MGIR 2ZAMA 4YWJA 3ZD8A 1KVRA 3IT1A 3M0EA 2R48A 1OWOA 4EIWA 2AR0A 1A3CA 1OT3A 1UOEA 1UEJA 3Q12A 1NONA 4FCVA 3G9TA 4KZKA 3TW6A 3O94A 4QUDA 4RJ2A 5LKRA 1ACMA 1RC1A 4M1ZA 1K8QA 2E7ZA 1XJWA 1PEYA 2QB5A 1AY0A 3UK6A 1H2BA 4WZAE 5JAZA 1RVV1 1BXGB 4XQ0A 1Q6ZA 1PD0A 4E7OA 4D80A 3D81A 3IE0A 3R0QA 5AJXA 5T6MA 2ZT8A 1CQJA 3ROZA 3VMMA 4DGQA 4HQKA 4RZSA 2ZI9A 3GCXA 1H66A 2BBWA 1OBOA 3EMDA 2ZBEA 4G86A 4L75A 1ULUA 3VDMA 2R6CA 2GEJA 2Q29A 3CXRA 2YXBA 4NEQA 3GMTA 4XQGA 5HE9A 2WWVD 1F6WA 4NBWA 3NHLA 1GTSA 3MWDB 3VBEA 2OO5A 1FDTA 3HDGA 4LE2A 1K9SA 4NU5A 4LXXA 4H4EA 5LCXA 3UICA 5FUVA 2QT1A 3L9XA 1SHZA 2XT6A 1IAQA 3CWCA 4R2WA 5EERA 3U4AA 3TRKA 4L51A 3AK4A 4NU8X 5HIJA 5JIBA 3IC5A 3DE5X 4OU4A 4XDHA 1QXSA 1ZNWA 2C8VA 3BSYA 4WBXC 3TOZA 2H4XA 4LYHA 1DOAA 5ERYA 5GJWC 3B7WA 2F8LA 3U1TA 1I80A 1XROA 3R1IA 2IEDA 3F6BX 1F3OA 1ZL0A 5KREA 4YDRA 3K35A 3WLQA 1KEKA 3E9QA 1CY7A 4Y2PA 4R1QA 1U4SA 4B3HA 1CQJB 2C8JA 4D4LA 5KYYB 1EUCA 3D1VA 1VG9B 4YAJA 3WXBA 1K8YB 3KAKA 1FSFA 5I5GA 1W2WB 1EA5A 4D8UA 4PTLA 3KC2A 2PANA 3H6KA 4E22A 4BNVA 2C9YA 5B57C 3G89A 2FFBA 3WK6A 3KB2A 3KIPA 4ZIRA 1IJEA 1ZRNA 3I58A 3A3OA 2YJ5A 1J8YF 1IEQA 2DSTA 3F71A 5U4QA 3UH0A 3SSOA 3KXPA 3GRAA 4GWLA 4LFCB 3SNKA 4FU0A 1UWKA 1J42A 4ZI2A 2RHLA 5FL7D 5BXQC 1XCLA 3DEJA 3H0CA 1M0EA 2R8YA 2WAMA 1CJSA 2EQAA 2ZSDA 1JR3E 2VP6A 1NIJA 2PQMA 4MI1A 3D6JA 2DKFA 1M5TA 1ZL2A 4JI8B 2XMCA 1P1JA 2LD4A 1I5RA 3OSUA 3Q40A 1WOMA 4IF6A 3TZQA 3LV8A 1J2YA 2HLDD 4ZHQA 4QGHA 1GNPA 2LIVA 2NZ8A 1DDGA 2ENUA 1XMPA 4OHZA 3IAM1 3RODA 2VT7A 3ZWPA 4D4JA 5J43A 4WPGA 3ID6C 1W4RA 3PDIB 3E9YA 1YK1A 3F1LA 1UFVA 2DGDA 1LLDA 2IUTA 2WIGA 3N2GA 2HPZA 4IIXA 4QSHA 2GILA 3AOEC 1E2KA 1EE1A 1T29A 2C00A 2X5NA 2ZUBA 3DC7A 4JSTA 3GROA 3FYUB 4UHFA 4ZI5A 3I37X 1CYEA 1EA7A 2RGNA 3QY0A 2A58A 4BLWA 5KQMA 3MCVA 1BE1A 1L4BA 1T24A 3AUJB 4IUYA 4TWAA 5CH8A 4GSYA 4NJEB 1YCFA 3HI4A 3VR1A 1JIUA 2R8ZA 2Z95A 1FFXA 4P7KA 4YP7A 2JHGA 5G02A 2J4FA 3BGDA 5FXMA 4RSMA 3T7AA 3UT5B 5ILOA 2ZYGA 5JTUA 4RULA 2VTBB 5BWCA 2WMYA 1MEEA 4E09A 3RARA 1K6JA 2VI5A 4P4LA 4DNOA 1ZEMA 2B94A 3BL6A 3LY8A 4B8WA 4I3FA 2PJUA 1W0JA 4OATA 1MORA 5KKCA 3CLRD 1WPRA 4HMQA 1YU9A 2VC2B 5KSWB 2RB4A 2PX4A 4TLAA 1W36C 2ZCJA 1SVNA 5CYFA 1KL7A 3N2KA 3VSDA 1QLWA 1U7XA 2X3YA 4G2NA 