1XZNA

Pyrr, the regulator of the pyrimidine biosynthetic operon in bacillus caldolyticus, sulfate-bound form
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
179
structure length
161
Chain Sequence
MQKAVVMDEQAIRRALTRIAHEIIERNKGIDGCVLVGIKTRGIYLARRLAERIEQIEGASVPVGELDITLYRVPFPVTERNVILVDDVLFTGRTVRAAMDAVMDLGRPARIQLAVLVDRGHRELPIRADFVGKNVPTSRSELIVVELSEVDGIDQVSIHEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Nucleotide Complex of PyrR, the pyr Attenuation Protein from Bacillus caldolyticus, Suggests Dual Regulation by Pyrimidine and Purine Nucleotides.
pubmed doi rcsb
source organism Bacillus caldolyticus
molecule tags Transcription, transferase
molecule keywords PyrR bifunctional protein
total genus 50
structure length 161
sequence length 179
chains with identical sequence B
ec nomenclature ec 2.4.2.9: Uracil phosphoribosyltransferase.
pdb deposition date 2004-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1xznA00
2PRZA 1QK5A 3N2LA 1DKRA 3DEZA 1OPRA 4IJQA 1NULA 4LZOA 3QW4B 4RANA 2AEEA 2JI4A 3MBIA 4OHCA 1QCDA 4X44A 1G2QA 1Y0BA 1HMPA 4KN6A 4PAWA 4WN3A 1LH0A 4ZFNA 5E38A 5JV5A 2WNSA 3DAHA 4RABA 4RHXA 3M3HA 1I0IA 1A96A 1GRVA 3LRTA 1DKUA 2YZKA 1DBRA 4RV4A 1ECGA 5ESXA 4JITA 3DMPA 2VFAA 2P1ZA 1BD3A 1JLSA 1A97A 4JLSA 4P81A 3ACDA 4F8EA 4LZAA 3S5JA 3GGCA 4P86A 2EHJA 4RQBA 4MB6A 1D6NA 2H06A 4P82A 1ECJA 4P80A 1QK3A 5IPFA 1ZN9A 1CJBA 1STOA 4Z1OA 4RAQA 4P3KA 3KB8A 4RAOA 4S2UA 1PZMA 1A98A 1YFZA 4LYGA 5BQPA 1BZYA 1XZNA 1OROA 3G6WA 3ACBA 5KAMA 3NAGA 2H08A 2IGBA 1ECBA 1G2PA 3OZGA 1GPH1 1UFRA 1ECCA 1R3UA 3H83A 2JBHA 4QRIA 1QK4A 1XTVA 1I14A 4FYMA 1P19A 1NONA 1O5OA 1A95A 1ZN8A 1IBSA 2JKZA 5HIAA 2DY0A 3LPNA 5BSKA 1FSGA 2XBUA 3GEPA 3EFHA 3MJDA 1P4AA 2E55A 1OREA 5KAPA 1XTUA 1G9TA 4RQAA 1DQPA 1W30A 2PRYA 1A3CA 4QYIB 1XZ8A 1A4XA 4RACA 1VSTA 3ACCA 4RHYA 1L1RA 1QB8A 1G9SA 2H07A 1I13A 5JSQA 5HKLA 4RHTA 1Z7GA 1ECFA 1UPFA 2FXVA 2JKYA 1TC1A 5BRNA 2HCRA 1I0LA 5EUCA 4QYIA 1MZVA 1P18A 1VCHA 1BD4A 5BQOA 4M0KA 1U9YA 4WMLA 3O7MA 4LYYA 2GEBA 4TWBA 1XTTA 4RHUA 1QB7A 4X45A 1P17A 4M0UA 1QCCA 3HVUA 3OHPA 4P84A 1WD5A 2C4KA 1O57A 4RADA 1J7JA 1HGXA 3GGJA 4LZNA 1UPUA 2PS1A 1U9ZA 1V9SA 5ESWA 1AO0A 1ZN7A 4P83A 3OZFA 1DQNA 1L1QA 1I5EA 5IAOA 4PFQA 1VDMA 4M0PA 5K51A 1TC2A 1JLRA
chains in the Genus database with same CATH superfamily
2QORA 1U7UA 3THRA 3LLSA 5EA2A 3EZ6A 2JHAA 2NV0A 4RD2A 3EISA 1PT7A 1Y1PA 2G88A 5B1IA 1FMCA 4X44A 5F2NA 5K01A 1Q74A 4R8KA 1NV9A 1L5SA 4YWJA 1M2KA 1OCEA 3IQEA 1BKSB 3OO0A 3QEKA 2CSXA 1R4AA 1HG0A 2ZIAA 4U7GA 3X2SA 4OP3A 2QT9A 1WMSA 3GJXC 1D09A 3NPMA 4M36A 3VYSB 4AK9A 2DVMA 5FA6A 5KYYB 3R6WA 3CONA 4D3DA 1W0KD 2ORWA 3VR5D 2BAGA 3HCDA 3L0OA 5LMZA 4Z0HO 1SVKA 3H7IA 4LJAA 3KYIB 1XHEA 1KP2A 1KTIA 2VRWA 2VSNA 5AR1A 5B3JA 1XYGA 4HP8A 3BWMA 4A23A 3TSAA 2XA2A 5G0TA 4EMSA 1TYBE 4QFBA 1C1HA 4XB2A 4GZLA 4P4SA 4RGQA 1OAKA 5K8LA 2I22A 2GXSA 2ODPA 1SOVA 3QUAA 4PSCA 1V4NA 1Z29A 2CVFA 2PWZA 2X8JB 3BWCA 5T4FA 4BZWA 4JMPA 1P77A 1IBLB 2M9MA 3C5HA 3K5PA 4UREA 2C1EA 1FFCA 2RBGA 4X1KA 1NZDA 3LT0A 4O4JB 4OBEA 3SE0A 4F3CA 1B1CA 1LB1B 2HF8A 1EFPA 1FXUA 3PKZA 2R1ZA 4BKPA 5T67A 3ZDCA 9LDBA 1HE5A 4KKXB 4MRVA 4EHDA 1S2OA 1YE8A 2IF0A 1JHAA 3L4BC 1HFJA 1P5FA 4QRIA 3DZIA 3LZ6A 3RJZA 3LT5A 2I65A 1YRQA 4JX8A 3GT0A 4QWMA 4XGQA 3IUYA 2ZUSA 2WG0A 3M1IA 3PEFA 3UK0A 1SU4A 2R65A 3AJAA 4OM8A 16PKA 3CZPA 4KR9A 4D45A 4G65A 1WZ2A 4S1TA 4UFOA 1DBIA 5EE9A 4V3BA 4U6QA 4OG2A 4TQUS 5IW8A 2FKAA 1S02A 4QODA 4CM9D 2EYQA 2QK4A 5B7NA 3UGJA 3HO1A 8MHTA 3IP3A 3TDNA 3UJ7A 3WYDA 2YJTD 3D3KA 3STXA 4E09A 3RCBA 2C9ZA 2OOKA 2JJ1A 4ENUA 1SEVA 2GR9A 4C04A 4EPXA 3JQRA 1SRQA 2OCDA 4BGDA 2WQ7A 3GDFA 4ZI7A 3E03A 3OX4A 5CFOA 2OGSA 4N3GA 4ZCPA 3VU1A 2D1SA 3PDWA 4AQ7A 4FYPA 1MAWA 3MJTA 3AO0B 4REQB 2QLLA 4FBLA 4B47A 5KOYA 3IUQA 4H7DA 5AK0A 1TU4A 2H4YA 5A3VA 1H2FA 3DHVA 3S28A 4WT7A 3WGKA 4LOLA 4M38A 4R3UC 1CWUA 3KB6A 2G5PA 3RQSA 4EY5A 2PQ0A 3FCAA 4I3HA 2BUAA 3TOCA 4WXYB 3S40A 5AM2A 1JR6A 3I0MA 2FSHA 3DE1X 2O8EA 1QANA 3PT5A 4C20A 1P62B 1X77A 4FMCF 5DNAA 5E9QA 2QROA 4MV9A 5G2OA 1OV6A 2B1JA 3U3JA 1IUKA 3LWNA 3ZNQA 2AQHA 4MKXA 1NRJB 3CSSA 5AVWA 5CVTA 1SUFA 2PEYA 2Z6QA 1K08A 3OLZA 3WLOA 4LNHA 2CC2A 2C9YA 1F6BA 1Z36A 3HZZA 1PJBA 1KVUA 4MYSA 3CS3A 2HDWA 1EFTA 2A0YA 2IX9A 4OHMA 2F1RA 2J6CA 3I5AA 3LIPA 3VPCA 1SURA 1KKUA 2AKYA 4HPXB 4JOBA 4NBTA 4N3NA 1VXRA 3AVQA 2NP7A 2PBFA 4K6FA 1WSWA 4KDCA 3JWIA 2HADA 4FBGA 2TMDA 1B76A 1V43A 2YV3A 4MROA 1WETA 5EP3A 1EP3B 2X0JA 1E2BA 1G20B 3IUSA 4W1RA 4D4LA 1SD5A 1THTA 1QTQA 5KSYA 4B3GA 1ZCZA 1NRXA 2GZ1A 1PEKE 5D5HA 3FNEA 4NENA 3GLIE 1ZESA 2GAAA 2Q2WA 2WAXA 2QQGA 3G8BA 2MR5A 3LDGA 4ZVQA 1YVEI 2XUFA 4DREA 5BR1A 4BLUA 1RTKA 1QZTA 1JEQA 1BX3A 2PKWA 3AT1A 1DEOA 3AGPA 4IVNA 1NWHA 