1XZ8A

Pyrr, the regulator of the pyrimidine biosynthetic operon in bacillus caldolyticus, nucleotide-bound form
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
179
structure length
162
Chain Sequence
b'MQKAVVMDEQAIRRALTRIAHEIIERNKGIDGCVLVGIKTRGIYLARRLAERIEQIEGASVPVGELDITLYRDVPFPVTERNVILVDDVLFTGRTVRAAMDAVMDLGRPARIQLAVLVDRGHRELPIRADFVGKNVPTSRSELIVVELSEVDGIDQVSIHEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PyrR bifunctional protein
molecule tags Transcription, transferase
source organism Bacillus caldolyticus
publication title Structure of the Nucleotide Complex of PyrR, the pyr Attenuation Protein from Bacillus caldolyticus, Suggests Dual Regulation by Pyrimidine and Purine Nucleotides.
pubmed doi rcsb
total genus 48
structure length 162
sequence length 179
chains with identical sequence B
ec nomenclature ec 2.4.2.9: Uracil phosphoribosyltransferase.
pdb deposition date 2004-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1xz8A00
1R3UA 1ZN7A 1DQPA 1IBSA 1P19A 1O5OA 1ZN8A 3H83A 4KN6A 4RHYA 3OZGA 4F8EA 1Y0BA 1ECFA 3HVUA 1CJBA 4X45A 5KAPA 1J7JA 3KB8A 4RV4A 1U9ZA 1G2PA 3G6WA 3DEZA 1ECCA 1GPH1 1HGXA 1UPFA 2JKZA 4PAWA 4JLSA 4MB6A 5IPFA 5ESWA 4LYGA 1OROA 1XTTA 3OZFA 5BSKA 1BD3A 1QK5A 1V9SA 4QRIA 3LPNA 1XZ8A 5K51A 4P81A 4QYIB 4WMLA 4JITA 1ECBA 1G2QA 3M3HA 1I5EA 1YFZA 1QCCA 1QB8A 3O7MA 1AO0A 4IJQA 4M0KA 4P3KA 2C4KA 1BZYA 2WNSA 1P17A 2JKYA 3N2LA 2PRZA 1A98A 1GRVA 4P82A 5BQOA 1DKRA 1JLRA 1QCDA 4M0UA 3ACBA 2FXVA 1JLSA 1STOA 1XTUA 1OREA 4WN3A 4X44A 1OPRA 3ACDA 1L1RA 1ZN9A 4RACA 2H07A 1BD4A 2PS1A 5KAMA 1HMPA 1G9TA 1I14A 1NONA 1VDMA 3DMPA 1XTVA 1QB7A 2IGBA 1A97A 1P4AA 2HCRA 3GEPA 1A95A 4ZFNA 1I0LA 1L1QA 5IAOA 1PZMA 4M0PA 4P80A 1DKUA 4RANA 4Z1OA 1XZNA 1G9SA 4LZAA 1VSTA 4RHXA 1DQNA 1O57A 4P86A 4RHUA 2XBUA 2PRYA 1UPUA 1QK4A 2H06A 5HKLA 1D6NA 4OHCA 4P83A 4RQBA 1U9YA 1P18A 2DY0A 1QK3A 5HIAA 1ECGA 1Z7GA 3DAHA 2YZKA 1DBRA 3MBIA 4P84A 5EUCA 2AEEA 3OHPA 3ACCA 2H08A 4RADA 5ESXA 3GGCA 1FSGA 1VCHA 3LRTA 1W30A 1TC1A 3EFHA 1A4XA 4S2UA 4LZNA 3QW4B 2P1ZA 1I0IA 5JV5A 5JSQA 1ECJA 4FYMA 4RAOA 1LH0A 4RQAA 3S5JA 1WD5A 2E55A 4RHTA 3GGJA 4LZOA 4PFQA 2EHJA 5BQPA 1I13A 2VFAA 3NAGA 4TWBA 3MJDA 2GEBA 1A96A 1MZVA 1A3CA 4LYYA 4RAQA 4RABA 2JBHA 5BRNA 4QYIA 2JI4A 1UFRA 1NULA 1TC2A 5E38A
chains in the Genus database with same CATH superfamily
3OFSA 2V5AA 3E9ZA 4ITRC 4DC0A 3NBXX 4S1WA 2EJCA 2BL4A 1GGJA 2GERA 2B25A 2OCIA 3AVQA 2ERYA 4FMPA 3W2HA 3HGMA 8LDHA 2ZB3A 2O2HA 4EO7A 3C5CA 3H7AA 3P0JA 2JKVA 1UK9A 2XMDA 3L8EA 2MSKA 2WKQA 5CPFA 4B3IA 2GASA 1GZHB 2VP0A 1XRPA 3TLAA 1T24A 4RK7A 3OE5A 3Q0TA 1SQ0A 2AHOA 1DJQA 1DO2A 2QQGA 2PG3A 1A2QA 1DRKA 2CUNA 4OAOA 4CIBA 3NX4A 1SCAA 3I2JA 2GAFA 4RD3A 1HLFA 4MRVA 2JW5A 3OZFA 4OH1A 4MW2A 3ASYA 4QVIA 1DDGA 4E22A 2XKBA 4ZI7B 3V3TA 4DEVA 3EYWA 4B9AA 3N2GA 5HUJA 2VEDA 3RB8A 2I6GA 1EU1A 1SUCA 1XTJA 2JLSA 1GAXA 4RMHA 3A1WA 2IPLA 1AV7A 7ABPA 3IVGA 5K0ZA 5LIRA 1P9NA 4EGSA 3KQNA 1UDCA 3RYFA 3PIRA 4U2BA 5HIKA 2I4LA 4ARIA 4ZREA 2INGX 2A0XA 1EH5A 5AI8A 4ZVOA 3HP1A 5DW0A 4I4IA 4JYBA 3CLTC 4FCVA 4HAXA 5TS3A 3VR5D 4BTVA 2XY4A 3EWIA 2JGDA 1KK1A 1KOFA 1Z7BA 4E14A 3C43A 3SYKA 2H5JA 5IABA 3RIHA 5AWFC 3ENNA 4LDJA 1KXJA 1AQLA 3LW7A 1CC1S 2RBEA 4FQ8A 2VDJA 4GO1A 2AX3A 1UQTA 3OQPA 3DEYX 4PZYA 3M6XA 3T5MA 3BEDA 4NBSA 1JHUA 3DFUA 4XQ9A 4ZVSA 2ZJ5A 3SZ3A 4CLRA 1L7RA 1YZQA 4OI4A 3PLAE 3TQHA 1O9GA 3I2IA 3N6RA 1O89A 1U8TA 4Q1FA 2G1KA 1ILWA 3FNEA 2V7UA 3CVUA 4KIFA 3H1PA 3OIWA 5TY0A 1M6NA 4OXXA 2H2DA 1EK1A 1QR6A 3B1JA 3GDFA 3H1AA 3RV3A 3PI6A 4XLLA 2A5GA 2PFSA 1XEWY 3DUFB 3P2KA 4BIMA 4CI9A 3OQBA 3K0CC 5AW1A 5TIIA 2QNBA 2VZEA 4M36A 3URKA 1UZLA 1B8PA 4QEKA 4C0SA 5EIBC 3AERA 1ZGAA 1Y4AE 2PMKA 4C0LA 3K9LA 4W9NC 3DEFA 2AJLI 2ODQA 3T9CA 2DKFA 4X1YB 4CKEB 1PNVA 2IODA 3IEUA 1VL8A 2QLMA 2C7BA 4RKQA 1RZVA 3GL9A 3AXTA 3O7WA 4QBTA 4RD6A 4WKCA 5AKKA 4CM4A 1RP1A 3H0CA 2ZI5A 3PUJA 5EJEA 1KOGA 1B14A 1A76A 1DO0A 3BZWA 3IVAA 4QBGB 2FX3A 3KDSE 2YQ4A 4HDSA 4BJ5A 4D9EA 5JV5A 1YQGA 3SAJA 2E1RA 1IE3A 2OLJA 3O74A 3P71T 3L93A 3A6FA 3PK0A 4HXEB 3RG8A 3ZS8A 1I4TD 4UU0A 5LP6C 4DIFA 4TZ6A 4QDXA 1AGRA 2VWGA 1U1FA 1XKLA 4GPTA 4HPJB 2XTAA 2OSVA 2Y76A 1RWNA 4LZOA 2A84A 2X6TA 2ZBPA 5D5QA 4EKGA 3C98A 1OXMA 4BV2A 3C6BA 4OCZA 3V2GA 5BSFA 3WLIA 1SZJG 1CB7A 2VNJA 3AVUA 3DT6A 2A0UA 2AL7A 3T1QA 4HDRB 1H2XA 4GHWA 5FWXB 4DRXB 1DT5A 1VJRA 1U6IA 4TLBA 1LW7A 4LXQA 5LUAA 4YV7A 4LWOA 1LSSA 4NKRA 3NP7A 4PPYA 4YMVA 2YY7A 1CY7A 4V0SA 2IIQA 4Q3NA 1GDTA 1KPIA 2PL3A 1CIPA 2QN9A 4GMXA 4R1SA 4TYPA 4X8HA 5E6SB 4RTRA 4NECA 3PUVA 2IYSA 4OJYA 4EABA 3L7AA 5D3QA 1Q44A 5JAPA 2ZRHA 5AXBA 4LFAB 3LCUA 1W94A 1JLHA 2WJ4A 2QRUA 4HWKA 1V8FA 4YAGA 2B4QA 3DB1A 4D3XA 5L3ZA 4NFSA 1TZ2A 2HUNA 4ZEVA 4LYGA 3FG9A 2XNHA 4UZSA 4TVKA 5G0UA 4F91B 3RODA 4E1AA 1LNZA 4IJMA 5F1PA 4UHKA 2JL1A 4MH0R 3UPDA 2B5VA 3G8CA 3OQIB 2X6RA 3CWCA 2EWVA 1AN9A 3F3MA 3HY4A 4P36A 5CB4F 4WBNA 2O07A 1L9XA 1B0PA 5IASA 821PA 2W6JD 3IIMA 3LKDA 2IV2X 3DBVO 5LJIA 4I4TA 3EUEA 4HDKA 1G8SA 2W2KB 2PVPA 3S1AA 1T34A 3FHLA 3KQMA 3O8NA 4BWYA 4AMUA 1D03A 3FFAA 5CNIA 1P6UA 2H7XA 3E53A 3MJFA 4CG0A 5COBA 4PXYA 5L3QB 2DLDA 