3DXZA 2MYPA 4UBNA 3BXGA 1T9HA 1RQXA 4OKSA 3OQ1A 4L07A 4R69A 5HS6A 3UPDA 4IG9A 1EB9A 4OOEA 2WUEA 3C0KA 3GOHA 2ATIA 3M6VA 3CVWA 3ACDA 5JASA 2B8JA 5IFLA 2FDRA 1PJRA 4JP2A 3DE3X 3JX9A 4DUYB 1W76A 1YR8A 2MJLA 3KYDB 4NJEA 5BR8B 2OAP1 1M34A 1HOXA 2VPIA 3BZWA 1BO6A 1CUYA 1V6SA 3LC0A 3QLUA 5DTRA 1FFXB 4B8YA 1QF6A 2FSGA 1V9LA 2IHTA 3G2PA 3WKBA 4QD3A 3HVRA 3VR4H 1Z4IA 3OUTA 2K5UA 1WXDA 3ABIA 4ZI7A 1E4EA 3RUDA 4OQNA 4AULA 3KE8A 5BRAA 1ODKA 3HO6A 1UQUA 3ZVLA 3WWPA 2QL6A 2R5FA 4KWTA 1EP2B 5C4IA 4WCVA 2IK8A 3GEHA 1W93A 3OQVA 3T1OA 1EP1B 4PIVA 1NQXA 5KX5B 3GLIB 2GCIA 3STYA 4LS3A 1QVWA 2OGWA 2HHLA 1JBKA 3F3YA 3KX2A 3LUHA 4HGPA 4UE3S 5E6SA 4BJ1A 5IK2D 4EHAA 3HP1A 5SZKB 4C4YA 4KN5A 5IAJA 1G1MA 3F0TA 3ZG6A 3CZCA 4RCZA 2J6BA 2NO0A 3LCCA 3THXB 5KYUB 4TMKA 5JSHA 1R8SA 3PEUA 3E3NA 1NFRA 3EDYA 4FD3A 4LMRA 4ZWNA 1AMUA 2FW7A 4Q5IA 4BMOB 1QPGA 5HTKA 2E85A 1JDBC 4DE5A 4EG3A 4FE4A 3WGYA 5B1YA 2Z5FA 2ALJA 1TU3A 2JBAB 2OQ2A 3C6QA 1BIFA 3OQJA 2HBQA 3CWZA 1QE0A 3MGAA 3OEHA 3ZHSA 5K9ZA 3EIXA 4G36A 1XVVA 5EZYA 4RK0A 1EFHA 2LTAA 3LAWA 4YJKA 1E4EB 1L8AA 1O94D 5IHPA 2FW1A 1E6LA 3C14C 1PG2A 2DF8A 1O94C 1T2AA 3GBSA 4HX5A 2O2IA 2PQ6A 1I2ZA 4QLAA 4GUDA 4ZT2A 1H9CA 3CSSA 4OXKA 2A5LA 3RFCA 4S04A 2RH9B 4Q93A 1T10A 4Q37A 4WDQA 3ZD9A 3W90A 3GGJA 3GLRA 2MSLA 3A4TA 3ADKA 3ST7A 4B3MB 2GJ4A 2ZEJA 4Q9JA 1YULA 4B76A 4CQLA 3D8SA 3FCAA 4WFJA 4EPYA 5I7SA 1H6BA 2G5PA 3FKSD 4D42A 1KQFA 2Y1LA 3ZD6A 3E8XA 3GJTA 5HJ2A 3AFMA 3O83A 1DKLA 4EHHA 3EZYA 4WUVA 1ECPA 2QN3A 2ZG6A 5EE1A 1C3OB 1TJ4A 3RLFA 3ECSA 2LUOA 5IAKA 4JI1B 1VIVA 4GI7A 5KWEA 1SVUA 1XAJA 2QAJA 1VE1A 4DSAA 1QR2A 1Z9BA 4NI5A 1V11A 3O0TA 3RHFA 4YCBA 1H2WA 1JSZA 3B78A 7REQB 1X9GA 3USZA 3SM9A 5HVNA 1YVEI 5MFZA 2O54A 4LVCA 2QPTA 3TGWA 2D5AA 1YE3A 2IEIA 3V1LA 1JAHA 3ZDRA 4URXR 4N9WA 1N2BA 4R3WA 2P4SA 2C2BA 2H4HA 1PTJC 3ZZUA 3BGIA 5H4HA 1D6SA 1M76A 3OCWA 4L74A 5J47A 5JH7F 5JPDA 3CNHA 4M37A 5HZMA 4FB4A 4A0SA 1RWXA 2G9RA 4Q6BA 3TLXA 3HZOA 4BBJA 4OU5A 1G4AE 3A9RA 2V0NA 4P4NA 4U2DA 4LXYA 5AVXA 4JVSB 2J0SA 3WJAA 5KEIA 2AMVA 2FVYA 2P5UA 1H2XA 2C9BA 4P7BA 3QKRA 5HFJA 2ZTUA 1NI4A 2O14A 1UANA 2RAPA 2VH5R 2YS6A 2Z30A 4X00A 5FTMA 4AECA 2A0WA 3IPLA 1G7SA 4OJKA 1C3OA 7MHTA 2XA1A 3AF2A 3MNFA 4AY2A 2B83A 2YYSA 1ZH0A 1HORA 