3T4EA 4BNWA 3EN0A 2MSWA 1CR0A 3CIOA 3QUCA 3GVHA 2VA8A 1LF5A 3ZU6A 3GIDA 1YI0A 4CIDA 3B78A 2E89A 2X9VA 1ORRA 3KQMA 2L19A 1WF3A 2B8TA 4R3NA 1P4JA 3I64A 3N8NA 3IKJA 3O4VA 4WBXC 5SZJA 2N9UA 3T35A 3ZTTA 4EZEA 2CL5A 1RXWA 4AI6A 3WBBA 4Y6QA 1MJNA 1KS2A 1UXKA 1DB3A 2ALJA 3I23A 4OA8A 2B20A 3KDSE 4HXYA 1TAGA 2B7CA 3KQYA 2C8LA 3LUHA 3O4IA 4MKGA 5I47A 1Y7IA 4PAOA 4C6HA 3JWPA 1L0BA 1JA9A 1S0UA 1TM3E 3RGWS 2H7YA 2QPLA 2PYDA 2O3JA 2J41A 2WHYA 2YN0A 4TTAA 3VH1A 4EUSA 3DP9A 1GNVA 3QXHA 2ZVJA 4KGZA 2RK4A 5FPPA 3VZPA 3FWHA 4AJJA 4CMCA 3B3GA 2O2ZA 3KZKA 5FNVF 1Y5LA 4EWLA 3AYZB 1FFSA 3DE7X 3LZDA 2NYRA 4LRXA 2J85A 5B2EA 5JD5A 1KO1A 1UCFA 3LGXA 3DTTA 5ALIA 2PQ2A 2PSFA 3DOFA 3HM2A 3O74A 5FPYA 3PRHA 3M5DA 5P21A 4P8RA 5EQFA 9ABPA 1OZ0A 1G8KA 2WSSA 2ZI4A 3CH4B 4CTOA 5JI3E 2C58A 3EG5A 3FSRA 4MLCA 2Y2UA 3UZUA 1Q0HA 2BM9A 4QVIA 4BV3A 4KK3A 1BCSB 4M0KA 1OXBB 3UOWA 4M1TA 3V34A 4LE1A 4KDRA 1U0SY 1NL3A 3PCRB 4L9WA 4UTOA 4WCFC 5B58C 3BHJA 3K9BA 4X1YA 2F7SA 4J2HA 2WYWA 3S2SA 1FXSA 2HHLA 4BX3A 4EPYA 1PL8A 5BV1A 4I5GA 3DO8A 3BHMA 3G82C 4RA9A 4NP6A 4RY9A 5ITZB 1EVIA 2HK8A 2NUTA 4AMUA 4EYKA 1J0AA 4OV6B 3AVTA 4PSDA 3OKPA 1W59A 2PUJA 1EA5A 3PD7A 4M60A 1RRGA 4RJLA 4UDYX 5DGDA 5IARA 3FPCA 5K3AA 1YU9A 3KOZA 5JU6A 1PAUA 3BA1A 3HV2A 2RIPA 4J0EA 2HKIA 4MW1A 1PWEA 1ZK0A 4YJGA 5JO9A 4I1YA 3KAPA 5FBLB 2XT9A 3TSWA 4W7SA 4QU0A 4BFYA 4DIDA 5DN6D 3OX2A 2HBRA 1R88A 1ISGA 3RS2A 3O73A 3FROA 3V8RA 3BZUA 1JLRA 1VKRA 5A05A 1GNQA 2WYHA 1TTPB 2ZJOA 3TLGB 1Y6FA 3Q0TA 4IJQA 2HXYA 4E2ZA 3ZZTA 5DLEA 4BTEA 4TMKA 1M1XB 3QVWA 4XYLA 5JSZA 3BB3A 2NU8A 4DADA 3W9UA 1Z7EA 2PIDA 3MN1A 3IR5A 5FQOA 3VNAA 2GN1A 4P1ZA 1U1EA 3TAHA 5L9AA 5EOVA 2Q7OE 4RS4A 4EJSB 5BSGA 4HMQA 1VB3A 1T6YA 2WA2A 2Z8YM 1AIPA 3H1FA 3ZWAA 2EJCA 1QX3A 3GN1A 1DKPA 1RS0A 1KIFA 3NHFA 4RF5A 3RAGA 4EENA 1HPLA 5B7QA 3OPYI 4J4HA 1PJQA 2HA4A 3QWAA 5WRFA 4HUTA 2BJHA 3WGYA 4XLTA 2ODEA 4ZOAA 4DIUA 1W2HA 2HU8A 2FE1A 2FPSA 4G5OA 1PL6A 2ZI5A 5B4UA 1G21E 1QORA 1U4NA 4E11A 1CV2A 1VGVA 3JQ6A 4CM6A 3HI4A 1GL9B 3D4NA 2IQ5A 1VYTA 3FCXA 3M6FA 3OQBA 1VL1A 1D9XA 1TZMA 2VJLA 3EQ2A 1PS9A 3GWGA 3F7NA 1C0EA 2DPXA 2WVAA 4RAOA 3QQ5A 1VECA 2QX9A 4IQGA 2EV9A 1Y8RB 2I4TA 1ZOSA 3LPLA 1LFAA 3KKQA 1SXQA 1PR4A 2F43A 3ZWVA 4O2BF 4U00A 2JF0A 3C43A 3JATA 4RBNA 4B3CA 3DMFA 4RTMA 1WE2A 1MFPA 3JALB 4O2RA 2DTXA 2FHSA 3CRW1 1OBFO 1TXGA 4U2GA 5EQDA 3V1YA 1L4YA 4OHZA 3LUFA 4M1EA 2QJWA 5LL6P 4J6FA 7ADHA 2FFHA 3C16C 1V0JA 2Z5FA 3HJBA 5IM4F 1SVSA 1KYIA 3TI9A 3O94A 5TARA 4CTJA 2AX3A 2GJKA 3DDZX 4XUDA 5CXXA 3IEXA 3U4AA 2VXYA 1G8SA 5JXWA 4ZOQI 1ZHFA 2XNDA 1K9VF 4XEHA 3SYNA 3R6DA 1NDUA 4BNDA 1ZCBA 5A9RA 1TO2E 3SC6A 2PUWA 5IM4A 2MYPA 3KNZA 2OILA 5F77A 3DBIA 3GROA 5TB5A 5LYJB 2VDQB 4K2HA 1FUUA 3A14A 4LGVA 2ZBFA 4Y2RA 3GUCA 1L4NA 5BV7A 4DV4B 3CUKA 1CS0A 1SBCA 1XP8A 1P7ZA 3ZDXB 1YDEA 1YRYE 1PVDA 5BURA 1XN1A 4BV2A 4RPJA 1F48A 1U5BA 3IAEA 4PG4A 2QQ0A 4GSYA 4D9FA 1N4AA 2GBLA 3IRVA 4WFIA 5E95A 3SVZA 1PQ4A 3U4HA 5JFOA 2MT9A 4XB6B 5IBPA 2R5WA 2J7PD 1BA3A 5LA6F 2XAUA 1AQUA 2J46A 1DDGA 1WABA 4R8LA 3UAXA 3K96A 4HDOB 2XOKA 1CQJB 1G5TA 1D4AA 4X92A 5K8UA 1UOOA 1T9CA 2QSUA 4GIBA 4YI3A 3VR2D 3D4PA 4YMHA 5FHRA 1YI8A 2PBZA 3EXG1 4MP6A 4EHLA 6GPBA 3NWJA 1ZVQA 4B2LA 1H05A 3TGWA 4K8RB 4AJPA 1M2WA 5DRTA 4BBZA 1IB6A 3S2FA 1ZJ6A 1DAIA 5IT5A 2Q1TA 4YJHB 3EXAA 1RZUA 4IJMA 1HK7A 1AY0A 3I5YA 2X7XA 3CW2A 1VJDA 1T5LA 3H2JA 2I6QA 3QEJA 3TQIA 3ZQ6A 1GA4A 4GZ3A 4NONA 5ALKA 4KH0A 1TAQA 5KTSA 3I2KA 3IIMA 1F9EA 1L5KA 3PFBA 4JBYA 3CMMA 1M75A 1F7UA 2P75A 2OZPA 1XCMA 1EEHA 1UMKA 1KF0A 4RTRA 1AUPA 3KV3O 4GZ5A 4TVOA 5G4LA 2VBFA 2ZZMA 5AKGA 3VR1A 3VR6H 3GZNA 1UK7A 5BQFA 1FTWA 1WVIA 2BM1A 3CLTC 4FEGA 1I8TA 1FFDA 2G0NA 4NSNA 2ZQYA 1E5LA 3WOVA 1E2KA 2QMUA 1ORHA 1T1RA 1Q1BA 5KVSA 1YDMA 4FYXA 5KNLA 3V9AA 1TQ2A 4IPTA 2CNDA 1IOZA 2R7MA 1AO3A 4R9UC 4RVSA 3FRJA 4OKNA 1LGYA 3C3EA 4X3OA 3PGA1 4BUJA 5DCYA 4MULA 1XVVA 5K09A 4A92A 5CCEA 4WNCA 4FDUA 3P9XA 1AK1A 5AVOA 5FL3A 4FS8A 4PTYA 2B37A 1GTZA 1TYEB 3OWHA 2H1FA 5LLSA 4ZYWA 1EFAA 3NIBA 1YFZA 1UF9A 1Q7CA 1DAKA 1T15A 5KTKA 2RC6A 1XTQA 5GM1A 5KAMA 1PNRA 3E7DA 3O91A 4R8MA 3EQ7A 2QP3A 1DEXA 1WDKA 2CHGA 4O29A 5G0UA 4AP6A 1ECCA 1YHZA 2GH1A 2ZEJA 4DQXA 3EY4A 2Y0CA 3W3AH 5JJ5A 4DL9A 2F8SA 2Q1XA 1S8FA 3QVLA 1JAIA 4R0NA 3D6MA 1DSSG 1JN0A 1Z34A 2RDMA 4LRQA 1ZI6A 1QGZA 2EHDA 1N6OA 4L1KA 4J8PA 4L22A 1DOAA 4ONEA 1YRBA 3JARB 1X1QA 2PCJA 1OYWA 2HEIA 3INGA 3MFYA 3N39C 3K0SA 3N58A 4DQ0A 2K6GA 4H1WA 4DLSA 2P3QA 4E4YA 3TF5A 3NPAA 2HTEA 1UJBA 2ACWA 1OREA 3OZCA 4O5OA 5GM2A 1U8UA 2RGEA 3JALA 1YQGA 1JWAB 3N28A 4IZOA 3CWQA 3LQQA 4HNGA 1DIAA 2IEBA 3LHDA 4KVZA 4M8KA 5IC5A 1KY2A 3GJZA 1ZUHA 3FJOA 3N7UA 1TTHA 3UBMA 1KC3A 4E31A 3A6KA 5J40A 2XADA 3E53A 4ZAFA 3HA5A 4ZZ3A 1PVVA 5KOJB 1CQXA 1TQ4A 2LD4A 2VLBA 