1Q7CA 3KKPA 2H3EA 3CUTA 1ZIPA 4UD6A 4G5GA 1VKNA 3QX7A 4HMQA 4TS9A 1AQUA 3JYLA 4Y9RA 3PVCA 1Q92A 1ZN9A 3BGOS 4ZALA 4W1RA 1N6OA 5AVXA 1FZQA 2OM2A 4MB2A 3DM5A 4KN5A 5FBVB 3UJAA 2HCRA 4C08A 3HJRA 4BKMA 1U2DA 4J16A 4Z4IA 1ML3A 3C6QA 2ANBA 3WSWA 1FRVA 2A9KA 3A2LA 4ZVMA 2HWWA 3V32A 1RLTA 1E62A 1Y7LA 4V1CB 2HWXA 4KITB 2YZMA 2II6A 3AR2A 4H1TA 5KNDD 4FUTA 2BUAA 3ODGA 3TTUA 3DPIA 4O59O 1DAEA 3UPTA 1TGVA 4BAGA 3C3JA 3MJ4A 1DZIA 1LBSA 4HJRA 4RH3A 3Q1KA 1J2TA 3J7TA 1AHIA 4O4HB 5A9SB 3VPXA 4RIFA 2CMKA 2REOA 3DHVA 1W76A 2I99A 2W0SA 3FOAA 3RBXA 1G21B 4C4ZA 2A86A 4DCJA 1E9EA 4Q4AB 3B9BA 4G5SA 4TOIA 4E32A 1ZJ5A 5KQMA 2ORWA 2C7OA 5IX8A 3RC1A 3I6BA 1NXVA 4ID9A 2PX3A 3A1VA 4MMXB 5EP2A 4QQKA 4WGFA 3GDHA 3HDJA 3BT7A 1TC1A 3SC2A 2Y3IA 2O19A 5LC1A 2P30A 1F9EA 5KTYA 3A3NA 3G17A 1HSOA 3JX9A 3VUEA 3PICA 3OBIA 4JGIA 3BMNA 4RAOA 3LHSA 5DYIA 4RQAA 3G82C 3FPBA 4MVYA 1T6XA 1WD5A 2I80A 2I6SA 4TV8B 3PJGA 1ZJWA 1LTKA 3ULKA 1AXEA 4PXAA 3NOQA 5BQ5A 1C5KA 1EVKA 3DUFA 3FYUB 3VU9B 3V8NA 2MSDB 2PUJA 1R4NA 4WFIA 5K3SA 1TQHA 2VJPA 4B7ZA 3EB9A 1TJYA 4IUYA 1J1ZA 4BX0A 4ZC1A 4JQSA 3WBBA 3D0KA 3WJ7A 4OD0A 1CEEA 4JT8A 1QS0B 4QXPA 3PYLA 3L0YA 3K5PA 4G9EA 2X1LA 2BFWA 1ECFA 4KBFA 2Y77A 3OZRA 3Q40A 4NH4A 3PD1A 4QWWA 3WIBA 5TQ2A 4TXMA 2WIJA 3NVDA 4MS1B 2ZUEA 4BUZA 4ZTUB 2GK3A 1X2BA 3IR5A 1G2PA 3LTEA 5KDDA 1UPFA 5AVRA 5A5FA 3SBOA 5JJ5A 4KH0A 4N76A 3BDIA 5J2UA 2MTBA 3BXOA 3OJWA 3NHKA 4PR0A 3HCRA 5ALFA 3FTCA 5HUHA 1CUSA 3DKKA 1MAAA 2DBQA 3K0SA 1QOPB 2WA2A 1K08A 4TWIA 4L3WA 4FR2A 2WQ7A 4KWTA 1TKAA 2D5AA 3WK9A 1CZLA 2XWBF 1X92A 4G5YA 2OUIA 1RR6A 1X74A 1AS2A 1YDHA 5AVOA 4BDSA 4BQFA 3GGPA 2FEOA 2B35A 2QX4A 3LYAA 2G9RA 3QA3E 1WMFA 2OXIA 3I9FA 4KMSA 3LBNA 1XBTA 4AZ0B 2B5OA 4RXUA 3SC3A 3EUWA 2BKEA 4LWPA 1O6CA 4K81B 1T4DA 7AT1A 1NU6A 5D2CA 1LKZA 5GWXA 4ALLA 4LS3A 4R01A 3I0ZA 1U8EA 3I8OA 4NEQA 5J59A 5GAJA 3ZE0B 5HIAA 4ONEA 2HLDA 2IW3A 3D3KA 3IR6A 4NLLA 3VI4B 3OURA 3LY7A 2GNPA 1RRMA 1SOWA 1U6JA 2I7XA 3IBCA 1RMQA 1Q7TA 1M2WA 4UQPA 2R8OA 4GKAA 3KVVA 4Y6QA 4ZOCA 3T9EA 4PHTA 4CEHB 4ER5A 3R9XA 4BDTA 1GR0A 2BAGA 5KSPA 2WIGA 1FDVA 5BWBA 4ZYLA 2C54A 2VUUA 4ZJUA 4DZZA 4UE3S 3G79A 4XXHA 2V7GA 4B87A 1OFUX 3FSRA 3P52A 3EQ8A 2HM7A 4UBNA 2WBLC 4K3VA 1POWA 4HQOA 1F48A 4LJAA 4MR8B 2WSMA 2DE0X 2PYIA 4PYRA 4PX9A 3TSOA 4AF8A 5JROA 3CF6R 4P33A 2O7RA 3A26A 1U2GC 3IAHA 2QUJA 4RKEA 2VLIA 4C0JA 1FXSA 4V1CA 5LBIA 3AP1A 4PPFA 1EP1B 3TF5A 1OYWA 3OIDA 3ETNA 3KS9A 5KIAA 1CD5A 1WXIA 1PSWA 1SVSA 1C1XA 1DPGA 4B6SA 2BSQA 2R1UA 3PQFA 4B3FX 4Y2GA 4IQGA 1J0AA 2VH1A 4OEHA 1T1GA 5A5GA 2HB6A 2JJMA 1TIKA 1VCHA 3QG1A 2HCFA 4Q21A 2PZJA 4D8XA 4NAVA 4IG4A 4LRUA 5A5VA 4I9FA 5IZCA 1HO3A 1J9GA 3GI1A 4IIYA 2CBGA 4FYMA 2IVZA 3PFNA 4Q7MB 5CHEA 3GFTA 1D0IA 3AM3A 4WFQA 5EE1A 4C20A 2V96A 1ZOOA 1FC0A 2OQ2A 1PJ2A 2Q2QA 4KR2A 1A9OA 4MI3A 4X0EA 2ZUTA 2IH2A 3MJDA 5LJLA 1L3BA 2NPIA 5C32A 4Q47A 3DLCA 3O21A 4ZZIA 5FBZA 1KRWA 2WJJA 3I45A 2JGNA 4KQ6A 3L0BA 2HSJA 3D43A 3U3OA 5K0SA 4BC1A 2ZBQA 3OOJA 5CA1B 3ROFA 4NCHA 3SMVA 2FW8A 1KI2A 5DMHA 1VIYA 3E0XA 3HKDB 1BKYA 4CMIB 3KWLA 2BGKA 2Y9MB 3U3RA 2G28A 2F17A 2PH5A 4IFBA 3W90A 5A1JA 1ZN8A 2Z09A 3VVCA 2GHTA 2QU7A 4IDGA 3B2EA 2N47A 3ANTA 1EFUA 4IVRA 3IXQA 1F1BA 2WICA 2XD4A 2QD4A 4FZJA 4EFLA 5JAOA 1L5HB 4MIOA 3QVXA 1W36B 2M6SA 4WK4B 4AX4A 5IBRA 3RKSA 2ZE6A 4KL8S 2HZBA 3BWYA 5H80A 1K6EA 4RD4A 2FI1A 4HGNA 4NU0A 4LN1A 5EXPA 2FN4A 3IVCA 1NVVQ 5K8UA 4EB8A 1Q17A 1RWVA 1EUCA 3LBAA 2PLRA 3ZIAD 1L1EA 4BQIA 3H6KA 5F5LA 1J70A 4AWBA 9ABPA 4CKWA 3KPWA 1MCZA 4R3UC 1LC0A 2BKXA 3FCEA 4JDUA 5CRIA 4DZRA 3MF4A 3PL5A 1BE8A 2DLNA 2IH5A 3B9PA 3JD1A 3WYEA 4XVUA 1R8SA 4P7BA 4DR1B 3MAAC 2HGZA 1X15A 4LHVA 4MAFA 4PAOA 1K97A 3O3NB 4CE6A 3WADA 1AF7A 1SVWA 1AKRA 4EPRA 3LGSA 4X62B 2Y93A 1U8XX 3SZOA 3A4NA 4BVJA 4WFJA 1SU7A 3I37X 2XH8A 4W7HA 3UUWA 5DHQA 4QOIA 4KODA 2QRJA 4RNDB 5L3RA 2I4RA 2AG0A 4Q02A 5L4LA 3WNVA 4WA7A 2LCQA 4ERNA 2WIDA 5GINE 1OX5A 4NZ9A 3EDOA 3H5OA 1QRTA 4MDFA 3ESZA 3JPWA 5U1PA 5L4NA 4YAIA 1TO2E 1Z34A 2QE7D 3AF5A 1FDRA 1IJBA 2LWIA 1PZEA 4LGMA 4PGFA 3BB4A 3JQ8B 5EKDA 1B43A 2NUAB 1TTTA 5KX5B 2P35A 1GIAA 3E22B 4ZMSA 4FZ5A 2JI9A 4A2QA 1AN0A 5T8KC 3ND8A 1YBFA 2XBUA 3OJOA 5F64A 3W6UA 5HKLA 2HBQA 1NUPA 4F9TA 5C18A 3T9BA 3ZE9A 4R1QA 4YN3A 4YAKA 4DBLE 4G25A 3ZD6A 1CYEA 2FFAA 2JLBA 2G67A 1SUIA 2XA1A 2QM7A 4Y9TA 3UCFA 5KSYA 1Q57A 2W22A 1RLMA 3EGDB 3PQ3A 3GLSA 1ZVVA 4U7GA 4H0NA 3QWHA 1ZGJA 2VRCD 1PFGA 5C51B 5CGZA 1VKJA 4A0SA 4CMAA 4AJKA 2QP4A 1PFKA 4DJEC 5IT9A 3NBYC 1XAIA 1LLDA 3O4GA 4PICA 4X8OA 3TW8B 4XWAA 4HQ0A 1NNUA 3VJMA 3NNNA 1NUHA 3WO1A 4B3SB 3QKSB 1KA9H 1UZUA 3AY6A 5DIFA 4BV3A 1WDKA 4BL5A 5KNCH 3GFFA 1M5RA 4P4SB 5G2OA 1XQ6A 1Z5PA 4JJ7A 5LZ8A 3M9LA 2FWNA 2OVBA 5G41A 1U81A 4E12A 2WIKA 1A96A 5K2MA 2VTBA 3M6MD 2HRBA 5IBQA 4YROA 2ENUA 1PSZA 3RJZA 4A3SA 2B8JA 5DYYA 5DK6A 1WQ3A 1E7YA 3A6JA 2Z3ZA 3IHKA 3ZWKA 3ILVA 3JQ6A 5EVCA 4RGQA 1QPGA 1KI3A 1YR6A 3D8TA 2OXRA 4DIEA 1H2EA 5EYPA 3A32A 2FPWA 1TM7E 5CVJA 4IKEA 4KLCA 5CUQA 2V0NA 2OBXA 4Q6BA 4UKDA 3DLBA 2UXCB 1SKAA 4W1PA 2G5TA 2NSDA 1D2NA 1MAVA 2BI8A 1OBOA 1UC4B 2X58A 3CF2A 3N8DA 4FYVA 4QQRA 4ETIA 5A71A 1OWLA 1QIHA 3VYVA 1GARA 3IIJA 2QMHA 1X42A 3OA0A 