4IIUA 2I3ZA 1E2DA 2ZDGA 5NULA 4DV7B 4ZPJA 2R1UA 3S2GA 5BNZA 5EN4A 3NGLA 1RC8A 1OZGA 1Q3HA 4XI9A 4A0GA 1AKTA 3P97A 5EWJB 1M1UA 3A31A 2PSSA 1TVCA 2J9FA 1VGQA 3WFZA 1S4QA 3WI7A 3O3NB 4MUXA 3PNMA 4XVRA 3AZPA 3GDHA 1AS3A 4UQPA 4R98A 2XY4A 4KXXA 2CDBA 1CKEA 3FGZA 4RIHA 4TMXA 4NG5A 4MS4B 5JYCA 3FMFA 3DKIA 3EAGA 2H1OA 3ND5A 5A4KA 2HU5A 3OZIA 5JG7A 1F9EA 2GAIA 1EFVA 5EZSA 4XIIA 5BYBA 3SPXA 1B6SA 5J2UA 5DHTA 2EQBA 4QYWA 3QLVA 1L5QA 4XIFA 3IKJA 1JHUA 4RAOA 1J0XO 3OMLA 4Y7DA 1JR6A 3ZY2A 1CULC 1GY8A 1IDN1 1JMKC 2PXHA 4R7GA 5CFQA 2XVXA 3RYIB 4FZRA 4L5CA 1OFVA 2YH2A 4PAGA 3G85A 5T41A 1P2SA 4JUFA 3OM1A 1Y4DE 1A4RA 5C35A 2XHEA 4G97A 4H0FA 2FWJA 5DBHX 1Y8AA 3EGWA 4BO2A 3LCUA 2YYZA 3IUQA 4XVQA 2HJSA 4M1OA 2ZBPA 3I3SR 1KR2A 1GP2A 3JW8A 3NUZA 2O23A 1T9AA 3PPXA 3Q6NA 1DTEA 4KSYA 1XRRA 1F2TA 3OQIA 2WB4A 4Y30A 3E5RA 4K6KA 3DQQA 4GX5A 5DX1A 3CX7A 3GUHA 4L9SA 2PS1A 3B70A 3GPLA 2EL9A 3RAJA 5KTTA 2QRVA 4X8HA 2X4LA 2WE8A 1LQUA 2Q7DA 1FFYA 3GCDA 4Q9DA 4JT2A 2BGLA 3OLZA 5D00A 5H16A 3OIGA 2GF0A 1Q6YA 3P96A 1KKUA 4U8HA 3FE2A 4NK4A 3VR5D 1IONA 3DF9A 3MJCA 2QVBA 2XMBA 2VNAA 3DDNA 2ZSAA 1CW2B 4RJKA 2IP1A 4E2ZA 4K40A 1NLMA 221PA 2IHUA 4UCWA 2IUUA 3OMXA 3QPAA 4A5SA 3BREA 4N4AA 4JLDA 3IOBA 1VLZA 4KPEC 2PMCA 4D8YA 1T2CA 5DT2A 5D3QA 1E6EA 4ARZB 3EXG2 4QC2A 5JLJA 1H2EA 2QT9A 3LQKA 4ND8B 4UE2A 3X1XA 4G1BA 1KBQA 1GKKA 2VP4A 3F74A 4YJHA 5LYJB 3EWIA 3H1GA 2NU8A 1AHPA 4C2TA 5AJHA 3A2NA 3O7WA 1NZDA 4X1YB 2ZTHA 2IDMA 2F9FA 1V41E 1SQGA 1KEWA 4YUVA 2BEUA 3RI3A 2Q1SA 2OV6A 3BJMA 3QUCA 2F9MA 2XE7A 4NABA 4OSPA 4P3YA 1SXJA 3H84A 3RS8A 3TIIA 4BKRA 2QTMA 4DLRA 3EIFA 1KSJA 4INJA 1XJQA 5AUPB 4YMWA 1UJMA 3H9GA 3HB4X 1QE5A 3WHLA 1L5SA 2A8YA 4RKRA 4A6XA 1ZIDA 1P1RA 1MX1A 4C1BA 4QU8A 5FUWA 5EMJA 4Q7EA 5AVRA 3ORSA 1ENPA 3ILVA 1NQUA 2Q7OE 2P35A 4QJBA 4RHTA 1T9GS 2YQZA 3A9VA 1I10A 4ZVNA 1DJMA 4ZDWA 4MVJA 2DP4E 5K0LA 2ZK7A 5AQEA 2O3SA 1WXHA 5F3RA 3U49A 1CX9B 3Q15C 1CF4A 1IN5A 3PI6A 1I01A 1TMKA 2RONA 5T3YA 4BKOA 1FFAA 2IX3A 4NBTA 3WGNA 1CZHA 3EY9A 1FBTA 4KVAA 3TLBA 3VYUB 1DQNA 2CXXA 4MB0A 5F5NA 2O8DB 5GZ3A 2PDAA 4UM5A 2AG5A 2BFNA 3E9DA 3BIWA 2VK4A 3CZRA 1CUEA 2YXLA 3ISJA 4WLOA 3VH4A 4K26A 1NF2A 1TYZA 1UMBB 1GFWA 3R2JA 1ZR4A 2JHAA 1I1HA 1JZTA 1E2IA 5EIWA 1ZMXA 1QVZA 