3H99A 1CF4A 4E46A 3A6JA 2E48A 3CWZA 4QDTA 4XWOA 1ZIPA 4HAYA 5DHUA 2HLNA 1CZLA 2WIFA 2Y1FA 4Z6KA 3P0IA 2CXUA 2P2GA 1VJRA 4JUDX 3BG5A 2D7JA 3MIIA 4KE9A 4OX9Y 2C3YA 2NZ8A 3O84A 4M0UA 4FMCB 3V3TA 2VJOA 1GTRA 4OXRA 3QOXA 2XMBA 3E22B 4LJLA 4C30A 1EAYA 3RM3A 5H1YA 1YO6A 2ZBDA 3CLUD 1ZW1A 1E3IA 2XRYA 3N5CA 3DEJA 4U9UA 1NBME 3HU1A 3PJRA 5ALMA 2Y3IA 2JANA 1W581 3UB4A 4NR0A 5AI4A 2E6KA 4XWYA 3PJFA 3OCJA 2YWFA 5JCJD 1USWA 4NEGA 2ZBVA 2IY8A 1OI3A 1AHHA 1V71A 1J8VA 1XTPA 2OVFA 2ZYIA 1CUAA 1E64A 1VXOA 2Q0QA 4IR7A 4LJYA 3R23A 3VBCA 3IBSA 1NNSA 1MOPA 1NJ8A 5DT9A 4DEXA 1YB6A 3LCJA 4N39A 4GYKA 1U3FA 1JEJA 3D0QA 3G5AA 4FGJA 1ONBA 4HH4A 1EK0A 3I34X 3W2IA 3U4QA 5JC1A 3TWOA 4P38A 2XF2A 3IBYA 5KS2A 2I8LA 5DK6A 1L7NA 3PLRA 3TJZA 1NW9B 1EI9A 2C2XA 3L18A 4KTTE 3GGGA 4OY3A 3I32A 4BZPA 4NPHA 1ZD3A 4I8IA 4N18A 1KI6A 1NC3A 2PKEA 1VBKA 1KI9A 3I2FA 3KD3A 4MV5A 1TYAE 4NE7A 5TQ0B 4LZAA 1I1OA 4DG5A 2WM2A 4ZDJA 3RUCA 4WZAE 5JTUA 3VTAA 1IZ7A 4CTKA 2BFPA 2QYTA 2GAFA 3G8YA 5SYMA 3LUBA 4NOJA 1VPLA 4RAQA 3D7NA 4EO4A 1K2WA 3UMMA 3JYPA 1DIOB 3EXHC 3VPFA 2PD4A 4BKRA 1NVXQ 3SICE 4BRUA 3K5WA 3OSZA 5EG5A 1DT5A 1PRYA 4TPKA 2NPFA 1XQ6A 3ZPXA 2A4KA 4DC0A 2AJTA 2ZRGA 4K81B 1P3Y1 1RE1A 1U2ZA 1FS5A 3G5TA 4IIFA 4BJ1A 1ONNA 1JJ7A 1ZICA 1KORA 2JGNA 3FPHA 1H69A 4PIMA 1DPFA 3JYNA 1R0ZA 3NASA 1RM0A 2PXHA 2VNHA 1W4RA 1MB0A 3UB3A 4KBFA 2EEZA 1RHUA 1QC5B 2NU7B 3LPNA 3ZDAA 4WECA 1IHPA 1D2HA 3FVTA 2ZYTX 1WBBA 2V6FA 3FBGA 4Q66C 4XDGA 1LRKA 2LKCA 2PV7A 4RZSA 3J81A 3RUHA 3CCFA 1TRKA 5JBIA 4NCIA 4C0JA 3K0EA 1FRFS 1W5EA 1QOPB 1KZ9A 2VBIA 3L1JA 4ZKEA 4AG5A 4L4XA 2AXQA 3P9YA 4FFPA 5K3BA 3BDVA 3WLEA 4ZTUB 4KV7A 2VHJA 3ZKWA 2JS7A 2FG5A 2GETA 5T3UA 3WYCA 1D03A 4F5ZA 3LDHA 4FNMA 2BFDA 4WZAB 5E6SB 1ZJWA 5H0IA 4ZEOA 1FY2A 2HYDA 3GUHA 3ZE2B 2GZSA 4EKIA 1HL3A 1RPAA 2YOGA 3RFCA 3SZUA 3JQFA 4HDKA 3PQ3A 1GFZA 2BFOA 1SVUA 2HPVA 1CK4A 1DTWB 4UUAA 1U5BB 1G42A 1PL0A 1C3OB 1WB6A 1PK8A 1P17A 5B7PA 3VHRA 1Q7RA 1A04A 3JQEA 4KO3S 3H6GA 4R16A 5BQXA 3VI4B 3WKAA 1VG9B 1QWSA 3T4XA 3SIPA 1MG0A 1N2CA 2IYEA 1YI1A 2QVGA 2ZE5A 3R0IA 4NBSA 5JDCA 1KZ1A 4URYR 4C5CA 1Q1QA 3A6GA 5CGZA 3PI6A 1N33B 1C2TA 2BISA 2Q2OA 2WKQA 3BXGA 4OSPA 4XXHA 3F74A 4P4UA 1ISSA 4WNAA 4YJ2F 2QX8A 3K5IA 5D5QA 1M1NA 1W73A 4Y2VA 3LIIA 1W76A 1ZN7A 3FWYA 1ATZA 2UYGA 2JNWA 2R6CA 4E5SA 3GCGA 2MSLA 2YIMA 3F4KA 1CF2O 5K3EA 1RHKA 4RIHA 3KAQA 2CV1A 1DIBA 2YDXA 3C4QA 4BFZA 4UTPA 4W5JA 5LQKA 5A0VA 5I5GA 3QX3A 4C4XA 4IDHA 3FWPA 1C9KA 4GDMA 4KXNA 5GJWC 3UJ6A 1LPBB 1EUQA 4YAKA 5IJ9B 1M76A 5DN9A 3RNOA 3TXAA 4ZJZA 3UAYA 3UHPA 2I6TA 5KKNB 4FWBA 3A37A 1DKOA 2DT5A 3K72B 1TUBA 4LFCB 1U0LA 4QPJC 1R6UA 1TT5A 4YJ3B 4RH0A 3Q72A 4AL4A 4CMKA 1A96A 1V8DA 3F9CA 5TVGA 3VU9A 3VX3A 2OBFA 3ZBUA 3ZWOA 2X2PA 2C2WA 2OCKA 1GPMA 2J9YB 3W06A 1CUIA 5DV9A 2XKKA 2NZ2A 3ZNNA 2FPIA 2EATA 1WU8A 1SBIA 1L5HA 2ZUEA 1THZA 4CI0B 1E58A 1KFBB 2VJMA 3W2GA 1VE6A 4E07A 2DM6A 4Z5XA 1NPYA 3RAEC 1LSSA 4RTNA 1JRLA 1N6PA 2CHVA 4NAUA 3T9AA 4JI7B 3H2GA 5I3CA 1B4DA 1QP4A 1CB7A 3PHLA 1RRVA 1A9TA 3AMVA 2PDAA 3DMYA 4HYQA 1F4PA 1H1LB 2CLSA 2H59A 1WDWB 2XV1A 4NMXB 4PZ0A 4URVR 1EFLA 3BQNB 4LMAA 4J0GA 3ASYA 3I2YX 4IJ5A 3ZK8A 2UZ1B 4W1PA 1FTYA 1UFRA 2HQRA 4RTKA 1YNOA 2WD9A 4GRIA 3U7QA 4C0HA 3T5PA 3B13B 1MTOA 3S8YA 5F21A 1RLTA 2VK1A 5F1KA 1F5NA 2LRHA 3O6VA 2UU9B 3WGZA 4NCAA 3GGOA 2F67A 3D6AA 4QLAA 5A9TA 1ZD1A 2CLIB 1C3EA 4YQZA 1FP6A 3THYA 2R3SA 4JGBA 3I45A 4OJQA 1RACA 2FEKA 1P4AA 3F49S 2FOXA 1N34B 1W93A 1R64A 3K0FA 2Q4DA 1EMDA 4DMHA 1CY8A 3M2PA 3OM8A 2ZSKA 3S7ZA 1E3LA 5A1TA 3ZUPA 1SCUB 5KEIA 1JR3A 1QB8A 1G9SA 3CKYA 3GEHA 2N47A 3N6RA 2AMVA 1HL7A 1XEWX 3PJEA 4F6CA 4F7WA 3JVEA 4W5HA 2HCRA 4PONA 5L53A 2EW2A 1ILEA 1EFHA 4W6QA 3TZHA 3N70A 1P0CA 3NIDB 3STVA 3T0FA 2V4ZA 4QDUA 2ADFA 2I1LA 2HRBA 2IC5A 1W48A 1L5VA 1CDEA 3MWYW 3CZRA 4CETA 2BONA 1BCSA 2F8MA 5DO9A 2ECPA 1AKQA 3ZHQA 4M0FA 2BMFA 3KCNA 3ZV3A 1X80B 4IGIA 3UGQA 3D3EA 4RNDB 3T7EA 1MAAA 1M1ZA 4L4UA 3WNBA 3BIWA 1G5RA 3QSYA 3DEYX 1DTSA 1UFKA 4MPJA 4F5YA 3L7NA 1JL3A 3WNQA 4HQLA 1XTBA 1YVRA 4TZKA 2QRLA 4Z4HA 4JI5B 2ZS8A 4YT4A 3HLYA 4XVCA 2IIQA 2Y1WA 4B0OA 2D74A 2RJNA 3FB4A 1B41A 3X1MA 1XP5A 1N2GA 5F9MA 1MO2A 3SR0A 3UTCA 3ZGLA 4WLNA 2BMWA 4A10A 3PC7A 3Q40A 4GX2A 1G3MA 5DIZA 2XOXA 1XA3A 4UUNA 1ZD5A 1COWD 1O9HA 2OPBA 3OX3A 4MYDA 3QFTA 3WIDA 5D1HA 4NJMB 1AV6A 4HH1A 2WA1A 1G7SA 4WOPA 3K9FC 5IDQA 2NAPA 3PBKA 5E6SA 1IUNA 4UDOA 4IIJA 4XCQA 2OG1A 4XOUA 5JZOA 1GUBA 3FCUB 3NEYA 1L3CA 2WP0A 2PR2A 1NQUA 3NYWA 1D1QA 1PX0A 1JZSA 1HYBA 3DBLB 1CE8B 3EK2A 3GN2A 3IQXA 2FUNB 3KPWA 4JENA 1YQDA 2XUQA 4UUPA 5E7JA 5EP2A 4PZ9A 3TR6A 3LQYA 3TO5A 2HC9A 1QYVA 2O1WA 4QTYA 1UR5A 1KERA 3IEPA 4OYRA 4H1HA 3STUA 1BKYA 3DMPA 1LC3A 2P1ZA 1W4BA 5LUBA 1OXKB 5AW6A 5HA5A 3A04A 2JFXA 1HOTA 2V8BA 2FG6C 