4LOIA 1S2IA 1YJ8A 1EUYA 1ZBDA 3DO5A 2Z6AA 4ND4A 1BRTA 2HPAA 4DCUA 1CJMA 1H1TA 2VP5A 2XQFA 1FP4B 3HI4A 1BE1A 3O8OA 1DXOA 4PVCA 3PXDA 4W63A 5IDXA 1NURA 4BLUA 1I5EA 5CCDA 4O1HA 2AUTA 1QB8A 3LRPA 3B9QA 3BULA 3HU1A 4LYHA 1YRBA 3HB7A 1WDWB 3GG2A 1A8PA 1E1KA 4IDOA 3BQNB 5AHWA 2PDAA 3QU7A 5EZ6B 5IW8A 2D2EA 4C6TA 5FPHA 4RCVA 3R6DA 1QYDA 2XXAA 1EK5A 4J1TC 1M66A 1VOTA 3QFHA 4MOWA 2JCBA 5B53A 2Q5FA 4J1QA 1OPRA 1KZ9A 4AK9A 2FTKE 3AZPA 4G9BA 4L50A 3U19A 4F84A 2MSLA 3WISA 1FYFA 3GFQA 4EHIA 3GP8A 2NMVA 5JZSA 5D3MB 4XM2A 1Q1GA 2Q6VA 1CP2A 1VE7A 4NL4H 3IRVA 3IILA 2BYTA 1K8YB 1UT8A 1XDDA 2FWPA 1QE5A 2HXSA 2AD1A 2P2LA 3J7AC 4YJ3B 2BGMA 3PQ6A 4FKBA 4ML3A 2YFYA 5CYOA 1LF0A 1PK8A 5EWJA 2EF1A 5EKSA 5FOVA 3UT5A 2X77A 1DOAA 1G5QA 1YJ5A 3N7UA 1RMYA 2I2BA 4RHXA 1Y81A 4TTIA 1GQ2A 5K8VA 1QK4A 4A82A 3QHPA 2OBMA 2D1QA 3IL2A 1A7AA 2N42A 2OG2A 4R40A 5C35A 1Y8RB 2NO7A 1Z0IA 3X1WA 3GJ6A 1NBIA 2A5FA 2BZ1A 1DQRA 2FFQA 2I1QA 2BLLA 2JFWA 3CB4A 3KT8A 4KN9S 4U7TB 3X2EA 1JEQB 3E5RA 3H9JA 1NY6A 4CMCA 1YMQA 4S1TA 3ZHZA 2QQ5A 3LU1A 5DGCA 3BE6A 4WEOA 3FMPB 4A8JC 2PUBA 1A82A 1SXJD 3FSJX 2BGRA 3QW4B 5AI5A 1VL5A 3QLJA 3GQBB 2BF7A 1OR8A 1ZHHA 3WB0A 3W5BA 2JATA 1IOLA 2MINA 3CVYA 1GL3A 3V1TC 1GV1A 3W5AA 3HI6A 4NBWA 5H59A 3RYFB 1Y4UA 3SZGA 1OFGA 4FYJA 4EI9A 1QSGA 1RJGA 2ZI7A 2PZLA 3OKFA 1IZ8A 1KJNA 1A7JA 1RXCA 1M2FA 1UFOA 1XIVA 5FTWA 3IPCA 5BMVA 1MJHA 3UK2A 4Q3BA 3OQHA 3NPAA 2O9JA 1WS6A 2JHFA 2YV2A 3WGLA 1QHXA 4G2NA 3IDFA 2YWEA 1ZK4A 1E3EA 1QGAA 3FI9A 2IY8A 3TXXA 3GQBA 3WXMA 1I2CA 1XCMA 2V5VA 3LF1A 4TTSA 4AMGA 2AFIB 2FPPB 1MPTA 3UA3A 3BDVA 3FFBA 2NYVA 2FZWA 3JQCA 2OPHA 1NQVA 5K3AA 3UMGA 4DLAA 3GQVA 5B7PA 2NXEA 2R8RA 3IQZA 2Y1FA 1AA9A 1MO4A 3AUKA 3H3JA 1Z83A 3HJCA 3I09A 4FS3A 4TKUB 4CKZA 3K0EA 2XNDD 2B8TA 1GPWB 1Q1QA 3GLQA 3QBTA 1LK5A 1XQVA 2QV7A 1I4DD 4RWZA 2NAPA 4FJ0A 1FDUA 1WCYA 2Q0HA 3MT0A 3GJZA 5KVVA 3VA7A 4MAMA 3UYLA 1KAMA 2J6HA 4NC9A 3MTGA 3PQEA 3WAKA 2X9GA 5JNWA 1C9JA 3CZRA 5CJJA 4GPD1 3WYDA 3TR6A 5FADA 4RQUA 5E8JA 4BYGA 2J0VA 5JYDA 3E5MA 3E58A 1NXPA 3HP7A 2N1BA 2WMNB 4OP3A 1JKJB 1PZFA 4RJLA 4AFNA 4R8LA 5AK5A 1Z4JA 2QLNA 3IMKA 4Z86A 4Z4GA 1USKA 5AW0A 1JDVA 3AHGA 4HAYA 1X39A 4WZAE 4OGLA 5EJ7A 3DFIA 2RKWA 3KQPA 1VKRA 2OFWA 4KC0A 5JFOA 1ADYA 3DZFA 4JI5B 4QM6A 4DCOA 3U56A 3BGVA 3NOOA 1T3TA 3DL0A 1DEHA 1FUUA 3QKRA 3L7DA 1MGOA 5F3RA 3QVKA 4PW0A 3U13A 6YASA 3UHOA 3SVLA 2NSHA 2WYVA 4WGGA 5E2AA 1RHMA 5HA5A 3D2BA 4DANA 2HA4A 3E82A 4KDRA 5DISB 1F0NA 2GOYA 2AOVA 3A10A 1EFRD 3FLMA 2WIAA 4Q1EA 4TV9F 1NC3A 1GAJA 3UWMA 3K6JA 2G6TA 2JI7A 2CXTA 2ZB2A 1IBRA 3JAWA 2LV8A 4M86A 4Q00A 2ZTVA 3GJTA 3NNDA 3SSMA 4YT2A 3G0GA 4P93A 3BAZA 2D0OB 2QTRA 1FJGB 3A4TA 4NF2A 4OJKA 3K1AA 3TIIA 5B6PA 4ZTZB 1Y3IA 2JLYA 1A04A 3SJBA 5KYTA 4LJ5A 1C9NA 1NVFA 1EGQA 2AR0A 3M33A 3DDNA 4TN5A 4O4JA 3MT8A 1AVTA 4DWJA 4OX9Y 1RYBA 1P7YA 3HJHA 3OZBA 4AG6A 2BN4A 4UNIA 1VE3A 4EKYA 5ADHA 2VJMB 4TTPA 2I2AA 1U9YA 3N6VA 1X7ZB 4BBZA 1YA8A 4YQFA 4R8SA 5CFPA 1TAQA 5K05A 5LD2B 4J9UE 4ZC8A 3U7HB 2XVMA 4G4GA 1QO0A 2LZ0A 2P4HX 3FN4A 3DAHA 4O33A 3UJCA 3RU3A 4EJ0A 1K6XA 4TTVA 5FV7A 3LQRA 3NV9A 1MTOA 1J22A 4YC7A 2EX4A 1EFCA 1RYFA 2Q99A 3EQZA 4U2GA 3UH0A 2FMFA 4DY6A 1W8IA 1ZJYA 2Q5OA 3PFIA 3RPEA 3D6NB 2YFQA 3VAZA 4BFVA 1X7WA 2PXXA 3U62A 1BCSB 1VPTA 3IC5A 4ZP1A 4DSTA 2XPCA 4FWTA 3NJ8A 2RH5A 3VZQA 1G8PA 3H11B 3UKOA 4EPWA 1ORDA 1I13A 3A0UA 5FWYB 1XJ0A 4UTVA 1XZMA 3BD7A 3UMSA 2FMTA 4X93A 1QH8A 3K09C 4D43A 2OTCA 2VXYA 5T4HA 1NXQA 3JWIA 3ZUPA 4UU1A 1TC2A 1VCNA 3ODPA 3WLFA 2PZ8A 2X0KA 3OZUA 4KSYA 1C1DA 1PJQA 2OCKA 1KEKA 4MHOA 4IDPA 3O4VA 4OX9B 1CRQA 1CLUA 3KJNA 3PDHA 1IM8A 2ZDQA 3K16A 4AD8A 4FYWA 1FTYA 4L27A 4LE0A 5KC9A 5DEIA 3AH8A 5I45A 2OSBA 3C8ZA 4YY3B 3NHBA 2ESRA 3GA0A 3WLNA 4HXGA 1T8TA 1PZHA 1WETA 1YZFA 4IHJB 3TGLA 4KO8A 4KRXA 4QECA 4IHJF 5LQDA 3TZQA 3VPHA 2JVKA 2B0CA 3B7PA 2E87A 3PCTA 1V16A 2Y6VA 4LA4A 4BJ6A 4FQ7A 1G1MA 4EA9A 5KTMA 4D56A 5FFNA 5B7NA 4JQCA 5EQJB 3WB2A 3CGWA 1P6XA 3OLXA 4XUGB 3B3FA 3I1FA 3U6KA 1RIIA 5DRYA 3VV3A 2SHKA 2JAPA 2VAVA 4IFEA 4WCVA 5D84A 2Z5LA 2Z4TA 3TLEA 4UHFA 2C78A 4YI3A 5L6MB 3L77A 2ZYRA 3JQFC 4INOA 1LQUA 4YJFB 3TFOA 3VR1A 4BEJA 4ZPXA 1MG0A 3LPCA 1P73A 3DZCA 3M6WA 4QJ5A 1I1QB 3PKIA 1NXTA 1FDOA 1XD9A 2R44A 1EP9A 5HNKA 2CYBA 2ZPTX 3EVTA 4M6WA 4U6NA 4N47A 3UAYA 3CT4A 4LDZA 4HB0A 4Z3DA 3DMTC 3WK5A 4AJ2A 2VH2A 3DW1X 2XBLA 1E0JA 3KAKA 4F21A 3FCOA 2VHZA 1I24A 5HSGA 3I64A 1XF9A 2J9RA 2WT8A 1NJ1A 2ID7A 4HZUB 4G01B 2ZYIA 3EWSA 3DO6A 2J3MA 1KI7A 4M1TA 4ENSA 1CUFA 1CS0B 3JSAA 3WBKA 1JVBA 3BE5A 3TPZA 5IC4A 1U7PA 5DI9A 2DY1A 1Y1PA 4BKPA 1PZMA 5HG0A 4NCAA 2YW9A 4REQA 3SDSA 3KLOA 1YK0A 1VDZA 1P4RA 2WVJA 3L84A 1P1HA 2DBZA 4S0ZA 3UMMA 5TQVA 2I4NA 5I7RA 4FMDF 1R1DA 3EIWA 3HB1A 1GRNA 1JYFA 4M7WA 3B36A 4JBXA 4V0NA 3T41A 4CCYB 4ZJPA 4GPBA 5B37A 4JLKA 3LOPA 2QZ4A 3L7KA 3QWAA 2CVFA 4JYCA 5DGDA 2NU8A 2WSLA 1YZVA 4D9JA 2OCAA 1XFDA 4TKZA 1T91A 5CB0A 3LBHA 1ZMRA 2YHIA 4O0MA 5ESXA 3BC1A 2A2ZA 3RTBA 1CEQA 2IE8A 3EAGA 4RLFA 3DMFA 4UJ3A 1W73A 1L4UA 3A6ZA 3AY0A 5JTTA 4L6IA 1ULAA 4QHTA 2X8AA 2HF8A 2ZVPX 1ARZA 4M0CA 4O08A 5E6RA 4V0ME 4F5ZA 5JSQA 3QP9A 2IQ5A 1GPKA 5KZMB 3Q9LA 5ELLA 3FB4A 3L4BC 4TV9A 