3GFOA 2P7IA 3QXGA 1D9XA 3ILYA 1RLOA 1J56A 3LHDA 3RS9A 1JG6A 3VYVA 5H8WA 4B0OA 3COZA 2WFMA 3DOHA 3C41J 4EJ6A 4TSFA 1EVEA 2Q46A 1XDWA 2V7WA 4FYYA 2W83A 1NG1A 1P2UA 1SC1A 2CLOB 4BNGA 4U7JA 3DM5A 4D4HA 1YC5A 4M1EA 4RNCA 1KDZA 3O9VA 3BL5A 2IIPA 1IXRC 4BGEA 1EESA 4YRGA 2CVOA 3ZY4A 1VIYA 4RDHA 5EA2A 4DNXA 1QK5A 2DG2A 1D2CA 2RFLA 2CL0X 1V7ZA 2QF7A 3GGCA 1OR8A 2R8PA 4PZ0A 4H7KA 4U7GA 3NXSA 1P0QA 3L0OA 4EB6B 4J9UE 3AYXB 1GZVA 1BU5A 1GL3A 1MOSA 2O2CA 4X3OA 5E9AA 3WMFA 3EJ6A 1A97A 4M0PA 1SGWA 2OD7A 3D8UA 1CFJA 1XB2A 4FOPA 3UUEA 3LBAA 2AH5A 4FFWA 5COBA 1QFMA 3W6ZA 2ZTVA 5KHLB 2VJNA 2ZJZA 1NQWA 4LE1A 5C4MA 1JSCA 1E3MA 1UQTA 1VZ2A 3IVMA 5EFZA 5T3UA 4ABTA 1UMCA 1UFKA 2PT9A 2XVMA 2Z2JA 3T3DA 3ETJA 3LCRA 4M21A 2ORED 5CA0F 2Y4NA 1NJSA 3E1GA 3VNQA 2ECOA 1ZGHA 3FNGA 3IV9A 4AP9A 5EJ9A 1C4OA 1TQDA 3QVSA 1NJ5A 1LS6A 1E9VA 4MUGA 2O8CB 5BR1A 3W3AA 1X38A 4PN7A 1SCDA 2GA8A 2D0OB 2RDMA 4D8XA 2XF8A 3MTIA 2WZBA 4GBED 4YNBA 4CE6A 3TF5A 5DDIP 4WOCA 4BL5A 4UATA 5DX0A 4EYKA 1XQXA 4MVJI 4UVIA 4EB6A 4IFBA 2JLQA 2PZKA 4CL3A 3ETCA 5CA1B 1YZTA 4K6MA 1LXCA 1TTQB 2FNAA 1Z2NX 3DPSA 1P4JA 3F7OA 3LTEA 3OZEA 1VRCA 3Q98A 1U81A 1Z8HA 4RTRA 3EYAA 4JEUA 2FSVA 4JBLA 1Q7GA 4BWYA 2C2GA 5TMPA 1LPBB 1UDXA 2E5WA 1XUOA 2L19A 5LBIA 1UZLA 4L8YA 1AN0A 1E2NA 1YB7A 3WGGA 1TYBE 1YL5A 2ASVA 2IDKA 3PC6A 1JALA 2OCPA 1TAHA 2OLEA 2UVPA 3GPDG 4GSLA 2R8OA 4OMFG 3T7KA 3VSAA 5MN6A 4K6FA 3I9V6 2FWBA 4H27A 3RJ9A 3WDSA 5LSAA 3E61A 4JHXA 3C3CA 4EUHA 4EBBA 1RQ7A 2D4AA 2YRFA 1F5NA 4I8IA 1C0PA 2QTNA 2QVCA 4RQBA 3TCXB 3F97A 2Y1FA 2JVJA 5LLTA 4A91A 2UZAA 4JYPA 1XA0A 4EJSA 1TM5E 2IEGA 1PU2A 4KQ9A 3H42B 5FL7A 2RGRA 5FR1A 1SELA 3PXCX 4XDYA 1JIQA 2B8EA 2R3SA 1U6KA 1XI2A 4M38A 3RS0A 1FLDA 2FSHA 2RAFA 5AM3A 1TAUA 3I09A 1EFAA 4FYJA 1WSDA 4FS8A 1M3SA 4OKNA 1GPYA 4NNJA 3RPEA 5CA1A 4LRTB 1RLJA 5BQ5A 4LDRA 1V43A 1JR3D 3K1YA 2BM0A 4X85A 3TB6A 1YZ3A 3QBDA 4PSVA 1XXLA 1D6MA 5T6BA 1ZVVA 5HF8A 2RKWA 2C97A 4PV7A 3WK8A 5CH5A 2PXAA 4LOKA 8ABPA 5D86A 1CRPA 4GWGA 2J3DA 3VZQA 3S8EA 1KI3A 2M98A 3QHQA 4NFHA 4RCYA 3R3JA 1KMQA 2FG5A 1F7UA 2G71A 4BY9E 3QSYA 4AW9A 4YCMA 3SEQA 3FETA 5A9RA 1QWSA 4IVRA 1HLGA 1M73E 1XN4A 4WKNA 1XV5A 1KH1A 1NW9B 1WJGA 2X0NA 3LT4A 3VDQA 4BMDA 1QHIA 2VHXA 5JE8A 2HU2A 1N5DA 1JYEA 