4MGYR 3JVDA 1PV2A 1YHNA 2KM1A 5JPDA 3H87A 3ETLA 5CA1A 2DUJA 2FUKA 1ZVKA 5IPFA 1HE1C 2BOVA 2XI4A 3PHHA 1XBTA 1N4DA 5I9SA 3T5CA 5K8TA 3A4VA 1HE8B 2BF4A 2ENWA 4G8CA 4U02A 3IEVA 1Z35A 3SDBA 3TW4A 2FV8A 2OFXA 4BO0A 3W5VA 3TIXB 3P8ZA 2P4SA 3KLMX 4BO8A 1V8ZA 1VHDA 3SSMA 3TCXB 3GG2A 3WYBA 1C9DB 1I4TD 1OBCA 1JMKC 3OEED 4EB3A 1P44A 3BMCA 3AJ8A 4RTOA 1H9CA 2GKGA 3IFSA 1QHGA 1I14A 1NNLA 4R51A 1XQXA 4CF6A 5JVDA 1RIIA 1R9NA 3EXFA 4ALKA 5BR7A 2I80A 4O2BA 3TNYA 4AG6A 3GRZA 2BEVA 1SXIA 3PHJA 4LI0A 4YP7A 1SUEA 3D81A 6ADHA 1QJ4A 3IB6A 1NJSA 4EJ2A 3AP1A 5EJ7A 1ZNQO 1EP2B 3L6OO 5AVQA 2HOQA 4N8SA 4EIWA 1IPHA 1CY7A 3OQ6A 2YWDA 5F5XA 1NJ6A 1N6HA 1P5RA 1P2SA 2RGBA 2Z95A 1E1NA 2CYCA 2P27A 3Q3JB 4DIOA 3FNIA 1EVJA 3OZXA 1CY2A 3QBDA 1DO8A 4LISA 4NICA 1FP2A 3MGBA 3BJMA 3TZ6A 4F7DA 4OFBA 4Q48A 4TTPA 5DX0A 4GPTA 2PU7A 4OXKA 5IKMA 5JH7B 2UZIR 2W2KA 2WP8J 2XYRA 2CL7X 3NDIA 4RMIA 3LW7A 1M6WA 1CCWA 3O7MA 3WYGA 4TUYA 4DLWA 5LYJF 4NXNB 1T1GA 2BFAA 4H17A 4KPUA 2PH1A 1X2BA 4J94A 2ACKA 4FZ3A 3TKLA 3VSAA 3OY7A 5GPBA 2RCYA 4LZZA 3TCKA 3DXZA 4TX1A 1H23A 4DIBA 5I4CA 1N9GA 2C7OA 2G76A 4ZYXA 1ZU4A 2FSVC 1D2MA 4U2KA 2HPAA 3UAGA 1RWVA 2JLRA 2RGCA 1KMMA 4AWBA 4GS5A 1FBNA 3QVKA 2ZCJA 4IFEA 3EWNA 2C1ZA 2WRZA 3OQPA 3URKA 3AM1A 3KEMA 4CLDA 3GRYA 1E99A 5KC8A 1O8BA 3K9WA 1A4UA 3RAFC 5IHPA 2OHXA 4V2IA 1XRRA 4MUBA 4ZVTA 4KTVE 5GGXA 4CKCB 1RWOA 2BGRA 3CA8A 5JAOA 2ZIVB 3WLHA 4XRGA 1DKMA 3GFOA 1GR1A 5I7AA 2AXPA 3EIHA 3GBSA 3FDJA 1DKRA 1XOIA 2HPZA 5ICEA 2CWDA 3P9ZA 4TVSA 2VT2A 1SU7A 4N03A 1HSZA 4YAJA 1Q91A 2AJCA 2QJTA 1MB9A 1P9WA 2Z2IA 2ZI3A 4C89A 2VDKB 4KN6A 1FYFA 1KYVA 2O06A 2H4FA 1OWLA 3AZPA 3QLUA 4FNOA 2ZB8A 2INGX 5DF1A 3RVMA 4EL5A 1NKVA 2PVSA 4Y67A 3VOBA 2G3YA 5J59A 5EVJA 4MKRA 3ECSA 3VSCA 3I8SA 1E6WA 1T4DA 4FFRA 3EZ7A 1GEEA 1GL3A 2C4TA 1T9HA 2C9DA 1P1HA 2XUJA 4G8JA 5FV7A 1R15A 3GCWA 5DLYA 3PUZA 4BLPA 4HVCA 3JWJA 3QOYA 2WAOA 1LK0A 1Z4MA 5DNDA 2GCOA 5EIEA 1KEKA 1VMEA 3QBEA 3R5FA 5MDHA 1ZS9A 1KJJA 1UDCA 1KEVA 2P2NA 4HNHA 1C3VA 1VE1A 5FPHA 5JEEA 5E4TA 2Q6LA 5JPIA 4AUMA 1N5IA 5IT0A 4XLLA 1FMFA 1Y42X 3WSVA 3HYNA 1UC8A 2VK8A 3HTXA 1NIPA 2F1HA 2P2SA 1TIBA 2Q45A 3JYQA 5IUJC 2PBLA 3HSYA 4IILA 2VPZA 1R0SA 5TPWB 2FZEA 2QJFA 4RKYA 4WLVA 5JAPA 3C3AA 4DY4A 4JJZA 3KJIA 5B3JC 1GU1A 1KI1A 2R1UA 3LUCA 4EFNA 3K9NA 4CL8A 2J4DA 4BZXA 1GYPA 3U3OA 4EO7A 4ND8A 4L3OA 2FW9A 1ZQ9A 4BB0A 4ZT3A 3N2IA 2CXQA 2VEDA 5FPQA 4F4FA 4LJRA 4FUTA 4OSEA 1VI5A 2YH2A 4AWXA 2IYAA 1ST3A 4OXXA 5JD3A 1E96A 4R9RA 4GSKA 5LJLA 2ZRPA 4G1FA 2YVLA 2F62A 4GWGA 3RHFA 1QYRA 2XCOA 3P2JA 1GTG1 4JL8A 3CISA 4ZYZA 1U5AA 2P9BA 3L0YA 2IZZA 3EEQA 3MBOA 3DVRX 4JYCA 4AJHA 2WKWA 4US2R 1E3WA 1HETA 4K6KA 3I83A 4R2LA 4V1CI 4GNKA 1Z5PA 5K3FA 5C5CA 1TPZA 2VA9A 1DCFA 2BEWB 1KE1A 3TTSA 1XCJA 2JCVA 4KOEC 2CKMA 1Z37A 1Z6ZA 2GTHA 3C4VA 1CEQA 3HZOA 4H31A 5FUXA 1EFRA 1X39A 2Z4RA 1JG6A 5DP1A 4BKQA 4RXUA 1UK9A 3TNFA 2BDTA 1JQLB 3F6EX 4RUKA 1GGKA 4XYGA 4FYIA 5IJWA 2R7KA 3T95A 1LW7A 2R6JA 3JQAA 3WISA 2ZAGA 3S5UA 1KH2A 3SEQA 2FK7A 1OA0A 4NPAA 2W2XA 3O1JC 1KARA 2AG5A 2PS9A 3AJEA 1I2MA 3KX2A 3JD3A 4Y1RA 2CY0A 1UWKA 4AJ2A 5LBUA 1I3NA 2IUYA 3I2IA 4QECA 4BKMA 4HWPA 2C54A 2A1TR 3V7NA 4CCWA 2R1VB 2B2NA 1AUOA 2Y66A 3DJFA 3OQ1A 3ZW9A 3G0HA 4ETWA 3FE2A 4V3CA 5C31A 4RZ2A 1CPYA 2QUBA 3UMSA 3WQBA 3KV1A 4AX4A 4NABA 2AEEA 3TIFA 1JB1A 4WPGA 5IKPA 1PWZA 2PVPA 1YA6A 4P08A 3CH5A 4BN4A 2YWGA 4WBNB 4QQRA 3X1WA 4L5JA 2Q4EA 3RG8A 3L6DA 3JTMA 3VR4D 4YRGA 4KYTA 1DJNA 1ZMRA 2H8GA 4CFYA 4CLHA 1RHQA 2H1IA 1X9HA 4Z9FA 4CKYA 2AKEA 3U4MA 2O8BA 5IDYA 2FR8C 1FQKA 1DEHA 4ZDWA 2EQ5A 2YINC 1ULHA 1ZGCA 3LX8A 4QJBA 4R1OA 5BSUA 2CBXA 3VYUB 3ZI7A 3HCNA 3DLBA 4S1VA 3BSFA 1K0UA 1VRVA 2Y0BA 3LVRE 3NJ4A 4ND2A 4F8EA 4HDNB 2CV0A 1DBVO 2GNPA 1OW3B 3C5WP 3DB2A 1OJLA 4HDMA 4I4IA 4E70A 1NBHA 3IEMA 2BEKA 1QG0A 1ZKMA 2J9ZB 5L4LA 5ARDA 2ZFUA 1UJ6A 3H9EO 1GZUA 3P94A 2F90A 2ODAA 3DFIA 3U4IA 5TGTA 1T1JA 3E8MA 3UC5A 4PO9A 2ANCA 1K7XB 4GE0A 3VSBA 2P2ZA 4DHEA 3OZSA 4C6RA 4EPTA 4O5AA 2C59A 1L7VC 3OLCX 3M6UA 3ZZMA 5TV2A 5IFLA 2NV2B 4KJZA 5ITSA 3O8QA 4DCGA 5CCXA 1ZPDA 3FYUA 1GYQA 2PSJA 3O03A 3DZ8A 1QK4A 2XJ4A 4B6EA 4O59O 1Y8QA 1HEYA 2FQXA 1AHPA 4A0RA 2Z9DA 1CDOA 2JKZA 5B36A 2HSDA 4WAUA 2D54A 3ICOA 4HWGA 2OHIA 3LWZA 2I1QA 2IHYA 1EWVA 4YJFB 1SA0B 3FNGA 3H9GA 1KAGA 1JXOA 2WJYA 1QHEA 5EWMB 3ZQUA 4D3ZA 3L6EA 1D2RA 3F6BX 1I5RA 5T6BA 3V1KA 1NAIA 4KQ9A 2GEKA 4G5XA 2Y2VA 3HBMA 2GAJA 2QTCA 3TOZA 3KVRA 5DDIP 3AKEA 4Q7MB 3BZBA 1YVUA 4PC1A 5FWYB 2O6LA 4Z53A 1MXHA 4URFA 2X3UA 4TLMB 3BK1A 2XDAA 3E5MA 2GBGA 2G9NA 5LFAA 1UBOS 1QPGA 1NX6A 4R2JA 4W4TA 2BGNA 4FD3A 2H0RA 3A0UA 1E4EB 4WN9A 3LF2A 1U90A 3EY9A 4E88A 1WZUA 2X41A 1YOVB 4GBGA 1A8UA 4BEBA 3HXQA 4M8SA 2YTZA 2FR0A 3A9WA 4GHWA 4Y9SA 5HUHA 4ES6A 5BMVF 3KSZO 3AOEA 4H16A 5REQA 