3B1XA 3S44A 3WGTA 3D3QA 3GRCA 4HL6A 3WK7A 3ZWWA 2IS1A 3O8LA 4R6WA 1WY5A 4GC9A 2Y05A 1K7CA 4LHYA 3IUEA 2P2YA 3IB6A 4RAQA 2FPIA 5LP1A 1VP9A 2CVPA 2R5FA 2GM3A 2WI8A 3RRZA 1ISPA 1WY7A 1G3QA 3BJIC 2Y1OA 4MQUA 4OB8A 1MABA 3BMNB 2IOFK 4TS3A 2ZEJA 1BIFA 4FNAA 3ZWXA 1T5HX 2IFTA 5JEEA 2CUKA 3UJPA 1GPYA 4F9FA 1XDUA 1J7JA 3ZGLA 1GYPA 5THXA 1NN0A 1DLIA 3TO5A 5C8DA 4BNWA 3ZDRA 1D07A 3AFOA 5AR1A 5EXEA 2RHTA 4PS1A 3KPVA 3X0DA 3UHAA 1GU0A 1OMOA 1WXXA 3CW2A 4IDHA 4JVOA 5BXQC 2ODWA 4MRMA 1FF9A 5LXTA 4V3CA 3U5TA 1ZI8A 5EZSA 4JXKA 2N1MA 4OXQA 4XB1A 3GN1A 4JC5A 2V3CC 1KGSA 4ZVLA 3VSCA 5K6RA 3VYWA 4GLBA 1AUOA 2UYQA 3LDGA 4LRSB 1OPXA 1EE2A 1GNVA 1QPBA 4PYIA 1GZ7A 3I83A 2GBCA 4Q15A 1TM1E 2DBYA 3IVRA 4YRKA 2IP4A 2J5RA 5CXSA 1RS0A 3DOIA 1FS4A 3CPEA 2FWMX 4F3NA 3EA4A 3I6YA 2JJ1A 3BXEA 4JAVC 2P5TB 4BV8A 5IVPA 1E2MA 1NLFA 2PM8A 3DAFA 3OWXA 1PD1A 1FRZA 1RKVA 3SIWA 2R87A 1H85A 1W6RA 2WTMA 4W7SA 3UNXA 5J2TA 1PV4A 3ROZA 1U1GA 1E8NA 1ENOA 5JYEA 3PDJA 2QBYB 5D85A 4QPJC 4TYMA 4KU4A 2QPAA 4AZ0A 1Z9BA 3RFXA 2NV6A 2XB6A 4J9VA 5DHTA 1B42A 4G63A 1Z22A 4B82A 4Q12A 3PS9A 1XD2A 4TMWA 1Z7WA 1FB5A 3AVOA 4C0XA 3F5DA 4EPXA 2ZUWA 1F2VA 2CBXA 3UJBA 1PGJA 5JG7A 4EUNA 1R0XA 3U5ZB 3HA7A 2C4MA 3FHOA 4I55F 1BCRB 1Z16A 4H1WA 2Q9AA 3B89A 5EHZA 2OV3A 3ENZA 2RB5A 1X1AA 1OZGA 3C3BA 1OU0A 1I7DA 3E70C 4KK3A 5LNK1 2UUCB 3CXUA 1UKCA 4G5HA 5IAKA 3WNCA 5IS2A 2HWKA 1J07A 5TQJA 3RROA 2PLNA 2O7SA 4RGYA 2WLSA 1MXFA 2GFIA 2IPXA 4EB6A 2GEKA 4X3CA 4RKRA 4TTAA 3MXOA 4QRDA 3Q2IA 3RTAA 2Y8EA 3C45A 4IF6A 1F8YA 3UG6A 3V1LA 2GI4A 1FY2A 5DM60 1XA4A 5LQNA 3M89A 5AJXA 3Q3HA 3HMKA 3QMPA 4KX5A 4DMHA 4JROA 1A5BB 3HXKA 5EWJB 3GOHA 4KIGA 2GWHA 4D46A 4HLNA 1NDQA 3DMYA 5HEKA 4PLGA 3IIIA 2KW5A 4ABTA 5BWOA 2JCGA 4RJJA 2N75A 3G2NA 3S81A 1DCFA 2K2WA 1HYQA 2P1RA 2VYCA 3G13A 2FMKA 3BTVA 1I4EB 3HJAA 1O97C 3MXTA 5JLAA 1R15A 3FCXA 2DFDA 5E38A 3U40A 1QANA 2D5CA 1W49A 3PWSA 3KVNA 1Z2EA 3CLTD 2IELA 3Q6NA 5IARA 2VQDA 3IKVA 1SUPA 3BK7A 2FY8A 4A7PA 3WJ2A 1QWOA 1UBSB 2IC5A 2IHBA 3IUQA 1HRDA 2B20A 4IQ0A 4PSVA 1IZ9A 3OIUA 4IS2A 2Q6TA 4CV0A 2WU0A 1KQFA 2QAGB 5DV9A 1TVEA 3CNHA 1G7SA 1A4UA 2P67A 4GOKA 4QELA 2ZRNA 1CZNA 2Y1KA 4XQEA 4DIUA 4FGZA 3PD7A 4GEKA 3BKWA 3WV4A 4WLUA 4XFJA 4Q6WA 1OB5A 2G63A 1HNNA 3PA8A 5I51A 3UAXA 4NOMA 4FBGA 4KV9A 2G4LA 1RC1A 1ULHA 4GPAA 3S2GA 4RTMA 4KBGA 1G18A 3LOQA 4ZQFA 1GRRA 1AUQA 1V7QA 2XODA 3MINA 2W8ZA 5F1OA 3JD0A 1JJFA 4HLQB 5EHNA 5JEDA 3H3XA 5LQJA 1TJ5A 2NZ2A 3F2IA 3QEJA 4UU7A 4YYEA 1RWKA 1L7OA 1PEAA 1ZM3A 1QVZA 2WMOB 1PS9A 2I62A 5F76A 5G0SA 5CYPA 3KZVA 5JQWA 4K40A 1XXLA 2Z95A 2J6IA 1FJHA 3G89A 4XUCA 4I2VA 2ZETA 1GN8A 4JIGA 4LRXA 3SDBA 4A36A 2YFHA 4EKNB 1SHZA 2FNAA 1IFXA 1X1TA 2G5CA 3HJTA 4BZQA 4CM5A 1DLJA 1KMHB 2H2GA 3FFXA 3MGAA 2WIFA 3NNSA 1IH8A 1M0TA 5F1KA 3EULA 5IDYA 5IKOA 2QE7A 4BNIA 1RCFA 2ZSBA 3KPJA 4QGHA 3RSCA 4BCDA 3THXA 1UC5B 2KM1A 3NBKA 4JKOA 5REQA 1T9CA 3ZE7A 4MUYA 1Y6FA 2AE1A 3MJRA 1XDGA 2VTBB 1UZNA 3CO0S 1XDWA 3GZJA 1TVMA 4JX9A 3UPUA 3ANNA 4I1VA 5B1SA 3I32A 4AXBA 4KXMA 3IS3A 1VIAA 3ZWBA 3ETJA 1XD2B 2GCEA 1TCCA 4K9QA 3N2GB 1VBFA 1C8KA 4EDHA 4MKFA 2Q8PA 4CM8B 3V34A 2OCXA 3P1JA 1XTQA 2J3LA 4OOEA 5EIWA 5M3BA 3IT0A 4WJLA 2PWAA 3I6QA 1N36B 1F3LA 4LDQA 1RZUA 2VKTA 3AX6A 3DE0X 2AFHB 3S70A 3SX0A 5EPEA 3K6SA 2O52A 1IAVA 3PE6A 1UEJA 2CUZA 3ASUA 1Y8CA 1N5KA 4FEGA 4DPKA 5ECWA 1ND6A 1N9ZA 3H2GA 1OZ0A 4QDKA 1P77A 3N0XA 4LJLA 4F6RB 2YXBA 3LNCA 3DAPA 5CFQA 1PU2A 4L73A 5BR8B 1EAYA 2WD8A 3ZHSA 2V65A 4B0PA 1W30A 2F4NA 4ILKA 4YAUA 4ZZ3A 1YFKA 5J2TF 5DU2A 1Q22A 5J2UF 1PR6A 3QBVA 4EMTA 4YP6A 4X00A 4I50B 4RSMA 4XFKA 1GNRA 3MINB 4UM9D 1YAJA 1CRLA 2BMJA 5FXMA 2FYTA 1LH0A 1G0NA 1GPAA 1E3QA 3EMKA 1WQ1R 2PTHA 1IN4A 4QYXA 4NRDA 4K1LA 3JZIA 1P5ZB 1NN3A 3I8SA 1VLHA 3Q9NA 3TVYA 2XQJA 4C43A 4ZK6A 5KWJA 3M82A 3V7FA 3O84A 3N1UA 4RABA 4S05A 1U04A 1RQNA 1G19A 3WICA 1ACMA 1FLVA 3VH4A 3R5JA 1GLNA 2PGDA 4I55A 4UJ5A 4X20A 3GC6A 1QFJA 1HY3A 1CY8A 1MP0A 2YUTA 1JVSA 3D4LA 2IYQA 3M5CA 4FHGA 2HDWA 1EWKA 3B5EA 3JWJA 2O23A 4K9PA 3E3NA 4HTFA 5DSXA 1DNPA 4D5EA 4DDKA 4EG5A 2EYQA 1UC8A 3WVNA 1PLJA 4OGFA 4PAMA 4FHEA 2AZTA 3U7RA 1GSAA 4RK5A 1UKYA 2QTVB 2GHIA 1R50A 3T7KA 4NDAA 3QITA 4R7GA 4DQUA 1YBHA 4FCCA 1YR3A 3CKMA 3JYPA 4Y0VA 2VBFA 4WKOA 3W2GA 1N8NA 3N0WA 4QUHA 1AKTA 3PEUA 1E96A 4Q3OA 5FR1A 3UMRA 3VKUA 2GO1A 1QYRA 2GVZC 4I3HA 1N32B 2FFHA 2A3NA 2Q3HA 4AIIA 1N4DA 3GAFA 4ZOAA 1OT3A 4QRIA 4C4PA 1PZGA 3UVEA 4YT8A 2XUHA 4MWOA 1USIA 5EWMA 2HQOA 4F6CA 1SQFA 1YB7A 3UMBA 3QPWA 4BZXA 3BM5A 1PR2A 3R3HA 3ZGYA 3Q8MA 4OLFA 3PJRA 1P5HA 2CJWA 1ZVQA 1Z5WA 1L5FA 4MRSA 1OU4A 2RHRA 4J2OA 2R7NA 4B76A 2C88A 1AB6A 2P6PA 1VLVA 1VI6A 1WUTA 3E35A 3L4BA 5I9NA 5IBCA 1JS1X 3STVA 1QGZA 1KP3A 1R0CA 3KQQA 2I3AA 3HKDA 3HDQA 3KT0A 1T8PA 3IA2A 1MJNA 1XVLA 4JT2A 2CN1A 3Q1LA 1TYDE 2O2IA 1PT8A 4M76B 4PFJA 4EFMA 1NYQA 4FBLA 4EPYA 1WO8A 4ED9A 1M34A 1UFQA 1VDMA 3B60A 3F9IA 4QPNA 1E79D 1JDPA 3CNNA 3F6CA 3C6KA 4LEIA 4M9SA 4E6PA 1GUYA 4RLHA 1LU9A 1G5RA 1C3LA 2H92A 2IHUA 1SUBA 3D5EA 4B8WA 1SC6A 1LPPA 3KDPA 3AVWA 1QP8A 2DAPA 2RGUA 2G36A 3FCUB 1N5JA 4EQZA 2XQGA 4B3HA 5KVSA 1Z0FA 5DYWA 4KOAA 4UZFA 1T8UA 2FEWB 3TOSA 5KTTA 4QBFA 4YYZA 1MIOB 