4OHPA 4WOPA 3BICA 4QLOA 4WZ6A 2ZANA 3M6MD 2Q5CA 1SUWA 4V39A 3D6NB 1NX6A 4I2VA 5CHEA 5EWLA 5IDXA 2HT6A 3I3OA 1KXZA 2AUTA 5AK5A 2VTKA 5LZ7A 5LZ2A 3UG7A 5I8PA 1R66A 2WT8A 2AG1A 4ZYTA 5LQRA 1RJEA 2NXEA 4KXFB 2W6PA 3NNNA 4Q7QA 1W8IA 2WTXA 1O7JA 3WA6A 1I7DA 2BFCA 3H5VA 3AL3A 2OUIA 2BW0A 2BEWA 3MN1A 1JB1A 3PFGA 4TQUS 5FPPA 5DLPA 5KMGB 3EQ2A 2NVUB 3GPIA 3TI7A 3FTPA 4IH1A 3AWDA 2PBFA 3NHWA 1QKKA 1TAQA 2YV5A 1T36B 3QNWA 4CCSA 1RRCA 4H18A 1JV2B 1SUDA 3ZWVA 1KETA 4IGIA 1OAOA 4GYWA 2HK7A 4PU0A 2C0QA 2WD8A 2ZR7A 3GEGA 3N59A 4EMBA 1X1RA 2A6PA 2W6JD 2NPIA 3ZHRA 5B64A 3P2EA 2H1HA 3MJFA 5DMHA 4F60A 6PFKA 1FFGA 4MR9A 2YJZA 4KXYA 4OCZA 3S2YA 3JQ8A 3CN7A 1X6VA 4ER6A 2ONCA 5IBRA 3VZCA 1KZ1A 4MV3A 3EVGA 4E88A 3K9GA 2LDBA 3CRNA 4EK9A 1L3IA 3T61A 3DOOA 4GL4A 4U9IS 4LJ8A 1I0LA 5AW5A 4FCCA 1T2VA 3C5WP 1S8NA 2QKYA 2YWJA 2D1QA 3KKOA 2ZE8A 1KC1A 4IFTA 3TD6A 2BEWB 1N9GB 2JCSA 4EUSA 1R1DA 2CL7X 2D7DA 3UJ3X 1BXGA 1DI0A 2O3TA 2YNMC 3E7FA 2O8VA 3E2PA 1BFKA 4K28A 4LDJA 4HD8A 2VSOA 3IRUA 3BL8A 1XD8A 2PX6A 5IK2A 3EG5A 3PFCA 1PR3A 2OCBA 3PXDA 3RDPA 2B5OA 3CIFA 1WW8A 1TTTA 2HCJB 1KYQA 3C7AA 3GIDA 4QEKA 1SZDA 1UBUS 3MJTA 5C8VA 1MFZA 1R9NA 1RWVA 2QP9X 1FXUA 2X7HA 3WP0A 3LX6A 1TM2A 1V25A 3EODA 3PEVA 1SM4A 1RT9A 2R9VA 1SUSA 2YX1A 3MUNA 4UZEA 3UANA 4JI4B 5WRFA 3FPHA 4G84A 4TL6A 1YIOA 1U9YA 1NF8A 2Y92A 1TFRA 1YZHA 2NZVG 2Z2IA 2UV8A 3DDSA 3FWHA 3ZX5A 4Y2QA 2I6XA 3RC7A 1RI3A 4EG1A 4FSXA 3K71B 4MV7A 4H2DA 4P4GA 1EWKA 2XZPA 2JANA 5CD9A 4EBFA 2HV8A 2Q9BA 4FBLA 1IUKA 1I4WA 4CKXA 2VXYA 4H1UA 3L4JA 3ZR4B 2JG3A 1V1JA 2AA3A 2ZPUA 4TTSA 1I3KA 2OM6A 4LWZA 4OFXA 3LWDA 3WADA 1L5OA 1C7RA 4HFRA 5C7IO 3VISA 4PSCA 5KSPA 1NJFA 4QASA 1XKQA 4GYKA 4WERA 2ZJ7A 1DX4A 3QEBZ 2N3ZA 3OZFA 3A4VA 3KSUA 5LR6A 3DLTA 1GPWB 1J49A 4G0WA 1NVMB 1WXFA 1NF9A 2CNLA 1YBHA 3B6MA 5GVRA 5JR3A 2RGXA 4RH1A 3NONA 2WSLA 1CUJA 2V5AA 3HY6A 3NJ4A 4UAGA 2EW1A 4OXNA 3TW4A 2C77A 4BVFA 3O6VA 1DAIA 2PL1A 2YIDA 3LU1A 3ZXXA 5GV8A 1N5JA 1KYTA 1O58A 2FPGB 3X2SA 5ECGC 1D2GA 3VHXA 1APBA 1OI7A 4KIFA 1AD2A 1QIMA 2CNWD 4EY5A 4CT5A 4NATA 1FZQA 4M9ZA 5DH9A 5DYIA 3S99A 1ONSA 3KOZA 4RK7A 5FI5A 4OAQA 1XF9A 5CLIA 4M0UA 3SX4A 421PA 4ZHQB 3E3AA 4RU1A 3AIOA 3DO5A 5F12A 1GLVA 2WJ4A 2K87A 3E3OA 4X20B 1NW6A 3RSLA 3W9UA 