1CEXA 1B3BA 1G60A 2EZ8A 1NT4A 2WMDA 4UJ3A 3SM9A 2GPBA 5KNCH 3VYVA 4Q21A 1M7BA 3TDMA 2DY1A 1X7GA 3ROFA 1RZRD 1V1JA 1S3IA 2B4KA 5IYZF 2Q1SA 5AKKA 3G17A 1CUFA 1E2JA 4OMDA 4QDZA 1Y6GA 4OL9A 3BL5A 1MN6A 1K98A 2QL9A 4WKPA 3QPAA 1Z63A 1DBRA 4OD0A 1NXPA 2B5OA 3PGLA 2AZMA 1FSZA 3N2LA 2X8WA 4PG8A 3WA7A 5IBRA 5BXYA 5IEJA 1MQ8B 4R1QA 1ADCA 4UXHA 1T3TA 5JJLA 1R6BX 1H22A 4LK3A 2EP8A 3KOUA 3O31A 4M9ZA 2X1VA 1QHSA 1BXRB 3LVFO 3BULA 3ME5A 1U28C 4QOGA 2GF9A 1H5UA 1PT5A 1V2HE 1E5DA 4R2IA 2FEWB 3G68A 5TEVA 2A5DA 4ZZ1A 2QQ5A 4RVFA 4OH1A 1NJFA 1F0KA 3CZMA 3FOWA 3MAJA 2H2GA 3I52A 5BPHA 4IHAA 1L7EA 1SFRA 4D0RA 4CYMA 3A1EA 4K5QA 3TQCA 1X74A 2A9PA 4P82A 3DHEA 1TKCA 4QJIA 3ZHUA 4LY9A 1YR7A 1GL7A 1Z5GA 1ZN9A 2P9CA 3MAAC 4ROTA 4MA5A 5CYPA 3RAPR 3KZVA 3JYHA 1YJBA 3Q3HA 4KI7A 1EUCA 1MDBA 3LMKA 1GLNA 4LHXA 2D0PB 2ACVA 1F20A 1GIAA 1M0WA 1TJPB 3C5CA 3L8HA 5KJ6A 4OGKA 1R6AA 3O83A 3H05A 3TZCA 4FX5A 2IGBA 2HRDA 2QRPA 1Z13A 1CQIB 1Y34E 1AK9A 1X7ZB 3Q12A 2P35A 5EYPA 1EEXB 3RQIA 3ZU3A 2X2FA 3LM8A 4C87A 1DARA 5B1HA 2X4DA 2Y92A 1AD2A 3ZZ1A 3ITNA 1JAZA 1E3DA 1DG1G 3OE5A 4HX9A 4R1SA 5CX1A 3ODPA 4LCJA 5DXAA 3VO8A 3GH1A 4GSLA 3GH3A 1FYDA 2B69A 1JG3A 2Q6IA 3REQB 4D46A 2JLAA 4EHNA 4EYGA 4DBLC 1CQJA 3KTOA 5JSHA 3K6SA 1PR2A 2ZWOA 1R12A 4IRUB 4KSYA 1RHMA 2PA0A 1QE0A 4HAVA 4Y2XA 4YROA 4C0KA 2IHJA 3W9YA 4C6SA 2IEAA 3I53A 2JEOA 2R96A 3HYSA 3BQMB 4GP9A 5JS8A 3OZUA 2AXEA 1H4QA 5CA0F 3O3OB 1O95C 4A6PA 1GSOA 3N05A 4DCUA 1D04A 4KFSA 1ZOIA 4RACA 3ZQ4A 3MTQA 1R00A 1RR6A 2WHXA 1B15A 2JGIA 2CNLA 1D7OA 3U7FB 4QHSA 1DKLA 4YT5A 1BVYF 5CFZA 4B80A 3U56A 1AXEA 4EW6A 1JDBB 2OZVA 2BFCA 2OYRA 4LRUA 1PG0A 3IJ5A 3NTQA 5F9FA 3Q5DA 4NJEB 4YRBA 2R84A 3C3XA 4I81A 1JKJB 5DHSA 4HVAA 4Q02A 1K8RA 3D8UA 4PAMA 4MI1A 1XWFA 2QGZA 5AUOB 2ODWA 1XRLA 4X45A 3ZHBA 1L5RA 4KUGA 4HLCA 1KS9A 1W52X 3BGVA 4R2MA 1R74A 1YJ8A 2ZIEA 1ECPA 3JZAA 3NLLA 2LV8A 3NB0A 4M89A 1DG3A 4PZEA 4BNYA 4DS3A 3CNQS 3TR0A 4DARA 1N32B 1WCXA 5FBVB 2IP4A 3QYFA 1ZA2A 5DM0A 1YKGA 2ASVA 4IDPA 5BYBA 3T7SA 4AS2A 4CQJA 4L5BA 1JTFA 2ZVPX 3WTBA 5CD1A 1GOTA 4PWZA 4C7MA 2NTNA 3ZBQA 3FPBA 1T0UA 1TMYA 2FPXA 3FYSA 5JSZB 4NRDA 5EIAA 1MC8A 2QX4A 2IU0A 5I9TA 1W5AA 1BXGA 3QE9Y 1VL0A 2RAUA 3N8KA 2GKOA 3RVRA 3U44B 2XWSA 4X1OA 5IP5A 3GG9A 2RH4A 3HYLA 3MA0A 4G4JA 1GKKA 2HA0A 1PBTA 4FFMA 1RFLA 4LNAA 3ZVRA 3JAWA 1T0BA 2IUUA 2FWBA 2WTNA 1VZ3A 2XKBA 2DQZA 2X5XA 2XH8A 1N3LA 3KZXA 3N75A 3OM9A 4NE9A 4Q9IA 3V7WA 4AN4A 1J0BA 1EK5A 3SX0A 4WN3A 2HA7A 5JYDA 3EAQA 4PHHA 5ICFA 3OKAA 5JRZA 4G2NA 1E7WA 2YJGA 2D5IA 2OORC 1SXHA 2DP4E 3IBTA 2DKFA 1QG2A 3LNTA 1A0OA 2RSLA 2C20A 2I4MA 3KFLA 1Z8FA 3HP1A 1JDTA 3HVHA 3N0RA 3NV7A 4L2IB 4XWAA 3FDXA 5EJAA 4F96A 1P4SA 3DBRB 2I55A 1MA0A 3SX2A 2FMKA 4YAIA 1DPGA 5CH3A 2DYKA 5DW3A 4FE3A 3ZTYA 2A5FA 5H3HA 3WMRA 1N5DA 3NGLA 3ZTWA 4AQYB 4IHJB 5K0EA 1RCUA 1UWVA 1G0NA 3TEMA 1HRKA 4Q4DA 1HYGA 3CLRD 1MH1A 5JCXA 1PT8A 2LP4Y 1MRSA 3LTEA 5F2EA 2M6SA 1QAMA 2OECA 3G8CA 5DOZA 2CL0X 4Q9NA 1KVSA 3NUZA 5EMKA 3S2ZA 4IGEA 2CXOA 4A3SA 4MQEB 4E30A 1U7ZA 3MTBA 3NV9A 1WXWA 1BDJA 3B9QA 1SB9A 3T7JA 1T9GR 2JGDA 3ZV5A 3OA0A 1U3VA 1BEEA 3RKSA 5KQMA 1SCJA 3QRWA 4YMSA 2DU8A 3AUTA 2VWQA 3DM5A 1IUOA 2ZU0C 2AMFA 3B1WA 4ZN6A 2B1RA 2C2OA 3FPKA 3RC8A 4A0SA 1E5XA 4I5IA 4BRWA 4Z7JA 3GC6A 5GJVC 5J63A 2NUTB 1I10A 2GTPA 1VZ2A 1Y4ZA 2BYTA 2EF0A 3R40A 2Y6UA 1MJHA 2XXJA 3EJWA 4PX9A 3GCZA 3REGA 5JI2E 3T52A 2NMVA 4ERXA 1IB0A 5KYUB 4EHIA 3WDMA 1A2BA 2P6UA 2IEGA 4A91A 1UPAA 2WPDD 3U19A 2L17A 1YBFA 2PX8A 1Q0ZA 3EIXA 4HC4A 4G0OA 2WUDA 1A5SB 3CLSC 4KXMA 1L1FA 1JDSA 3VTFA 1UJ4A 1OLXA 3ZHYA 4EB6A 1XMQB 5LU9A 4DQKA 3W6UA 2O7SA 2XE4A 1Z4JA 4WHMA 3GY0A 1BYUA 3PSHA 4H0FA 4Z4EA 3HGTA 3USCS 1SCIA 3PR1A 2GN6A 3K2BA 4LOIA 1R18A 4WXEA 3L4BA 4ER3A 1IN7A 4YMTA 1NUAA 2IDZA 3DDUA 4ZHSA 3VV2A 4K9DA 3GL9A 4CI9A 3P2IA 2JIZD 1W96A 3GHHA 2QLJA 3QLEA 4JY7A 1EHYA 5J1TB 3UO8B 1C4WA 1N8NA 2FW7A 4RQTA 3HWSA 5D51S 4ANFA 4CLOB 4CHTA 3AEXA 2WFLA 1NVBA 3BMXA 4H0NA 4LXXA 3VKHA 1M2OA 1MIOB 2P6RA 1EUZA 1V7QA 5GJCA 3SQLA 3QI7A 5FJIA 3R7NA 3ZD7A 1PR0A 2BKAA 3BF7A 2XCLA 3HCEA 4CQLB 3U5ZB 1SVOA 3USES 4OH7A 4BIIA 4DXAA 2ZR0A 3KE8A 5DNVA 1V6CA 1UPBA 4JQZA 1UQUA 3E1GA 3AUFA 1GDTA 4AKTA 2WYOA 2J0UB 1JLLA 2RMKA 5EFZA 2JGDB 5K51A 2D3TA 1SOWA 1ZD8A 3KHUA 1NNI1 2Q3EA 3GLGE 2FGJA 3P26A 5L4NA 1GAXA 4ASUD 1RQPA 2VAVA 4TYNA 5FBRB 1L7DA 3O9MA 1T8TA 1TYCA 5EZYA 1TZ2A 4DVJA 4IHKA 5AKHA 3ZU4A 3U7JA 3WDSA 1JFLA 4PGAA 4QSHA 1NT2A 1H2XA 4G0QA 1UDXA 3LQ1A 2IXEA 2WNSA 4LV5B 3M1AA 1K7CA 4LKRA 4NU0A 1PNOA 2AFIB 1E60A 1R9MA 3WMWA 4DPLA 2XDYA 3I05A 2Y6VA 5TSDA 2H2IA 3F47A 2ZTLA 5K2MA 3V8MA 4C1BA 2ZM6B 4O4HA 2ZUBA 5EZYF 2QBYB 4XUCA 1DUSA 3OH8A 2WM3A 3EHDA 2AVDA 1Z6PA 3WBKA 3CRVA 3HWWA 3QXSA 2FMIA 1U9CA 4GYYA 4QM7A 1SVNA 2RIRA 3AVPA 4IF6A 2AFHA 