1SR8A 3AEKB 3MCZA 3AT1A 1GEEA 1E0AA 2QTVA 4FMDB 2XCIA 3UYKA 1W9HA 2BI4A 5ADWA 4L8FA 3OQVA 2M6RA 4XKJA 4Q16A 4Y67A 1KI8A 5ALSA 2X1HA 1KP2A 2PNJA 2F48A 5CLHA 3SVTA 4N0QA 2ZYVX 4JEMA 5G4LA 4U7DA 4EA6A 1TKCA 4EMBA 3G88A 3CF0A 3RCBA 4D2IA 4Q4AA 1WAMA 2OM6A 4I1YA 2O8BA 1ZEMA 1NW3A 1SVMA 2JFNA 3DPUA 3PVSA 1A7KA 4H7FA 3TYXA 2BDTA 3CZ4A 1YVPA 3I3SR 1BVRA 2QB5A 3CRVA 3IAAA 4GKVA 3NPMA 4NWIA 5C1DA 4GX5A 4QU9A 1C29B 4LKRA 2C1ZA 3V3KA 4XPIB 1KDOA 4CKCB 4YH1A 2C59A 3ILHA 4RSGA 2UZ4A 1XWIA 1KDPA 1NVKA 2PUWA 5EKUA 4N8EA 1FYXA 2EEPA 3K1TA 5SYNA 4HFJA 5HF6A 4OTZA 1A3CA 4ME6A 1SM4A 4Q1DA 5IC6A 3W5CA 4HDAA 5FKJA 3EPLA 4WOKA 1JKMA 3OF5A 2GN4A 1PR4A 4R1UA 4HBGA 2YJNA 1DG9A 3CV3A 3HEAA 3A6EA 1Q0QA 3QYAA 3UK6A 3HSSA 3GDGA 4F2WA 4EVSA 1VHDA 4TMYA 1WZ2A 1MABB 2EP8A 3R4CA 2O5RA 4LGCA 4AU1A 3PUZA 5B6IA 4IZIA 1X8XA 3GJ0A 3P9SA 5K6AC 5JJKA 4OA8A 4OP1A 1L7PA 3OJXA 1CUIA 3QWFA 4AKGA 2P9EA 5THQA 1ZVKA 2GEDA 3A27A 3PJEA 4WQMA 2QRLA 2WC1A 5C0OE 5LQUA 3FOWA 4HNSA 5AJYA 3VTKA 5JSUA 2AF3C 2FLVA 4L4ZA 1XZ8A 3MJCA 1YOVB 1KP9A 5CU7A 3WMFA 4BNJA 5KYXA 4MUKA 2TS1A 3PDIB 3OJCA 4OL9A 4B84A 2XITA 4RLSA 3HK2A 5I7AA 1EK2A 5E1DA 1LSOA 3IBFA 3IBSA 3K8ZA 2I4IA 4JL5A 4FEYA 3B1ZA 1ZLXA 5FNVB 3L9XA 4CKYA 3PTLA 3SC6A 2POCA 3HB4X 1NATA 3CBGA 3CQ9A 3MCVA 4LBVA 1QQBA 4EP1A 1UXGA 2NU8B 2Z8ZA 4GMDA 4BFTA 1XJWA 1I51A 1WWKA 3PC3A 4Q3LA 4RJ2A 3WLMA 4UEJA 2A58A 2L42A 1KYTA 4RHEA 1DDIA 1JBKA 5E6SA 2D06A 1TAGA 3AQIA 3OJLA 1MHTA 1YR1A 2VJLA 1FMLA 4AICA 1ZWKA 4URZR 4O29A 2GPWA 2WJVA 2AN9A 3GY0A 5KKCA 1XWFA 2VXOA 2AX4A 4IOKA 2P2NA 1M7BA 4KRFA 4U63A 5CX1B 3T3EA 3U9SA 4IGAA 4HUTA 1XTZA 1OFHA 4C4XA 4E5DA 2JLRA 4L74A 2AE2A 1YU6A 1GYQA 2XGSA 1HM5A 1QXSA 4WCFC 1U9IA 2R2GA 3TSWA 5LIPA 3CPHA 3ES9A 2RG1A 4QUEA 1W19A 3UCXA 2NPOA 4E5PA 5BQXA 3EVDA 2X3FA 3FYUC 4MYHA 1UJNA 1GUZA 1V1MA 1XZAA 1YUBA 1PTJA 3SLRA 1E2UA 3KOWA 3SS7X 3CZQA 3IOBA 5L45A 3EHEA 2XOKD 3KWMA 2I3GA 4YP9A 5ENZA 2VHTA 1LWOA 4ZEWA 4KTTE 1LCIA 1S5PA 4EW1A 1S6YA 1QK3A 4Q37A 2XX3A 3QU2A 4ZQBA 5EEHA 2CL0X 4DT1A 4HAUA 5SY9A 2EIXA 3CRZA 3E5HA 3IT3A 2DWUA 5AK4A 3BWDD 1JFFA 2SICE 5DCUA 3RT1A 5EJMA 1I4OA 3JALA 3HBNA 4M1EA 3FPAA 5JZ9A 1P74A 2UZ3A 4RVHA 4ZHSA 1E60A 1T5TA 2BTEA 5H3LA 4I08A 5JAUA 5DFAA 4Z3OA 2C94A 1BWSA 4FU0A 1TK2A 1ZOPA 1VSBA 2ZYAA 4EQ6A 4O02B 4RHTA 1VPDA 3E5NA 5E7QA 5BV0A 1DADA 1EBBA 2PUEA 4FI3F 1KTVA 2Y2UA 1ZGGA 4QDJA 5JWRA 2C2YA 4IGKA 4YALA 3G68A 3Q6MA 4Q4HA 4WASA 2ACWA 3PZBA 1KQPA 3IULA 1A2KC 5FHQA 5HFJA 3P2EA 3PCXA 3CYFA 3FDZA 5KNBH 4UNPA 1XDSA 3FYTA 1LXCA 3EW7A 3HBLA 4JS0A 4L15A 4UEKA 4JUIA 3ONFA 3EBPA 4NXNB 1QGUB 2CMHA 2PMBA 3OOWA 3ZBPA 2O5EA 2DWQA 2KLHA 1CY0A 4LPKA 4I6JA 4B3TB 2K5UA 3UW1A 2F4VB 3TNLA 3K9FC 3T1OA 2VUIB 3F6SA 1YDMA 3RRBA 2VQ3A 3LPLA 1L7NA 3QNUA 4QO8A 1NE7A 2GSWA 4G26A 2ZXFA 2X22A 3V8EA 1ECCA 4W5OA 5MHTA 3AUTA 3GD5A 4DV0B 3IPAA 4AF7A 3NT4A 1NF9A 4R81A 3H11A 1GVNB 2RGAA 2QA5A 4KR7A 1CR2A 3SR4A 4PYKA 1KQ3A 2CLIB 1WUKS 4J6EA 2I8AA 3V2IA 3VC7A 3COPA 5DX8A 1ZITA 3OPNA 4QLAA 5KDOA 10MHA 2YYSA 1P45A 1BTOA 3PHIA 4FYYA 1VC2A 2EGUA 3A06A 3AESB 4ALNA 4P34A 4M88A 1BH2A 1XZLA 3PXGA 3BMQB 3AU8A 2XT0A 1QCCA 2W2TA 2CNOA 2QZZA 3KU1A 2CLCX 2IYLD 3NDPA 3R77A 4LJSA 4LOKA 5LA6A 4IOJA 4Y1RA 3RS0A 3F7MA 1L4FA 2KQUA 2ZRCA 2CJFA 2H1VA 4JVLA 1Q5PA 1XVTA 3VZCA 3HHEA 4LSMA 5BY2A 2X19A 3QKWA 3T3GA 3UC5A 4ZYXA 2R6AA 2HSGA 4D0RA 5BVHB 4RL6A 1M1ZA 3TTWA 3PR3A 5TR9A 2IDMA 4J0DA 3VR6H 3CR7A 1GNPA 5DHAA 3ZY3A 2FZ5A 5JQGB 2HRDA 2OXFA 4EG8A 3RU2A 4CRWB 2OHIA 2YY5A 4IEFB 2WP0A 4FOTA 1JIXA 2A33A 2CXRA 1TD1A 3GB9A 1MRSA 1QB7A 1TTHA 2DULA 4J4TA 3LLUA 5EPUA 1J2JA 1K2VN 2HQ1A 3GBVA 2W2NA 1VE5A 2UZAA 5JNLA 1IVYA 1CE8A 4RV9A 2VLBA 1E7RA 2E6UX 2XWQA 4HSGA 5I47A 3JVUA 4ND2A 1QRSA 4JFRA 4EA7A 2O8FB 5CURA 3D64A 3DZJA 3U3JA 4AVYA 3ZHUA 2I1VB 5IKEA 3WLAA 1DAHA 2W2XA 4ZQHA 3TIFA 4CR6A 3D4PA 5IHPA 2QLLA 3MMNA 4KZPA 1EDOA 1E77A 2C9MA 2ZWIA 1YIOA 2GQ0A 2HEGA 3AKEA 2NSYA 3NU1A 3QY0A 5EIFA 3T4EA 3LL4A 1XTRA 4I81A 3GUCA 3TDKA 4PN3A 4MVCA 2JDID 1YA6A 1O94A 4R6XA 2ZJ3A 1JEYB 1CJUC 1XLTA 1DOZA 2C4WA 2OBFA 5KYYB 1HEYA 4M83A 1W36C 4EZIA 1HTBA 1RYHA 3EISA 2ZB8A 2X8JB 4LF9B 4EW3A 3IDSA 3EUFA 3GJ8A 4YQYA 1C9YA 5GIPE 4AQ7A 2VTDA 2G25A 5CYFA 1Q20A 3AV3A 1OKKD 1BVUA 2W6ZA 2BMWA 2LDXA 5ILGA 2DHCA 4F3YA 5EP4A 3G85A 4LY3A 4EUSA 1EXVA 3TTYA 2NTEA 3LUAA 1ITZA 4OOFA 3U48A 1DI0A 3EXEB 2OHOA 2BGUA 3G0OA 4NPCA 2JH9A 3CX4A 5F78A 1GQFA 3I30X 4D8TA 2FW0A 2J7PD 5BVHA 4ZCPA 1A9XA 1FTGA 2I22A 1HWYA 1NKVA 1XZKA 4IWXA 2IEBA 4FSDA 5FWDA 1FP6A 2HHHB 2J45A 3BE8A 4IXWA 5K8TA 1GO2A 5LA6B 1KAOA 1US8B 4QUIA 4K0KB 5CBPB 1J06A 4U3JA 1DIGA 1ZKDA 2AFIA 3GMTA 3H1TA 2WM2A 4NFHA 1T4CB 4I7EA 1Q0TA 1G3MA 4XQ0A 5LPNA 1TT5B 1PGPA 3ICOA 1KZHA 3VC3A 5CFZA 4AJLA 2PVSA 5FRDA 3S5UA 4BGEA 5A62A 3LT5A 2MSCB 1JG3A 3FMGA 5FDFA 2PANA 1QMGA 1M3SA 4MQEA 3AB3A 3HN2A 1PHRA 1ODFA 1ZINA 3K6KA 4B81A 2GYYA 2OV6A 3PFKA 3NHFA 6PFKA 1JA0A 4DJJA 3TVDA 1R10A 4MQFB 1BGXT 1L8OA 4ZU1X 2UUBB 4DDTA 3GFGA 4ACBA 2QXTA 3BZUA 3DMNA 4WUVA 1MVNA 4JLBA 2PO5A 3D4IA 2IYNA 5IMSA 3LUCA 1OBVA 1T2AA 3GIWA 1CJTC 4C3ZA 13PKA 2UVQA 2J4CA 3BTUA 4MR7B 1X8KA 1ESDA 2OLEA 1NDUA 3NRJA 1CKEA 1ENYA 4N39A 4URFA 4PNPA 1Z17A 