4YO8A 4CM4B 4A5OA 4HFJA 1Z25A 2BHTA 2XF2A 2IELA 3I73A 5ED4A 1AKUA 4L4YA 1NKTA 3KV1A 4UARA 3W8RA 5I3ZA 2IBMA 4FDAA 3TOVA 4ZJZA 2CSUA 2YWRA 1UOOA 2QLMA 1XMXA 5EZYF 2V7VA 5B7NA 4P4UA 4KQ2A 1QLHA 1O5OA 2AZTA 5JSZA 2ZI3A 4MJXA 1MRSA 5CBKA 3V34A 3DZIA 1D0IA 1V4VA 2HF9A 2QSZA 3R4CA 1P81A 3PIRA 4UZFA 4EPTA 2O3UA 3KOUA 2G1JA 3ELYA 2JJ2A 4IOKA 3SE7A 4DPMA 1E5XA 3FFBA 4D9FA 3REQA 3SZGA 2JFFA 3TFWA 3PUHA 5B58C 2W2TA 3RBVA 4ZICA 4AX8A 3DCYA 3WO1A 3HL0A 1ONNA 1T0JB 3GN2A 5EKXA 4EHLA 3NHPA 1D6JA 1KK2A 4Q4AB 1G8KA 2WTAA 4JLJA 2ORYA 1E9DA 2Q5FA 4NVRA 4RLQA 1TGYA 4RPHA 5I9SA 1ODLA 3H13A 4DLPA 4X20A 5KJFA 2O19A 2H07A 3PGA1 2FN3A 3E03A 3JALA 4N3GA 4NCIA 2MSDB 3KYCA 4XCQA 3UGQA 5K0NA 3ZHCA 3Q8WA 1T43A 3F46A 3JS5A 2GBIA 3TG8A 4TN1A 1C9JA 4NDNE 4G81A 1CT9A 3UWOA 3ZI4A 1PS8A 3LGSA 1H2YA 4K0RA 3FUWA 4PO1A 4D8TA 1P91A 3SY8A 2CDRA 4HAOA 5JSZB 4HAUA 3H99A 5LYJF 3C24A 4QULA 2KS6A 3G59A 4UXHA 3ZU4A 4DCUA 1HYGA 1AKRA 3K6SA 2WMDA 2WHPB 5D3MA 2LDXA 1JFFB 3OECA 1OU4A 1W30A 1VPTA 3LRXA 1NNEA 4S1TA 5FH9A 3ROFA 2E21A 2GM9A 1MHPA 2BR3A 3PCXA 4NICA 4LJ5A 4QYTA 4F9TA 1HE2A 1D03A 3NT4A 4HAXA 5KX5A 4RA6A 4LJ6A 2VXBA 1R8JA 4CFYA 3V7UA 1MVLA 2DWQA 3KDAA 4XWGA 3WYFA 4EJ0A 5HTOA 5E2BA 3ED5A 1GZUA 2NUPA 4NYJQ 3AETA 4L0QA 4Q0MA 3I4CA 4OVKA 5GV7A 4BO8A 1FE8A 2R7KA 3KYCB 1RYYA 3VHRA 1BJRE 2M32A 1CZKA 4BVEA 8ATCA 1QAOA 4KQWA 1LZKA 3CLTD 1U7HA 3KK0A 3NORA 4HJRA 4R0VA 3ZDEA 4OG2A 1M33A 3W34A 4N7MA 1U3TA 4LWPA 2NV0A 2OQIA 3HP4A 4E7PA 1K06A 3FR7A 5ECYA 5FFMA 2ZB8A 3TDNA 3L3BA 2BGWA 1EYZA 1E98A 2WRZA 4GOKA 4Y0VA 5EUBA 2WP0A 2JBAA 2R00A 1XL0A 1W5SA 4FQ8A 3TQTA 3WJ1A 3HYLA 1OV6A 4Q47A 5K6AC 2RGGA 2WHPA 2Z0MA 1GQFA 4LG1A 2O3QA 4FYPA 3D6FA 1Y5LA 4M8LA 2XGGA 1JFFA 1D6NA 1B0PA 2PGAA 3DYVA 1KXJA 4RPIA 5ALLA 4PAOA 2X5JO 2VA9A 3LQ4A 4YA6A 2C88A 1GCIA 3IELA 1L4MA 4IDAA 3LDAA 3UYLA 1BEEA 2CLKB 1T1IA 3KXDA 4CQJA 3WGHA 2PVCA 5HUQA 4TUYA 3G5TA 5EKDA 5THQA 2VBCA 1G5HA 3GCWA 4IIYA 3EG9A 5DASA 4C88A 1Q0UA 2LKCA 4CQLB 1CYDA 3A10A 1H2HA 2WM8A 4LMBA 2QR3A 4RZUA 1MB2A 1QOPB 2H5LA 2X2EA 4HNAB 4H7FA 4Z53A 2C9ZA 2YN0A 2VSNA 4ZAYA 4UCXA 4N1AA 5BURA 2G82A 2IEAA 3DEYX 1GZHB 1PK9A 4PICA 2J3MA 4DQVA 1C0LA 1NGSA 4GR5A 5LYYA 5IDQA 2GZ1A 1Z33A 4MDFA 4D98A 5BSFA 2DUNA 2V7BA 3AGQA 4CIYA 