4L02A 3L5KA 3U31A 3RRFA 3HNPA 1C0KA 1IY8A 4L6IA 1T9ZA 4P31A 5I7UA 4XYMA 2Q5LA 3TFOA 4BQPA 3L0ZA 2HK9A 3EF1A 3TM5A 2YN2A 4BFLA 4KXUA 3OO1A 1X70A 3DAGA 3TL6A 3N74A 5JVDB 3TRFA 3PX7A 1P7VA 3N5KA 4FYKA 3IHKA 1D6MA 1IHDA 3G0CA 3F4LA 3T61A 2C94A 5AW9A 4JGIA 5K03A 4ZV4A 2VHZA 4S35A 3WB0A 1AGYA 2QL6A 1ACMA 1PWXA 1QQAA 4ZT6A 3PJDA 2EERA 3Q7SA 1PUJA 3G9UA 4AY2A 3P9PA 1FFHA 1JLKA 1X7WA 2ZWPA 3DOHA 3PQDA 5KDDA 2JAUA 4YDRA 4DM4A 5KINB 2HX1A 1WCWA 3OESA 2DOKA 3UAVA 4C4RA 3P4UA 3CQ9A 4WK0B 3B1ZA 3TD6A 1ZCFA 2EVWX 3UUFA 1DAPA 1KMQA 4QO7A 4TSFA 1DDOA 2SCUA 4FI3C 5HXAA 4DJ5X 3VR5H 1CB0A 2HSZA 5KTYA 4QYIB 3B6KA 4MK4A 2HCBA 9ATCA 3EVBA 4YIHA 5B1EA 1L1RA 2UV8A 4IGAA 3FIJA 3TPFA 1ES9A 3NHZA 2J33A 1YGPA 2QXYA 1NSYA 4NE2A 3DMNA 5C1IA 3ZHSA 3DVAA 1CYDA 3FF1A 4N3BA 3V8NA 1ZINA 1O0CA 4GX1A 2Q5CA 4AROA 5LJIA 1VMKA 4ZPXA 5M34A 1DMSA 1V26A 2QY9A 5BSVA 4GAEA 4JI3B 1H2RS 4TZTA 4XYEA 4TL6A 5FT9A 4DEYA 1DBSA 4H1VA 3C3YA 3CRNA 1E7MA 2XJ9A 3SMVA 2HR1A 3VNSA 1RBYA 2CF6A 1DKQA 3FYCA 2OGTA 1ESZA 1SVWA 2VVTA 3IUJA 4GKVA 4HMOA 5CB0A 1B8UA 2J3EA 3R8CA 5A06A 3P32A 1G6OA 3Q2IA 3A8TA 2PTGA 4NZ9A 5ESWA 3THYB 3CHYA 4KXWA 4EVRA 4X97A 2Q7DA 4QXQA 2FN4A 5HOQA 1Y89A 3G2HA 3M6WA 3EAGA 2VDUE 4YQEA 2WIJA 2CHQA 5JPCA 4G9EA 1B6SA 1JYSA 1B26A 4I7EA 2WJJA 3AKCA 1A9OA 2IYXA 2WIAA 3AF6A 4GQBA 1O6BA 2ZRAA 5IBQA 5LMUB 1KP9A 2PUVA 3ND9A 2C5GA 1X14A 1NFFA 2IOHA 1WUYA 4MP8A 3UAZA 3AOEC 5BWCA 3KAKA 4WKNA 1CY4A 5KYXB 5DNWA 5CM2Z 1Y9EA 5SZKB 2O8CA 2VNSA 2W71A 2RHTA 2HB6A 1J2YA 1HE3A 3M49A 4REOA 4XASA 4BVAA 5IAAA 5IX8A 4S05A 3NBUA 2J48A 1SD2A 1VE7A 4LHVA 3N6VA 2B25A 5BV0A 1QS0B 4R5MA 3BE8A 7YASA 2VF5X 3R4CA 2Y71A 2O7VA 2FGKA 1GZ5A 2B1QA 2G63A 3FOCA 3HCCA 4M7RA 3VOSA 4B32A 1GSHA 3TX2A 3QEAZ 4MYHA 3DEHA 3A6LA 4CODB 2W5UA 1M6HA 3EZXA 2G6TA 4BCCA 4X63A 2RBEA 1N5OX 4MS1B 4ZC8A 5TF4A 1KVQA 2O14A 5JQGF 1OXXK 1QO9A 3INNA 4JYMA 1JHRA 4P7GA 4DV7B 5A7GA 5ADWA 2XB9A 3HV0A 2IJGX 3T9FA 4P5PA 2H3EA 2IOFA 1RHRA 3KEGA 1E1RD 2XIJA 2ZE6A 1K7EB 3MTEA 4MYCA 3S8MA 4FDVA 5A7HA 2OMEA 1GKIA 4Z0PA 4RKEA 2MJLA 4NFLA 3GZ4A 1O94A 3FR7A 1IBMB 5K6RA 1PW5A 1ORTA 2R6DA 3B60A 1YRWA 3C14C 4HCJA 2PMKA 2X8AA 2VDMB 3K6KA 1ANKA 4E14A 4PVDA 4F9GA 4DC9A 3H1BA 2IPOA 1E2FA 4LZWA 1QQBA 1JIIA 1WOYA 3GMDA 3NHLA 1HNZB 3BJRA 3K7EA 2EF1A 1Y3AA 4EKDA 1B23P 4R6WA 4U8GA 3CF0A 4U7TB 1ZXLA 4TVKA 5E9JA 5HPYB 5E0KB 1LWOA 2A84A 2Z83A 1EG2A 4O63O 1LLDA 4UVEA 3P20A 3WAKA 4C4TA 1TEXA 3B7GA 3JVUA 4MWOA 1F7VA 2IPXA 3SF8B 2PX3A 4YIKA 3MGCA 1WZNA 4DLNA 1YS9A 3HFJA 3NAQA 1XTTA 1XD2B 4JJIA 4WUTA 3OKFA 5K3CA 4BJ3A 3PGMA 5EWLA 1Y6RA 1TEVA 2WHQA 3ORQA 4FLMA 3HUEA 2DBZA 2HSGA 5JC8A 1G17A 4UE3S 5KTTA 4H60A 1LX6A 2QL7A 1CF9A 4ZAGA 3SZRA 4F3YA 5LQDA 4KQJA 2PZAA 2W83A 4D96A 4ZALA 3KPYA 4WNYA 1BDBA 4A8JB 4RE6A 4DV3B 1O7JA 4J7XA 1ZMOA 2WICA 4IQ8A 1CTQA 2BHTA 2HZ7A 2XD9A 3MRXA 1JWBB 1X7WB 1TM7E 3MMXA 3WWEA 4DR6B 5TJ9A 5C1DA 2NZVG 1X3SA 2POCA 1N2IA 2NZJA 3Q8WA 3RYIB 1DV2A 4O0MA 1FVXA 4JI6B 3WAGA 1FMJA 1QFMA 2X1MA 1B6GA 2O8NA 4BNGA 3WLNA 3MWKA 4GO1A 3WRWA 5BSEA 1T0IA 1V3VA 2VRBA 4RM2A 5B1SA 5KHAA 4QNRA 5HNKA 3FVQA 4BKOA 4LSWA 5ALHA 3D4LA 4KFTA 4RABA 1P6UA 1GPKA 4Y1FA 4MNTA 5K0BA 5FUVA 2CEAA 3SYTA 2ZJFA 3EEOA 1J5XA 1H8HA 3TLMA 4BWVA 2GPYA 5DK4A 1XLVA 1ZCJA 4LWPA 4R69A 2QVYX 3OU6A 1SVIA 4CEIA 3BVPA 1S8AA 3HY3A 4NH0A 1ZEMA 2QUZA 1BFKA 4CMGA 1E1CB 2YN4A 3DDHA 1U3TA 2AE2A 3IQZA 4IGFA 1WUHS 1L7XA 5ESXA 2NOAA 2BMAA 1FQOA 1G8MA 4C7BA 4MDYA 4J16C 1WLYA 1X13A 2NTEA 1RPTA 4Q3CA 3B6JA 5CLIA 3PYLA 4YRJA 3ZKAA 3ZNOA 2K7ZA 4OMFG 3CNNA 5DGHA 2GD0A 3EEFA 1EVYA 3I4FA 5E3IA 2A0UA 4XFDA 5DBHX 4YYZA 1C0IA 5JNSA 1E1QD 1M10A 4TROA 2EW8A 4C3ZA 3UPUA 5IVHA 1DJPA 2EKDA 4L51A 1LZKA 1L7RA 2HA3A 3V8PA 4DV2B 1R0YA 2JAQA 3NAGA 1DT3A 1E9SA 3A6ZA 1WZIA 2YXNA 3T0GA 3K9GA 3DD1A 5CX1B 1HZZC 1ZU5A 1H6CA 3LPAA 1RWWA 3LPDA 4MWDA 2ZR9A 3ZY6A 4UUOA 4ATNA 3N1UA 4URZR 3HB9A 1CQIA 4B83A 4DLVA 1KDVA 1O0SA 2RCNA 4W9MC 3LYAA 4FJ0A 2BBSA 3EMKA 3Q7RA 4OXIA 1FMTA 1VP3A 2GEVA 2P4UA 1QO7A 1DQYA 3KEOA 4UMFA 4HK4A 2ZM5A 2XBMA 4KVFA 3HCRA 2WJAA 6REQB 3Q2OA 1KP3A 4DLYA 2P9YA 4MKHA 5IVIA 3A1UA 4G41A 2XHEA 4OMCA 4QLBA 4MS1A 1T2CA 3K1YA 3KUCA 4IEEA 3RIEA 1BRTA 1KK0A 2DCUA 4RQAA 1Q12A 3ITEA 3VR0A 2D0DA 3FVWA 1Z16A 2O20A 1EQUA 2E4WA 1SXJE 4W9NA 1E2EA 3EPRA 5E2IA 1YR8A 3IP6A 3A3PA 4GP6A 2AF4C 3DZJA 4MV7A 3ZE1B 3NXSA 1JA0A 1BW9B 1YF3A 2DMRA 3U1VA 3HN2A 4IH9A 5BUCA 1SZPA 4WXPA 1IHYA 4R3WA 1MLDA 3KP1A 5K3FB 5FUWA 3VRHA 3GJQA 3HKDA 2IZ1A 4UBLA 1UDAA 3CTPA 3GAAA 4NECA 4AECA 2O8CB 4U8HA 2CMDA 1FW8A 4LXTA 2YIJA 1KQOA 1XJ5A 4OYHA 4WBSA 3WJAA 3DMRA 4UUBA 1AUQA 1M6VB 4BP8A 1KY5A 1WLSA 3RSHA 1P9NA 1ZUNA 1MO3A 2DX7A 2BMJA 1Y9DA 1LVUA 4GR9A 3NOOA 4CEHB 4I9GA 3X1ZA 1EXWA 1Z47A 5CW1A 4D43A 2X2EA 1NJ5A 3GVCA 3SJBA 2QVLA 4KIWA 2CLFB 