4YCJA 3T1TA 1HNWB 3DBOB 1HURA 2VZ8A 4XX0A 2B3DA 3ETHA 3K2BA 4LC9A 1QLHA 2CYCA 2ZJ8A 5I7SA 2BV3A 4DC1A 4TL6A 4DMKA 4L4RA 2HIHA 4RDIA 1I5RA 4PGHA 1LPAB 2FRVA 1P4GA 1PJ4A 2FEPA 1PR0A 4JEHA 2RGBA 4KI0A 5BO5A 1FL9A 3T7TA 3LUHA 1CCWA 3PCRB 4M1MA 4DIMA 1PK9A 2CF6A 1GPUA 1GSOA 3N8HA 2F6RA 1L5MA 2COKA 4GSYA 1PR9A 1JSRA 5B57C 3LS2A 1YR8A 3E15A 3E9MA 2XOKA 1W93A 3FZNA 3CZ9A 4HXYA 2IUSA 3CMMA 2O8VA 1Z82A 1JEAA 1RQPA 3KLNA 4HEJA 1YZGA 2WVAA 5AW4A 2RHOA 4QOSA 1UQUA 4Q3AA 3ADCA 1HE3A 2R1TB 5C1BA 2VUTA 1Q1BA 1MNQA 4YAEA 4ZO9A 4MWDA 3WBJA 3ZK7A 4N5NA 1MB3A 5CG1A 3Q98A 3HWSA 1D04A 1K8ZB 4JSRA 1SG6A 2Y2VA 2B99A 2VOJA 4GT1A 3E6AA 4TZTA 4F7DA 1TB4A 3ROQA 1UKVY 1H6CA 4YUWA 3OE1A 3G02A 2XRFA 1TZCA 1SU8A 2MJLA 3QEKA 3FTPA 4IMPA 5TMEA 2PV0A 3TGWA 1CR1A 5CA0F 1MRNA 3L6CA 3FPLA 1RYDA 1Y89A 2LKDA 2P1DA 3AXSA 5DTRA 3VR0A 2V45A 1SRRA 2VCEA 3M6AA 1XCJA 3IALA 2IYOA 4PLHA 4Y30A 5K0FA 2O6HA 3SR3A 2JZNA 5K4AA 4EY7A 4NX2A 2BBWA 3EXHC 3TKAA 5AI0A 3ZJ4A 4OB6A 4YP1A 3QE3A 5ICSA 4N4AA 1YJXA 4LDRA 2J3KA 3TX6A 1E9VA 3JZMA 1MFZA 3N0VA 3L40A 4N03A 1Z13A 3PUIA 4QPZA 3QLTA 3SXPA 1H3NA 4MDEA 1U0NA 2I8CA 1Q95A 1YL6A 2HPHA 1FTQA 1DQPA 1BC5A 4CG2A 1JEOA 3CKLA 4ZCRA 5LZ4A 3J81A 2RC6A 5LN1A 1GLGA 2R5WA 4GXNA 1RI4A 1GLVA 4H7HA 5KU1A 3HYTA 4OVKA 3NR2A 4QXOA 4TM8A 5BURA 2QT9A 1LV8A 5JZBA 2QMZA 2YVLA 4G4JA 4HAOA 1JHPA 2IYEA 4ZMRA 1RDFA 2P78A 5AQ1A 1XCOA 2A9QA 3W8EA 2CFTA 2PKXA 4D8UA 3K5WA 1WV1A 2P5SA 3OU6A 2UVPA 3LY5A 4KR9A 1W5EA 1NX6A 1HDXA 1DRWA 2CJPA 4F3TA 2DSTA 1ESEA 3LPNA 4P4TA 4P81A 4WMLA 5HE8A 1YOBA 1YS4A 1DBIA 3C4VA 2ZITA 3TSAA 3VMMA 2FG7C 1OIXA 2WJPA 2ZLBA 1JQBA 1VKOA 2BFFB 4K6GA 2BP7A 3UCEA 3GFBA 3RVRA 2ZSFA 3VSEA 3KV1A 3QKRB 4PQRA 3ZLTA 1PT6A 4BUCA 4UQLA 5C9ZA 4LF4B 3QF4A 2QX9A 5LMZA 2QLJA 2FDRA 3JQDA 4YRPA 1C1XB 2VK4A 4FCWA 3ACBA 3R6LA 4HH0A 1PJCA 4YRQA 3IEMA 2ADFA 1CXZA 4FSXA 1OXBB 1P44A 1OWOA 2Y66A 4AKEA 4C2BA 3FRIA 4LHEA 1YZYA 5CX4A 5CT6A 3UMCA 2ROQA 3N5KA 4YRAA 5LQKA 3IQIX 4UPEA 5HKKA 3OJEA 4QLOA 5G1OA 4G1UC 1HE5A 3MD0A 3O1HB 4US1R 1ZM4A 5IP5A 4YRIA 1QVWA 3LDAA 2DSNA 3TPCA 2LBPA 1O8CA 1USWA 3GNSA 4L0QA 2JB9A 2QT1A 4HH4A 5F73A 3BILA 3VC1A 2XA9A 4BRUA 3MPUA 1Z4OA 3GLFA 1W0JD 4MWEA 4LK2A 4RZUA 1AK2A 1PR3A 3RR2A 4EZEA 1CY2A 1RP7A 4G0MA 3O8BA 3FOCA 5ERXA 1NXWA 3T12A 2NUTA 4FNGA 1V43A 3LZDA 1YWGO 2VQ6A 1XROA 4S35A 3WDLA 1T6BY 2ZUFA 5KOJB 4EEKA 2JLZA 1Y7HA 3LE8A 4BO2A 1MNAA 2DWCA 4M0LA 1WZCA 3V8BA 2M2IA 1SB9A 3AZQA 3HVJA 1ZCBA 2ZUBA 1NKTA 1VBNA 2QYHA 5TGTA 4GOXA 1JLKA 2ZRIA 3DEKA 1NMEA 1AD2A 4OYHA 2IHYA 4PAQA 3SF8B 4DDVA 1TQ4A 2VP3A 5CNJA 4J7UA 1L7VC 4ZAGA 2GJAA 3IAXA 3L06A 3FVQA 1TVKA 3RC3A 2XKJE 2H59A 3A1EA 3R6TA 1J5EB 2NU9A 1NBOA 5LYJF 1PZXA 3OSUA 1M34B 1E2KA 8ADHA 5M29A 1CF4A 2PUAA 3NWBA 4CMHA 2VJNA 5LL6P 4DM3A 1Y48E 4NNJA 5FUBA 2XD9A 2HGSA 4QNMA 3RJ5A 4H4CA 3ZV7A 4C4RA 5AW2A 5PNTA 5SZHB 3NRBA 1L7QA 1KZ7B 2HN9A 4MK4A 1V2GA 4RF5A 3DZ8A 1UWCA 4QGBA 1DEXA 4O2AA 4FLEA 1CRZA 4ZVNA 2AG1A 1N2GA 2HCTA 2JD0A 1BGWA 2Z5GA 3T1HB 3ZDCA 1LBEA 3LPDA 4CMKA 2VYFA 1L4GA 4FILA 3NS7A 1SBNE 4XIJA 3N2YA 1JQ5A 5EGNA 1T5SA 3VR3A 4C4SA 1JMVA 1NXSA 4YXFA 4DR7B 1GHTA 2GZ2A 5BWMA 1SXHA 1YGPA 2XDQA 3LVFO 2I91A 2EGHA 1Q1AA 2J3EA 1JBEA 3U17A 3D8NA 5BR7A 3ZXUB 4OYLA 3UJ9A 1DGQA 4IOLA 2CV2A 4QDUA 4Q7EA 1IL0A 5D6OA 4BBPA 1EUDB 1QCZA 3NW9A 3JVIA 2QRZA 4N0DA 4BU1A 2JBAB 1K6JA 4QG3A 4NU8X 2PCLA 5REQB 4BLOA 1H9BA 3E3AA 1U5CA 4R16A 4UCFA 2C77A 3WAJA 2G4CA 4UC0A 2JHAA 1QF6A 2J3QA 1PNTA 1T9KA 1SN7A 1G5FA 2I34A 3FVRA 2Z04A 1ZUD1 3AUJB 4JA0A 2Q2VA 3E2MA 4HTFB 4QNRA 4C0KA 1SOMA 4MWCA 1NQAO 5FQOA 4YR9A 1COWD 1ZRHA 2OUKA 4I1IA 2QTFA 1H65A 1WKVA 2VATA 2ET6A 3DLAA 3LFHA 4MS3A 4YRTA 5DEOA 4BNNA 1YGYA 2A4KA 4MV1A 3T3NA 2GFHA 1KSGA 4JIMA 1PZNA 3W9SA 1XTUA 1ZCZA 4QM7A 3GJ5A 5KINB 1VJGA 1M83A 1SQSA 2FPSA 1HEUA 1NJGA 4POOA 1LPBB 2ZSDA 3BWMA 2IRWA 3K2QA 3DDOA 2H1IA 1SFRA 3K1YA 4GSLA 3G0CA 5HK8A 2DX7A 4JI1B 4R2WA 2BFEA 2K2QB 2XKKA 3KJGA 3IHTA 1YR2A 4IDNA 4XYLA 5HJ5A 2ZIZA 5KVAA 1IAQA 4EJSB 1JE0A 1KI6B 1WW2A 2EX0A 2IZ5A 2ZGVA 3FNIA 2NACA 4BVFA 2X15A 3BPSA 2AK2A 1UPUA 4Y1RB 3KB6A 4B6EA 3B2QA 2QL5A 3EA0A 4LCJA 5DNVA 2X5XA 3A9UA 3P2YA 1FBTA 3B6JA 3D2LA 1QFMA 2FZVA 2VJCA 1AGYA 1OA1A 2P0AA 2ZRFA 1U9JA 3OE7D 4FZ3A 3WLKX 1FDWA 2FF7A 4DJAA 4DB2A 1T6NA 2XJ9A 4M4SA 2GVNA 4EGFA 3THYB 1SBQA 3RFUA 4YAOA 4B4DA 2AOUB 4YJ2A 3IBYA 1VSQA 1T9GS 4HAVA 3RD5A 2BKLA 2FX5A 2PNFA 2F1RA 3DNMA 1DKNA 1R6DA 2ILVA 5AOVA 3M7IA 4IZHA 3PZRA 3P0FA 3DS8A 2D0IA 4F4IA 4MZXA 2L69A 5IM5A 3A7DA 2JA2A 4P08A 5BYBA 3YASA 4KFCA 3AEUA 4GBMA 5IYZF 2JCXA 3B78A 4BX9A 2HNBA 3HO6A 1MVOA 2P65A 1HL3A 1Y7IA 2GPNA 4TRRA 5IRCD 2EW8A 1IWPB 2IYZA 1FFWA 1UJ6A 1NF2A 3GYGA 1WHSB 4R3NA 3FWNA 4Q4DA 4F8YA 5KQSA 5TMPA 4MR7A 3VPDA 3Q7RA 2FPXA 5JS8A 3GUYA 3M4JA 1Q1NA 1U1EA 3OJFA 2BFBA 1RHRA 3PPYA 4RVCA 3ZE2B 1U2GA 2PL1A 3T9AA 4LTNA 5T57A 1KQNA 7REQA 1G59A 3RS9A 2AZ4A 1YRLA 3FGZA 3DEJA 3KQOA 3LCJA 3OF2A 4CL3A 3NJ4A 5GZ1A 2ZJ4A 3V8QA 3MMPA 1OJ7A 2X4DA 1Y5LA 3KVYA 4GBED 2EVWX 5GMOA 3GHHA 4MW0A 4V0KA 1SVUA 2QY6A 1NRXA 3L0ZA 4NAUA 4GL2A 4ON9A 2B2NA 2NU6B 4MXDA 3A58B 3HZZA 1XF1A 3ZYCA 1E3LA 3MOSA 5IPFA 1R4ZA 1GTRA 1KK0A 2B2CA 5ITZB 3DD1A 4UAJA 