3H2HA 4JJ4A 1VPLA 3H16A 2JIDA 2C78A 5L95A 3HWWA 5T8KC 2PL9A 3AR5A 3LSTA 3PX7A 1H1TA 3S0JA 2W58A 3E58A 2Y68A 5EAIA 2HXYA 2NZXA 4Z0TA 4GZ6A 3MT0A 2EKDA 1FX0A 2G70A 3I83A 4TUYB 4KJZA 4BYGA 4TWJA 5I9TA 1XA3A 3AONB 1H4QA 1HWYA 3IAHA 1M8FA 2YWFA 5ADHA 1H1LB 3CBQA 3VSBA 3R9WA 3BFJA 3CUSA 4GECA 3NWBA 2QM3A 1XLWA 1C8VB 1GTG1 3DMFA 1UEXC 3T5AA 1Y4SA 3PQDA 4WHMA 4X6UA 3WA7A 4DCPA 2O7VA 2J9GA 1NRIA 3R7SA 5JC1A 3O4HA 3SBOA 4L2IB 2Z6VA 3FFAA 3DZFA 2FUKA 1GZ6A 5G0TA 3VJKA 1YT5A 3D6TB 3HR7A 4JLVA 1JAIA 1BGWA 4EM6A 2XYGA 1JQJC 1LW6E 2AHRA 3PQ6A 2DYKA 3V9AA 2J9FB 1WHSA 2CLHB 3JAKB 3DOEA 3H9CA 3RUCA 3ZD7A 4ZYWA 1SQFA 1SHLA 3IEIA 4WZAA 4BS9A 2M6RA 1E9RA 5LMUB 1PT8A 2ZJYA 3E8MA 1XRPA 4DUPA 2O6HA 4AJLA 2I91A 4HZUB 3VAAA 3FI0A 2X8WA 1KAMA 2G83A 4EB8A 4JBGA 1AB6A 3R6GA 1LDGA 4HAYA 3QE3A 4X6YA 5I7EA 1VL1A 3VPGA 1P7CA 4A26A 3ZOZA 3AF1A 3OHMA 1AZTA 1I24A 4KMOA 1ZIYA 2GLXA 4AU1A 3J80A 4YACA 1A82A 1F7VA 3DVSX 4C4OA 2ZIUB 3DF7A 1RJGA 2AZMA 3M49A 2HLPA 2RAUA 3AFOA 3DV2A 2E9SA 4G67A 4ZRDA 3WY9A 2GO7A 5KNDA 1H0HA 2AQIA 4UXJA 1E0AA 4J2HA 3ZEIA 4DEYA 3AV0B 2WWYA 2BFBB 4M7WA 2P1RA 2GT1A 2WWIA 3A1WA 5DHSA 5E0KB 1AO0A 4I8XA 4OA8A 2VATA 3IQWA 1XDDA 4NZNA 4FN4A 4P36A 3VDNB 2YMPA 4W5RA 4GMFA 4M1KA 3ZWMA 1W46A 4WXEA 3E53A 3KPVA 4NV0A 5SZHB 2ZS9A 5CEFA 3JAKA 4I2NA 4X41A 1OUMA 2Y1EA 1OWMA 1M2NA 2E0IA 2I7CA 3OOSA 4MKGA 5F76A 4JI6B 4YYZA 2H4WA 2TRSB 4E1BA 4TZ6A 3G5AA 5K2MA 3NFRA 1W5EA 4J0GA 4TL8A 1DJPA 3U9LA 3HKDA 3IP3A 4ZZ1A 1EPUA 3KAJA 2AB0A 3PF8A 2HBZA 4FXOA 2FEAA 5DSXA 1L7OA 5CT5A 2WSSA 4QBGB 3HMKA 3I9JA 4ML3A 1PR0A 4CQMA 2GYUA 4QOHA 5CNIA 3DGEC 1W88B 2WKPA 4V1CB 3UQYS 3BRCA 2OR3A 4LOIA 2OBFA 4B2YA 4F2HA 2X0DA 2OC4A 3ZDYB 3I5YA 1R3DA 4RD6A 3CUWA 3RB8A 3BTSA 4QFMA 2C3MA 1OAOC 2BFBA 3JTEA 1Z6YA 2LE0A 1VSUA 1VECA 2VDOB 1AHNA 2P6PA 4XM0A 3WGTA 4AFNA 1ORVA 5IEBA 2MU1A 1PJ3A 4AO8A 4MQ5A 5I7UA 1V3VA 1KDPA 1ZSVA 3P9KA 2SCUB 4PQYA 3RU3A 1C50A 3RYHB 2VAPA 5JZBA 3GA5A 1S96A 3ZJUA 1W0KD 2X2PA 3D3KA 4C4PA 1GKIA 2YBEA 1LRLA 1XNHA 3IMFA 3RYCB 1B8PA 1E94E 4FHGA 3I5MA 3O47A 4O8CA 4NCHA 3RASA 4FMDB 4E13A 1FNBA 2HMUA 1ZU4A 3HKDB 5BT9A 2JFYA 4C3UA 2WIKA 4PZLA 4JI2B 2FGJA 3JWHA 4E46A 1LSUA 1C1HA 3H4TA 2XMSA 4L50A 2QMZA 4A6EA 4OA5A 1SPBS 3EXHC 4ROTA 1EX1A 3D5EA 