3PWZA 3TRIA 2DERA 5T5QA 4D97A 3D0OA 2AUNA 5CMLA 4QYTA 3N0WA 4BFTA 2P9TA 2IH2A 3D7RA 3NM4A 1LDYA 2JI8A 4ENTA 2QZZA 1GCUA 2PUAA 4ZCSA 1RYZA 2OB1A 4LZOA 1CUDA 2XNCA 1VJ1A 1ONOA 3ABOB 3PPYA 2PSHA 1I3OA 3W5CA 1IHOA 2R6GA 3NHKA 4XX1A 1ULUA 2JFZA 1K8YB 4PRLA 521PA 4CBVA 2AFHB 3ONVA 4QWWA 2CYBA 3GP8A 1IEVA 3M4NA 2CNWD 3C41J 3VA7A 1G21A 2OCYC 4X7RA 1GT91 4R01A 1XG5A 2C84A 3DPSA 1GCOA 3AVVA 4B75A 1QF7A 2WK1A 3C7DB 1QHNA 4EA7A 5JXHA 4MLZA 1MNQA 4HN9A 2UXDB 4AZWA 4AKGA 1A97A 1PF7E 4R9VA 3AVUA 5AVVA 2O6HA 2D2VA 1NMZA 3L43A 4CV1A 5HK9A 3CT6A 2YVAA 3S2UA 1W5SA 2H5EA 2ZBPA 4X24A 5F1YA 3BFKA 4AJOA 4JI4B 2NNLD 2RE8A 1WULS 3RYTC 4DDVA 5J4KA 5ALUA 1SA0A 4I9FA 1DELA 1D2EA 4MQ5A 2BEWA 5KX5F 1Z4PX 1PNQA 4NV3A 1WJGA 4TLCA 5HQJA 1JEEA 4TQ9A 1O9BA 2FU5C 4Z0TA 1O5TA 4RF2A 2QDXA 1ZL0A 4UVIA 3O95A 2FR8A 3UMFA 3ZVLA 3NWBA 3TRJA 5CFQA 1W87A 3LX4A 4CWAA 1Y8QB 1DZ3A 3HHEA 5DYYA 4PGMA 3JQ7A 4AMBA 4DJAA 4H3HB 4XB1A 3P9CA 5E9AA 3NYRA 1PYOA 1EWKA 2GN8A 3PXEA 4MVJG 4NC9A 3IAAA 1T10A 3PIDA 2I78A 2W6JA 4FYMA 4MUEA 4CF7A 4NZYA 2H5LA 1C9YA 3ZDQA 1UXHA 3LOQA 2VCHA 4HQKA 3W9BA 2O8FA 5E6UB 2C83A 2BMDA 4G5FA 4Q3KA 4KCGA 1G5FA 1FNCA 1EFRD 2ODNA 1V6SA 2GPAA 2XQIA 4M98A 2QN1A 3RJ9A 1Z6TA 3DO6A 1P0QA 4L3WA 1BU8A 4J03A 1C81A 1IEWA 1NVVQ 2JD0A 3GRAA 3JQAD 1P2FA 1L5GB 5CDHA 2WVJA 4LOHA 1XZEA 4ZQIA 2J0VA 2V3VA 1JHPA 1H2ZA 4BB9A 4NK5A 5AM1A 3BMNA 3OF3A 3QNWA 2V0NA 2Q21A 3NAMA 3K94A 1EX9A 2X77A 4M37A 2FXVA 4P2BA 3IELA 2OUIA 1CE8A 1OXUA 1DNPA 2BFBB 1F0YA 3CX6A 3LBAA 3I2HA 3LK7A 4ZAWA 4C4YA 4EKNB 3EJ6A 5T7BA 2AOTB 5L8VA 2AC7A 1MZPA 1J8FA 1RDFA 1POXA 4AKHA 2V7UA 4QUHA 3VC1A 4ENQA 5DCWA 4BQRA 3RR2A 5CB6A 3OBIA 5HS4A 1U7PA 1K3FA 2IXFA 4MMXB 3ROKA 3TJRA 3BXZA 3FPSA 3O3CA 5EJ9A 2HGSA 2P62A 1NVVR 4UEOA 1GPYA 4Q1BA 4LC1A 1WD5A 5JHHB 3W5BA 1VKHA 3L7KA 2OYCA 4A26A 1KQGA 2VUHB 2NWQA 3U3RA 1NUHA 1P7WA 1R3DA 4B31A 2ZSIA 2D2IA 4YB8A 4I1VA 3KZMA 4HQ0A 1M8KA 5HE8A 1Q19A 2V6BA 4L8YA 3UHOA 4MUIA 4PSKA 5CJ2A 1EWRA 2KW5A 1CNMA 4KFUA 3WMGA 2H2FA 2CT8A 3RSLA 1GN9A 2G09A 2NO0A 3WNVA 2VZLA 4CCSA 1TQ8A 3G0BA 3O93A 2IY7A 4IH1A 3KR9A 3KKNA 5AVXA 2XVXA 3AF3A 3PT9A 1EH5A 3WBJA 3DQQA 3CBGA 4FR0A 5PGMA 2W2OA 5ALEA 4D2IA 3HVJA 4D8VA 5EJGA 1YAHA 2AK2A 1TECE 3K0CA 4DA4A 1YZUA 3SZOA 2NVUB 3MS4A 3BA6A 2PH5A 3ASVA 4J43A 3ZK7A 4CKBB 1DKNA 4BWYA 4AYTA 1EUCB 2VTKA 5KX5B 3IP9A 3KQPA 3CF4A 2V5UA 1G8JA 1CUSA 1ODKA 5TEWA 1F6WA 2WW8A 3A3KA 4KQIA 1F5SA 1OFVA 1T36B 2XCRB 2FEAA 4J7AA 4IDEA 3TKAA 2CSUA 4IMIB 4YDHB 3TSZA 3COPA 3OCWA 3PX3A 4YR7A 1SOUA 4JITA 2XGOA 1KJNA 3RF7A 1CVIA 1IY2A 3GLIB 3EE6A 4Y18A 1AS3A 2JGEA 1YBHA 3JD1A 2LIPA 4QJ5A 4YP5A 5HX7A 5JZ9A 1G63A 4RCVA 3ZK9A 4HEA1 2A0KA 1EFVB 1NVMB 2Y1GA 4DDKA 2A9FA 3PIIA 4QQKA 1QGDA 4INPA 4DA9A 2YFKA 2SICE 1FDRA 3MINB 1WPXA 4CCYB 1L4EA 4LS3A 3RVQA 2XNJA 4NK4A 5F23A 2ZI7A 5IC4A 5A6SA 2F3SA 4TKVA 8GPBA 3SBXA 1P61B 3HXTA 5K0GA 2R0QC 3MUOA 4Q9LA 5TPZD 2HA5A 1EZ1A 4UM9D 3ZJ5A 2MDTA 4UKDA 4NDNE 2I4OA 2ZB4A 1R3UA 1NM5C 4R7GA 3IR7A 4MVJM 1ADJA 4TYWA 4Q4LA 5SICE 3IALA 4X8HA 1UADA 2QTFA 5HK8A 3SFVA 7REQA 4GQIA 1X6VA 1NYQA 3I6BA 5EIHA 6LDHA 2R86A 5CBPA 5BO5A 1EUYA 4XVHA 4XVRA 4U5QA 4I4TB 1RCTE 3H17A 5IJAA 3ZZ0A 1E92A 4X20A 4FIZA 5ERXA 4K9QA 3R3UA 1OD6A 2J6IA 3QPDA 4CKEA 4F4DA 3BPSA 4RSGA 1SBNE 1XLWA 3WZLA 4RFSA 2ZJZA 1BX1A 2QTRA 3BAZA 1PJLA 2O52A 2MYNA 3IHTA 1JGTA 4OATA 3E9DA 3LYUA 3PE3A 4UTNA 4MA4A 2HQ1A 2X6QA 2YS7A 4PX5A 1RZRA 3ZDBA 1YOBA 1DWOA 1AQJA 1XNRB 3FGNA 1KSGA 4CQMA 2EJUA 4XFKA 3FMIA 3ED1A 2QD2A 1ULBA 1W29A 4GP7A 1Z0IA 3GRFA 4GPZA 5H68A 4DMMA 3AEYA 4F0JA 5JOQA 4R5HA 4C0SA 4DR4B 2DHCA 3M6MD 1JPVA 3R5TA 1EP1B 1GM5A 3KG2A 1TADA 2FR1A 4LJ9A 4JLJA 2XB4A 3K4QA 4DLRA 1YH3A 3DE0X 3HVUA 4PIPA 3PR3A 2PFGA 4JMLA 4PPNA 4UNSA 5EUBA 4HBGA 3UJHA 2X5KO 3RV3A 2WKPA 4FHDA 3H4IA 5AUPB 1J70A 3R2JA 2OD7A 5F33A 3BXEA 4ZQGA 1DHTA 1Q1AA 3S81A 3OE7D 1P9RA 1KOJA 2IIPA 2VEOA 2ZJYA 1DWPA 4MLDA 3WKDA 5BOSA 2Z6UA 3U9LA 2HSWA 3BFPA 2B0JA 2G36A 4B4OA 4U39A 3FBTA 4AW9A 2AV6A 3KE9A 4UZEA 4YH1A 5EVCA 3TD9A 1T6NA 2VIIA 3V3KA 3WXMA 1MGOA 1I4LD 3I9KA 1AF7A 2WAAA 3H5TA 5B64A 8ADHA 2C7PA 1KY3A 3ETGA 2CEKA 3BK2A 3DMHA 2V9PA 4KXVA 5ANRB 4DQDA 5I9LA 4B2YA 2FHPA 4H4CA 2O4CA 3DGEC 3HMKA 4YRDA 2IOYA 3SX4A 1GG8A 2HFKA 1WCIA 5ETJA 1NOKA 3GJ5A 5DW0A 2WJZB 2AW3A 3DDNA 3N2KB 3RSGA 3WGVA 2OLEA 1P5JA 2ORYA 4LRTB 4BU1A 4QBFA 3R7SA 3TQFA 2XWBF 1EWYA 1TA9A 5AOBA 1RWMA 3W8EA 4DSNA 1SU8A 1JEYB 2ONCA 2O2DA 2XXBA 5KPJA 2GD2A 2TRSB 2O2XA 3E9RA 2OFOA 2XMPA 2PN1A 3AEKB 1BVRA 1RQNA 3EA4A 3F67A 2BFCB 3LECA 4KIJA 5CEEA 3S1SA 3I6YA 4X61A 4Z3DA 3RS5A 2H06A 3QVGA 3Q8XB 4UD6A 4LJKA 2NU6B 1KOGA 2DUUA 4LC9A 3VYRB 3W8DA 3ZHZA 1TA4A 5EMNA 1UZUA 2A92A 1A7UA 2O5RA 1V41E 2CLDX 2E4XA 2HMTA 1A98A 3NYIA 4MR9B 5BVGA 5ALDA 3AERA 1LBHA 4G24A 1KI4A 