4FFOA 3AI1A 3M0EA 4JCCA 3OLZA 2R7LA 3DFZA 1KU6A 1Z5OA 2A59A 4RV5A 1YVUA 4KYTA 5D87A 4WZBA 1R9MA 2NVWA 3QENA 1MC8A 3D0OA 4PO1A 3PA6A 3UV3A 1CUZA 4EOGA 4M0MA 3K0AA 5LBTA 1KI6A 1W0KA 4BASA 3WWYA 3BRSA 1EX1A 3ZKAA 3IP5A 2RGDA 4PHGA 1Z2DA 3TD2A 1U0HC 4JT4A 3U1BA 1KJYA 1ZX1A 3A4VA 3G5MA 2XLBA 4MAAA 1Z73A 3IQXA 1NUQA 2QN1A 1IJFA 1ZGBA 4F46A 3H1BA 3IAFA 3NIFB 3UJ6A 4I36A 2NIPA 2FPGB 4AN4A 1B41A 4KPYA 1C2YA 1ECLA 4HUQA 3F5MA 3IV7A 4XGRA 1FW6A 1Q84A 2WZBA 5ALPA 1PSDA 3C3YA 4ZVVA 1R0WA 4YAWA 2XMQA 1KFEB 3TNJA 3SC4A 3ZZUA 5CH5A 5HFNA 4ZFNA 4URVR 3O4IA 1ND5A 2J59A 2WJAA 4MVJD 3FWKA 1YXMA 2OHJA 1OXVA 4UE6A 4BU0A 4A15A 4G0WA 1FFAA 1Z08A 3WHKA 4LXYA 4X7RA 3RV4A 3DL2A 3VJRA 1WHSA 3N2IA 3EVBA 5BR1A 2WJZB 1RYMA 1I94B 3RG2A 2FUKA 2C95A 2CZQA 3ESXA 4RVGA 2Z9DA 2FG6C 2P6MA 4YP5A 4BKRA 2V9ZA 3CNBA 3GUVA 3MWDA 3Q72A 4ZAYA 3WLOA 1E2EA 1LJUA 1TFUA 3D4NA 4HDKB 4CMIA 2CHVA 3LBIA 3ORSA 4IRMA 5EMNA 3NHSA 2HA5A 5E3JA 5FOXA 5HW0A 2UYHA 2CDRA 1FSGA 1NBMA 1N6KA 2JGEA 3OLCX 1PG5A 2HNKA 3VR4H 2J0QA 1EJ6A 3E2IA 1HTTA 2P1ZA 1SURA 3TSYA 1NG1A 4ZV4A 3JQGB 4JHLA 1YQXA 4CNQA 3HADA 1YULA 2E55A 1JYEA 3VJKA 4D79A 4JUFA 1QU3A 5CNKA 3V4LA 3COJA 1C3OA 4P7JA 1T0BA 1RJFA 1RACA 1PCXA 3N86A 1HYGA 4NBNA 4HQLA 2ENWA 2WD7B 3FDIA 3IESA 3WL5A 4CM1A 3AC0A 1R18A 2QLTA 5K4GA 1CWUA 3Q8LA 4FEAA 1KNQA 1UH5A 2HDHA 1KYIA 1PEKE 5GQSA 2UUPA 4PLYA 4BNYA 4DCGA 5FPQA 5C5IA 4LXTA 2WIBA 4AZWA 2BGLA 4P5PA 1NT4A 5JCPA 4LNAA 4PE5B 3GLGB 3LO8A 2QPLA 1O58A 1X70A 1ZM7A 3K96A 3ZH9B 1U7XA 1VXRA 4YMLA 3PQ4A 3LK6A 2O0LA 4J4BA 3OC0A 1V0JA 3I34X 1U9CA 1V4VA 1TUIA 1E9AA 4TRNA 4A6XA 3LQKA 1EWVA 3TEMA 1NV9A 4N54A 3R7FA 1WB4A 3GLHB 3FHTA 4U7JA 4AS2A 5AIBA 3NWJA 2G1JA 3N05A 4GOND 4DFDA 4DQVA 4GDFA 2WPDD 4ZOLF 3MG9A 1DCTA 1G42A 3QWBA 2J9FA 5K0NA 2RCYA 1LSUA 3KM0A 4GP7A 4HLUA 1OV4A 4ZOBA 3E7XA 1Y3CE 4WFKA 5HJ2A 2R68A 3LJKA 3NBMA 2W58A 4TKMA 3SD7A 4WAUA 4KFTA 3RTGA 4IS3A 2JFGA 2ALJA 2LCFA 1FSPA 5F2EA 1HZZA 5JNTA 2GRAA 3DBRA 3AERB 4TS1A 4BO7A 2P5YA 1ZUHA 3A70A 3IEXA 4ARZA 2P2GA 1O0BA 4KLAA 5CMLA 1Z4IA 5EXDA 1V45E 3OFKA 4GX2A 4DBVO 4MCJA 1M7GA 2RARA 3EIOA 2NXNA 6AT1A 4TQGA 1W0JA 4TL8A 5LVAA 5TMBA 2XCRB 3T3OA 2ZSIA 1NUTA 4W9RA 2O2JA 5AJHA 2ODEA 3VKFA 4NPHA 1BRMA 1DJLA 1W85A 5EJGA 3TZBA 4JLNA 1K5GA 1JZTA 2ZAIA 3RUPA 1EK6A 4OSOA 3UENA 1HE2A 2I76A 1FUEA 2X7XA 3H2HA 1JG1A 1YC5A 2QX8A 1E79A 2WTXA 2D2FA 2XE7A 2PHZA 2ZFUA 1T9ZA 4GVLA 4L8LA 1N8SA 1QIFA 4N5DA 3H4VA 3TUZC 1EZ1A 4OI2A 4XAQA 3MMSA 4MP8A 1UXOA 5AI6A 5I6DA 1GYRA 1UWKA 3LWNA 3E7WA 4FTWA 5IEJA 5JO0A 4NU5A 3ZGVA 2MMGA 5LU8A 2ETVA 4BQPA 4UAUA 1KO1A 3IYLW 1TUEA 4PTLA 1DQNA 2AI1A 3ORYA 1N7IA 3KYCB 3HUTA 3F1LA 1B0ZA 1CK4A 1EP2B 4DMCA 1MV5A 4OXRA 5IM4A 2FGKA 3IJEB 2W90A 3W3ZB 4X7PA 5T3UA 4IKOA 4MULA 4MVJP 3N7TA 1KMCA 2OK8A 2WYIA 4FPXA 4JSYA 2ORVA 2CLMB 3QUBA 4LOLA 4QUGA 4WD3A 5K0LA 5FTKA 5CDUA 1TYZA 4RZ3A 4Z0PA 3RO7A 1FE8A 5KCMA 1QPZA 2GH1A 1XR3A 4JENA 2R8PA 5C8VA 4FOOA 4PC3A 5DT9A 2AOWA 3VXKA 3ZCRA 1TQDA 2REQB 1N6NA 1G6HA 4ZVKA 5F23A 4JV5B 1HORA 4ENPA 2HHCA 2DTDA 4J94A 1J7KA 1CS0A 1S3SA 1JE1A 1W2HA 3U9TA 1XK6A 4PLCA 1J97A 1QHFA 3KQTA 1LJ8A 2BDEA 5D7NA 2YS6A 1W2GA 4RC9A 2NVOA 4QBIA 5FPSA 3NOXA 3HXOA 1N5RA 4AZVA 3PXCX 4H18A 1SEPA 3AJEA 5FL7D 3AI3A 4KEAA 3VSDA 4I9UA 3F7NA 4IDDA 3MS7A 4CV1A 3FFTA 2IP2A 2Q28A 2FSGA 3OQJA 4YMUA 3U7FB 3CLVA 4L0MA 1XHLA 1ZIOA 3EFEA 1E5QA 1OX6A 2PZMA 2CSUA 3DFFA 3G9QA 3N07A 1ZXXA 4I6EA 4C5AA 3O31A 3QPCA 1ZQ1A 2AB0A 3CX3A 5BWLA 1SBHA 3VDXA 1U3FA 4KO4S 2DECA 4DV6B 3NHZA 3OFVA 1KFJB 4KHPB 1YOVA 1X7DA 1Z39A 4IDBA 2JJYA 5KYXB 1ESNA 2ZIAA 2FWAA 5IAGA 2B94A 3KYJB 5BN3A 3PQ5A 4OKSA 1N1GA 4L4UA 1QG2A 3VNRA 1HGXA 4PC2A 2QD5A 5FWNA 1DL5A 1O03A 4WUTA 1XVUA 5FBWB 1JRLA 4JLWA 3WA7A 1S01A 5I8PA 1XTTA 1RE0A 3PNOA 2NQTA 1HQCA 3BF7A 5JO9A 5KOHB 4AS3A 1F6WA 3RYCB 2O8DB 1W75A 1AU9A 3IEIA 4Z9BA 3VYSB 5BN3B 4JWTA 2ZRAA 2IIBA 1ICEA 1X1QA 3O47A 3F5FA 4BZPA 3H9QA 1EX6A 1RQLA 4HD8A 2HL6A 3FWZA 3DO8A 3IURA 3QPBA 4MKHA 5LR6A 1R4MA 4ZAZA 3H04A 1V71A 2O2GA 4BMSA 2HR1A 2Z1NA 4Y2UA 4JQOA 1QONA 4XWOA 4JU9A 2DFPA 2OMKA 1ZOLA 2FR8A 1MOZA 3OZTA 1OI4A 2MWMA 1XK7A 3A1DA 2GYUA 2Q3FA 4INPA 4AMBA 4JZYA 3TI9A 3WIDA 2AOTB 1RYZA 3DLHA 1U8UA 4IH9A 4ND5A 4Q3CA 4TWJA 5DTMA 3ZDAA 1Z5VA 3CX7A 3PGKA 1NL3A 4X6XA 3RF7A 1KMMA 1XB2A 3OAAD 1J42A 4IIJB 3A1UA 5DVZA 5B4TA 2J41A 1IJKA 4PYOA 1ONNA 1UJ4A 2HMTA 2WFMA 3CX8A 3QFCA 4ROTA 3RUIA 1HF3A 1BYUA 4PHCA 4BJHB 1L5WA 3F73A 1DE0A 1JSZA 2BCEA 3ZDBA 2QNIA 3U16A 3SQXA 1Y8QA 3GA7A 1V35A 4UXIA 4U5QA 1DKUA 1X1BA 5DHRA 2EFGA 1A9RA 3K1JA 2ZWAA 1BQEA 3QXSA 2XF8A 5I8ZA 5JD5A 1T8RA 2GCPA 2R47A 4YAJA 4BQQA 1W4CA 3PG5A 4N5IX 4PGAA 3D81A 3F4LA 3NH9A 4MI6A 3Q7SA 4YXWA 5FX2A 4C7OA 2GZRA 4I5EA 3QKTA 4LGYA 2VSYA 4FN4A 3RJ9A 2JJ2D 1M72A 3HCWA 1SZCA 3GPCA 4Q1AA 3RSOA 1X38A 5H68A 4PANA 3HU5A 5EUCA 2WFAA 3IX7A 5J43A 4LC0A 1W52X 2CB9A 1QTIA 4WXYB 2QX7A 2QJWA 1AURA 4RA6B 3T7RA 1LDBA 5HJEA 3G5TA 2FR0A 2H7VA 2DMRA 4JYMA 1IUNA 4RM3A 1RXEA 1LV7A 3MUOA 4IO0A 1GL7A 5JNVA 1MH1A 3KQVA 4TV8F 3LT2A 4CV2A 2VJQA 1SC3A 1T2NA 2GDJA 2MR5A 3ESAA 3GA5A 4C0BA 2IUEA 3FJYA 3HPQA 4DAOA 1F60A 4EGQA 2H4XA 1T15A 4AAYA 2V7XA 1A69A 2I71A 2Z6UA 3NB0A 3OY7A 