4RVFA 5DSZA 1AC5A 4I6GA 2W2PA 4BMZA 4GOND 1ZGJA 2DE0X 1YD7A 2NSDA 3HS3A 3G2KA 3NHZA 4MLPA 5F2EA 1SURA 4KNWA 4EY4A 2Q8PA 4NYIQ 3PKZA 3MS2A 3TNFA 2Z6UA 1U0BB 3Q5GA 3RIHA 3E0XA 3FRHA 3L0IB 1MC4A 1U1EA 1IQ0A 2YTZA 4HAZA 5HPYB 2Z09A 1Z16A 3MM4A 1Y5NA 3VAYA 4ESVA 1SBZA 4V0SA 4K9OA 2B1GA 2O2ZA 2IX9A 3GMSA 3HB7A 5D5PA 2CYAA 5DLQC 2JIRA 1T4CA 2ZUWA 3I01M 3RUFA 4TRJA 4X7PA 1YR9A 2NQTA 4ZMRA 2X9NA 4AKEA 4J0IA 1RRPA 2VF2A 4G5RA 3MBIA 3QF7A 2GHQA 4KE8A 4BQIA 4EENA 4F56A 4W5QA 1Y6ZA 2PTHA 2FCAA 4CKZA 4YAGA 2LGJA 2NN3C 1G5QA 4BRWA 4IWYA 3HVKA 1P4RA 4OJMX 4XUEA 3PHJA 4PC3A 3TQHA 5B2ZA 2CCJA 5F64A 4RWEA 3RF6A 3VR6D 2PKQP 1F8XA 3PIDA 2VPTA 4AYTA 4C01A 1XTQA 1YMQA 5C5CA 4NLLA 1GV0A 2B8NA 3UC5A 4ZU1X 3FHTA 1JL3A 1KARA 1FA9A 1N0WA 4H1VA 3U4CA 4K1XA 3CLHA 5L3SB 2A1TS 4OI1A 2AUMA 2XYPA 1FMFA 2Z4SA 4CDRA 2NZYA 2W93A 3QOWA 4H9GA 4B3XA 1WXWA 4GOMD 3LQQA 4K87A 4TYQA 3TZKA 1L7VC 1OASA 3UV7A 1GPKA 5EWMA 1OLOA 3TXAA 1MO4A 1NXPA 1CTQA 4BP1A 3I9FA 5HQ3B 4B2IA 1N1GA 3IFSA 2B34A 1XZQA 3OLQA 4JUIA 3TTYA 4AJIA 4S35A 4FWIB 1GARA 3AHFA 5CW2A 2YN4A 2TS1A 3OLWA 1GUAA 4HWPA 1DB3A 4IDEA 4K81B 3ROKA 1JX6A 5ELXA 2H9IA 4FYXA 3I6IA 3LRTA 3MOSA 3I52A 1E69A 3NDIA 5F5XA 1VMKA 1TPYA 2X9GA 2BF7A 2AFIB 2J5RA 4HHEA 2QAGA 5KAPA 1KS2A 1TMYA 3D0KA 3FSGA 1Q2XA 3MBKA 1LX7A 4CU5A 3D3NA 2XWPA 3ZY6A 3TTVA 4DT1B 3QNMA 1NVGA 3U7FB 2IXTA 4JLUA 5FORA 4JI5B 1UDRA 4M0CA 5BXYA 3JATA 4LXHA 4MV6A 2V5VA 4YFYA 5J2TF 4CPDA 2FEMA 2Y93A 3AESB 4YHHB 3FF1A 3RLIA 2KBEA 3NM4A 3N2NA 1OFGA 1ZI6A 2XWQA 3A6LA 4FHZA 3RHZA 1L4EA 4C03A 3F98A 1RWOA 3U81A 1MF7A 1MG0A 1UPBA 4TLBA 4UULA 2Z5VA 3H0EA 3GMIA 3RVKA 4AG5A 4YT8A 3Q2IA 5E6RA 2DPGA 1FDUA 2PWYA 2OD2A 4BB5A 4D6XA 1Y8QB 5K8IA 5CRIA 1PYOA 4QECA 3IBCA 3T1TA 3UB4A 2DUJA 1OHHA 3G6WA 2YFQA 1IM5A 3IEPA 4O8ZA 4EITA 1PFQA 1XZBA 2H7XA 2HB6A 3WJ7A 1OC2A 1A8PA 1FXWF 4MKXA 4C04A 1JLHA 1GVNB 1Q57A 4RMHA 4J29A 1F2DA 1HI9A 3FFXA 4HP8A 2CHQA 3QBJA 4TS9A 4D9EA 1QGUA 4AY5A 2D7CA 1K4YA 4W9RA 2XI4A 4AJ4A 2JRCA 1V3QE 1J9EA 2WIBA 3LHFA 3O03A 3V4OA 5H3LA 4HH1A 2PTGA 3WRXC 3O8QB 4DIUA 4DJEC 4B74A 4D9CA 3DCIA 2Q7XA 4P92A 3P32A 4EB0A 1V3TA 2PLAA 3Q9SA 3WQBA 4IDBA 2W37A 3C16C 3PXBA 2BMVA 2HMSA 3F6EX 1OW3B 1VIAA 4TTRA 3CCBA 2HMWA 1SKBA 4J16A 5DNEA 3IPRA 3W4KA