3FD8A 1XZPA 5JZMA 4A1OA 4KIWA 4FBMA 4E03A 5A4MS 2YRFA 5KUTA 4P7GA 1DC6A 2CJWB 4X1YA 3S99A 1OAAA 2V4UA 4JXXA 2QQ0A 3UAWA 2Q3DA 3ZWPA 2IYAA 4ECEA 3COYA 4JJZA 5EJ8A 5KHLB 2E5LB 1KY2A 4DIOA 3O82A 5A4JA 1J2EA 1CETA 4GXQA 2O0JA 4YRDA 1UF9A 2Q3EA 4M8NE 4X45A 1IHPA 2AQKA 2J07A 3DQQA 3GRPA 3SXJA 1Y82A 1CUXA 5FO0A 2QRGA 3ZZMA 4RKFA 1PT5A 2C8LA 5DP2A 2YYAA 1GKLA 1MW9X 1WHTB 3T7CA 1Z12A 2QTBA 4BLWA 1D1TA 2HDOA 3GBPA 4MB6A 5FUQA 2QPTA 2VHJA 4HNVA 4J0GA 5AO9A 2AWNA 4FGJA 4EG1A 1BD3A 1DTEA 3P2OA 2FF5A 3N70A 4ZT6A 2PJUA 3KXLA 4ESEA 1THMA 3R8FA 1QF9A 3EAFA 2FSSA 3LSTA 1T25A 4CBVA 5JBNA 1RRVA 2C4UA 2IPMA 3JQPA 1DAKA 1ZGCA 3CINA 3F8TA 2AD5A 2LE0A 3G23A 1DS6A 1UBJS 1LLFA 2KE5A 3LC0A 4HADA 1VZ3A 3F0TA 3D7LA 3LX5A 4IP0A 2QL7A 3KSUA 2FZKA 3GJSA 3HB5X 4IIBA 4X20B 3ZKWA 4A5SA 1GM5A 2OWDA 5ALKA 3MCWA 3LMKA 2ID8A 4RTLA 3ICEA 1DX6A 1ZL2A 3U4HA 4YJHB 2WAMA 5KWEA 4G5XA 4N3CA 4AQYB 1I4LD 1HFWA 5ER6A 1TECE 4Z2YA 4IF4A 1KEWA 1C0PA 2DPYA 1NSTA 4NEGA 3LY8A 1V4BA 4BZZA 5HZKA 2QP3A 3IEKA 3DLIA 4PX2A 2GUWA 3L0OA 4WWHA 3S55A 3TXAA 1U6KA 1Q14A 3Q9UA 1LDEA 2V8OA 3TSZA 5FYDA 4HH3C 5EN4A 4OIMA 3DXXA 1U28A 4RPLA 3FNFA 3A3KA 2CDBA 4LC1A 4YQEA 2EFDB 4HOYA 4MKRA 2OFFA 1A97A 3RUDA 5JNSA 3I9NA 3X1ZA 3H5RA 4PPNA 1JIVA 1MDBA 1SC4A 2JLWA 4UOQA 2CC2A 2BTQB 1BEZA 1NMSA 4R8MA 3CH7A 3TQRA 2EEZA 3ND9A 1U63A 3BMCB 4RW0A 1Z4NA 1O57A 2Z56A 2PRYA 1MRZA 1PJZA 2PBFA 4KGDA 4NBKA 2JFQA 1JXOA 1A71A 1CY4A 3WIUA 2CZCA 5FOUA 1HYHA 3DP9A 2A9FA 4K03A 2G0AA 1MOSA 5A4IS 2GX6A 3EIHA 1MHPA 4I1RA 2B78A 4PZ0A 1DCKA 2HEIA 1LI4A 5IVHA 1UXKA 3DMTA 3DLTA 3FETA 4C6RA 1JTVA 3GH1A 2AOTA 1JHOA 2X8WA 5AVWA 2VJAA 2X1MA 3AVTA 5JRDS 5LMUB 4QREA 4YJHA 4BEVA 2Q2OA 2HMYB 5KTKA 3H2IA 1KU0A 3VQTA 2F00A 1HG1A 1YL5A 1ZK3A 2GTPA 2R7KA 4XR9A 3HH8A 4M99A 3BMOB 2EW1A 1Z68A 2YW2A 2X2PA 4J0IA 4RVFA 3HRKA 5LLTA 1I7QB 1BMFA 1GPNA 2JIPA 2XE8A 4N0PA 1K0UA 1YFJA 4H1HA 3ROTA 4KX3A 1S4QA 2PGOA 2HK6A 3C3CA 4FS8A 3SNHA 1PNRA 1EDZA 2I78A 4MDYA 3SHFA 4W82A 1QF7A 1Z35A 1CE8B 1DIRA 5EA2A 1CX9B 1L3IA 3M6VA 4TT3D 1PT9A 1PGQA 1RD4A 3IQHX 4RHCA 4BVHA 2H1RA 1BVHA 3KDAA 1JILA 4TTRA 3O8RA 2FFJA 1I2ZA 4F92B 4WCFA 1K9SA 3CR8A 3EQ7A 4KFRA 1VMAA 4O1IA 2A6PA 2IYPA 2CCJA 1SA0A 4GE3A 4A5OA 4KHZA 1L7EA 1KRXA 3H9GA 1JU3A 2EBWA 3EGWA 5FR2A 1Q11A 3ZLUA 4G09A 1UP6A 2J9YB 4E09A 1HPLA 4YCDA 2ZS9A 5MN4A 4AWXA 5JS1A 2J67A 3RVDA 1YK1A 3WX0A 2QAGA 3DCIA 2OZVA 4EM6A 1HFEL 4FXPA 1GTL1 3LYLA 4EKDA 1T2DA 2C04A 3K1ZA 2WKPA 3FAKA 4JITA 1II8B 4ER7A 1CNFA 3NHLA 4II2A 1NLZA 3OPVA 3QBDA 5CW2A 3MVEA 3KRTA 2ADMA 5EKTA 4BNVA 3Q85A 2HK8A 4EX7A 5FYQA 2BM0A 2YXDA 1U2EA 3ETLA 2YDXA 4XWYA 2RC5A 3VMFA 4M55A 2WF5A 1ZVMA 4LYEA 2R00C 2ZREA 4UUNA 2G08A 3OHSX 4CMGA 2YHUA 2ZIXA 1HT1E 3RABA 5C7OO 4DIBA 2BSXA 4PGMA 1DJNA 4WINA 2C5FA 3BA6A 1JB1A 4OU4A 4AULA 4FR0A 5IG2A 3W5SA 5BYKA 2Y27A 1WW8A 1L1FA 1L1RA 2GJKA 3QVJA 2ZRGA 1A1SA 5JU6A 1RAFA 2PZKA 4KW7A 3OQ1A 1UBTS 1LRKA 4NESA 3Q7PA 3SE7A 1KBOA 4P3OA 4EJ2A 4EFKA 1BJRE 4I3FA 1K8RA 1NFRA 1ULTA 2XCOA 5G3YA 2WKWA 3S2SA 1T4MA 4FHDA 1TI7A 1YQEA 1QRDA 2B9VA 3T7EA 5CB4A 2P6UA 4OQEA 4GBGA 3T3MB 3RI3A 2UU9B 1Q1ZA 1LTQA 1B0AA 1RJEA 2D1TA 3MBOA 4MW6A 4F86A 1JQDA 4UNRA 3N2ZB 3DHNA 3KCQA 2C5AA 1APBA 3PNLA 3B53X 4MO2A 1WMSA 4J0CA 3D7NA 4HPXB 4GRDA 1WG8A 1OLUB 2JVJA 1P18A 1P7PA 3AILA 1ANKA 3FYSA 4F5WA 1O6FA 5LKAA 3K9QO 1DIHA 5F3DA 3ZHQA 5IHXA 2IITA 2LRHA 3IQEA 1CUWA 1KBZA 1G55A 2AEJA 1F38A 1SBIA 1SCDA 2HOQA 2J5XA 5EGSA 3DE6X 3TLBA 4CUZA 3B1VA 2WAXA 3DBHB 1LNQA 5AW9A 1U3CA 4G8BA 4YGYA 3RQSA 4HRAA 3FTNA 1HK7A 1E9SA 2PZEA 4S2UA 1TOAA 3VAAA 5HZHA 2CB0A 3N76A 5E9WA 3ZBUA 5JNUA 3WWDA 5JS6A 2EDCA 4DXHA 1CQPA 3M5PA 3T3IA 1S2NA 2QTNA 4IHJA 4V38A 3DBRB 4NZNA 3ROGA 4GR5A 4XB6B 2L0XA 3HXMA 2XNJA 3PYMA 4RL4A 2E0IA 4AP5A 4L5BA 2P91A 2DQKA 3KKLA 3ZE1B 4BRSA 1V1MB 4BX8A 4DW8A 2FZGA 1K7EB 1ADCA 2ODBA 3L0DA 3LVRE 4PRKA 3U3XA 4F3CA 4LYFA 1KPGA 4Q4JA 1NKSA 4XE5A 3T7AA 1J2RA 5I9LA 4KAJA 5C3UA 4N7JA 3RRMA 4IYJA 3MWKA 4PQYA 4RMNA 4F8EA 1W7AA 2CW5A 4R4JA 4LYJA 4G3XA 4E3ZA 1ZLYA 2H1SA 1GU1A 1I1NA 1OLSB 1WEKA 2QW0X 3RS4A 2HCBA 1TAUA 4J16C 4P3YA 4CKWB 1B16A 1XL0A 2F3QA 2LW7A 2W6MA 5JYCA 4ZANA 4CEJB 1CU1A 2PMCA 5DBEX 3BJZA 3EEYA 3O93A 3CZPA 4L4SA 4LHSA 1Q12A 2Z2IA 1VKZA 3AI7A 2X6QA 4CEHA 4NJMA 2NUPA 2GEUA 1XA0A 3BAFA 2I1LA 2GBPA 4BE9A 2QSUA 2G17A 1YS2X 4DTIA 5FNVF 4WEQA 1COZA 4DPMA 3TRDA 3BE4A 3DE2X 1E66A 1X7ZA 5ARCA 3C87A 5H70A 1LFDB 1XHEA 1UMKA 3L9WA 3QMMA 2O8EA 2XUGA 3HDGA 2YBDA 2FN7A 2YV4A 2BI7A 2ONCA 3ADBA 3CMCO 2NTYC 5CTJA 4BNKA 3T5CA 1UPTA 3QEMB 4AZ3A 1QRAA 4IV8A 1QTRA 5HE9A 1ENZA 1STOA 3C6ZA 4FT4A 3X1KA 1N6HA 5DI3B 4ZVTA 2CFIA 3E1GA 1KEVA 3D3WB 3TCNA 4DEXA 5JW6A 2HBZA 5EQFA 1H69A 4EHAA 2WKSA 4LFBB 4BNFA 5A1TA 1BG6A 4UBIA 3CH4B 3CWQA 4DM7A 2VK8A 3V7UA 2IGBA 3K20A 4YMTA 3PNQA 2IJGX 4WXHA 1WVIA 1MT3A 1VHTA 2ZRJA 3ECCA 1RQXA 1IN6A 3H84A 3QFTA 4WX2B 1T36A 3DKRA 1E1NA 1I3CA 3BSYA 4Z7JA 3HXQA 4HNTA 3MD9A 1XEAA 2ZAGA 2GK7A 3JZFA 3SE0A 1ELOA 4Y7DA 1M1UA 1ZEJA 1WXWA 2ZBRA 3P9IA 2J31A 4M7PA 1MC4A 4AMVA 3WRXC 5FL3A 2PXAA 4JLOA 2NUPB 2A78A 4O2AF 5LYJB 3R9WA 2UXDB 3HZHA 1SPXA 2W2VA 1UR5A 3OQ6A 1QUFA 2FMHA 3FUXA 3PIDA 2VOEA 4YNBA 1NXOA 3GF4A 1RXUA