1TO1E 2Z9BA 3WV4A 1AKEA 4UU0A 1R0RE 2ZSHA 3VZRA 3SZLA 2BM0A 4YNBA 1TM4E 1NKTA 5GY7A 1RTTA 4XDYA 4QUEA 3H6HA 3LXRA 2ZYVX 3NFYA 5FBHA 1SCDA 3ILVA 5DI9A 3PEUA 1FE8A 1IPFA 1JIJA 1IHXA 3W5IA 1U0JA 4U7DA 5DLPA 1WQ1R 2B83A 4BLWA 4YPOA 1UKAA 3H9JA 1A7AA 2G82A 2YRXA 1W2GA 4X1IA 2DY0A 1BE8A 1BXGB 1D1PA 1IJEA 2COEA 3SR4A 4A5SA 3BHIA 5JQGA 4BXOA 1SIWA 5TY0A 2X4GA 3RIHA 4HWRA 2APJA 3X1XA 1E7YA 1NPTO 3DOOA 4HFJA 3HCWA 4UUQA 3LKDA 1YA4A 3CIFA 1I3KA 5K6AA 1PJZA 4OJMX 9LDTA 1E1YA 3O8BA 1XMJA 2PKRA 3OZIA 3HYTA 3UNXA 4CCYA 5I8WA 4UHCA 1UBHS 4I46A 3NHUA 3U4CA 3KXKA 1ZM7A 1TUGA 2QD5A 2PLAA 4P93A 4MPPA 3E3MA 2JKYA 2NXEA 2Q4BA 2QZSA 4Q6BA 4UM9B 2ARKA 2JCBA 4R41A 3IQGX 5AVKA 1WZCA 2OV4A 1SG6A 2QG9A 2XMQA 3HA3A 3KXDA 4JXJA 4MVJI 4IDQA 3NH9A 4OGWA 3P71T 4B85A 3FUWA 2IYPA 4QXMA 1J56A 1ZFNA 1JAXA 1ESMA 3SYLA 1H1TA 3KKKA 3S27A 5U1PA 5CCBA 1OXTA 4X6XA 1U02A 3WP1B 3UHAA 2O2CA 3TE6A 3BJZA 2Y0EA 3RT9A 4QTUB 1WCV1 5CAEB 4UEQA 4U3JB 3M4YA 2BD0A 5J2UA 2JBAA 2ZUFA 1CRLA 3EZYA 4CKBA 3T3NA 1D9ZA 1J33A 1Z0DA 2ANBA 1C7EA 1HGXA 2AFIA 1LX7A 2CLOB 2PYZA 4HS9A 1CIJA 1XU7A 4LDAA 5JE8A 5U4XA 2DLDA 1TX4B 3Q85A 4FD2A 1N57A 1RXIA 1SBHA 2OFWA 1FPMA 3MFQA 5FTMA 4C3OB 3OZFA 1C9EA 1YSCA 2MSDB 4GKAA 4BVFA 2FUEA 1AMUA 4NBVA 3Q3IA 1NXWA 5THQA 4JI1B 1UM8A 1CUWA 2BCEA 2F1OA 1XKQA 3GZJA 3UM9A 1FTGA 1MG5A 1XF9A 3AYXB 2KHZA 5A3SA 5AM4A 3WTCA 3N3AC 5BWMA 3VYWA 1LQUA 1ZVJA 5IZCC 3IT0A 1CR4A 1FFAA 2OB2A 2J30A 2CMFA 3B1KA 1NP6A 3R9XA 5FDFA 1KDZA 1FYVA 3B2NA 3VKVA 1DCKA 1GKYA 4LQ4A 1NVGA 1GR0A 1R8SA 1XCGB 2CMHA 2WAMA 3QTBA 4ECAA 2HW8A 4PC6A 5LP6F 3A2LA 3KB1A 1V5WA 1I2BA 1TQDA 3GOHA 5B58T 5A6VA 3LO8A 1EDDA 2UUCB 1CR2A 1L4HA 4CL2A 2YJ4A 1C9JA 3HLKA 5EZ5A 5C5DA 3ILHA 5IM5A 2Q8QA 3WLQA 2OO5C 1XDWA 1U81A 3AHDA 5AJVB 4US1R 2F3RA 4KLRA 1E6CA 3AI1A 2NO5A 3FCYA 4CZ2A 1DTEA 1P0MA 1JX6A 1U80A 3DB1A 3MMSA 2MYTA 3DNPA 5DYNA 5C53B 3BMOA 1RWNA 4LSGA 1P4RA 2EIHA 5JLAA 5EZSA 3ZU5A 3QI2A 1I3MA 3AR8A 3NYQA 5KWSA 5MHTA 2OCAA 4RTLA 3QGMA 1ZVMA 4BLQA 3M6XA 3TH5A 4IEIA 3AM5A 3KKZA 1PZFA 1RRKA 5CT6A 4BMOB 1NASA 5KOHB 3TN7A 2ZIUB 5SV2A 2IW1A 3AQIA 3HDGA 3ADDA 1DDIA 3DC2A 1JQ5A 3L46A 1GGHA 2FDXA 4ARSA 4N3AA 1T9KA 1Z4LA 2HU5A 2PKYX 5JO0A 4R31A 3D1VA 1CY6A 1O5OA 1N25A 1V1MB 2QTVB 2PWYA 3L79A 1QF6A 5KNCA 2JIZA 4QG3A 5IANA 2ZANA 2REBA 1KFEB 5G41A 2Q4TA 3UXYA 4OI2A 7MDHA 2BFFA 1S9DA 2B92A 3GFGA 4NVRA 2P8JA 4QGFA 5G1OA 2FUG6 3TQTA 4EYOA 2RHHA 3HG7A 8AT1A 2YXDA 4DDHA 3FFBA 1V1RA 4F93B 3TRKA 4UQPA 1TQ6A 3PGKA 4NH4A 1XF1A 3QY9A 3CU5A 3EC7A 2AOVA 5LD2C 1KMNA 1CIVA 2H65A 4PO1A 1CS4C 4BE4A 1UKYA 1GQ2A 3BWVA 4YLEA 1WVGA 1ZDMA 2I3GA 4NV1A 5F7JA 2QXUA 1DCTA 3JZFA 1Z9BA 2FLWA 3RS9A 3CRMA 4C0WA 1YFJA 3HR8A 5FH9A 1L8LA 2JH3A 3ND8A 4RVUA 3SIWA 3UT5A 1AKRA 5FWNA 1GP2A 1M6YA 1LA2A 4D57A 1KI6B 3AR2A 4L76A 1BQEA 3QKTA 1XZPA 2ECQA 2C4HA 3KKOA 9GPBA 4QUDA 2CUKA 1FC0A 1RHJA 4G0ZA 4IYRA 3FYHA 4C08A 1ACLA 1FS6A 1HLPA 5L3ZA 4C7KA 3KT8A 3HC7A 3TTUA 3VPSA 2YV2A 1CKEA 2RHCA 1GRCA 1W44A 2FYTA 2PL5A 1TNDA 2WFMA 1QIFA 2R25B 2VHYA 3JZDA 5A4AA 1E61A 3EC2A 3HVIA 5BRAA 3W1EA 3OJCA 4KSCA 4X91A 1A8QA 3PXUA 3AR7A 3HPQA 3NTXA 4UHKA 1XRQA 3MQ2A 4KGXA 4O8CA 4J6EA 4JL6A 5HDQA 5GP1A 5LUAA 4TRRA 2NUAB 2W2MA 3UBTA 3K70C 2Q3JA 1YQ9A 2O7QA 4IXNA 5REQB 1RJWA 2VQFB 1OWMA 4DF3A 5FAXA 3UMVA 1LRJA 4I5FA 3ZCTA 5EPOA 2BGUA 3ZG6A 1HDOA 2BPOA 4XAQA 5EIBC 1KK3A 4DCCA 3A6PC 2K5UA 4CLXA 4YCDA 4JR1A 4DLUA 3HDVA 3IO5A 3SPXA 1VPWA 3LPMA 2EWVA 1ZD9A 2IVZA 4GX5A 4P5EA 4PEVA 4LFAB 1AHNA 5JMTA 4JI2B 4M87A 2G0TA 2AK3A 3CVWA 2C2KA 3RG2A 1SD1A 3UGTA 1WXXA 4MQLA 2I3DA 2OCIA 4EUNA 3MWDB 4YHHB 4H08A 2GPSA 2AZXA 1WMFA 3SYKA 1BD3A 4IG4A 3JU3A 4I1PA 2XRZA 1P74A 1XCOA 4ACBA 4EGQA 3MTAA 5ILQA 4Z1MA 1NR5A 1J0CA 4B3HA 4ZI3A 1D6JA 1YMUA 3BXFA 2O2EA 4MVJP 1EGVB 1QAOA 4I1UA 7MHTA 4C5AA 1C4OA 1BN6A 4BGIA 3C3PA 3L0CA 4EJFA 5K45A 3ICQB 1G41A 4OQNA 2P2LA 4PE5B 3U0BA 1ULSA 3GW8A 4TSFD 4CMHA 3BFVA 4JH0A 1AZTA 1ETUA 4L95C 4OQPA 3UAWA 4DR7B 3IQFA 2Z6AA 2IYRA 1IN8A 4KQ2A 3HGMA 5EMLA 2VQEB 5F51A 1EG7A 1W75A 3R74A 3KM0A 4XR4A 4OI1A 3TLJA 3QU9A 3BERA 1IXZA 4LGMA 4QARA 2P68A 2DULA 3ZGZA 3KUXA 1TI7A 3UWPA 2DJIA 3KQSA 3DWFA 4FFBA 4G9GA 3X1DA 1EVEA 1U9IA 4AUKA 3FDFA 2JVIA 3D1LA 4BBPA 1Q7EA 1R4MA 2X0RA 4TMTA 5AJHA 4G85A 4V0NA 2UZ0A 3D6UA 3GGSA 4K9SA 4R8VA 4DN6A 2B1IA 4TZ0A 2QPAA 1LPSA 3MWEB 4LNUA 3R7DA 1N9KA 4NBWA 1U4SA 4HKTA 4RKFA 3R3YA 2C07A 2IBMA 1X7ZA 4JVOA 1VFNA 4N47A 1K5DA 2WU0A 3QW2A 1DQPA 4LYHA 2HNAA 4UULA 4EG0A 5H3CA 4IS2A 3FOFC 1SY7A 2FRDA 5HJ5A 2REQB 3SY8A 1OFTA 3GFRA 5EJ5A 1EVLA 2ZUVA 1YXMA 4XCXA 5D00A 5F5NA 1JNYA 2JK1A 3AVXA 3MXOA 2D5BA 2NZYA 3S1AB 1I01A 4RK4A 5EERA 3PXCX 4DCNA 2C97A 1LBEA 3V5NA 2XRMA 4JLAA 1P81A 3OKCA 1I7DA 4MW2A 4JBXA 5C9ZA 4QHTA 2R11A 2UYHA 2CVHA 4POAA 4CG0A 1PGJA 3VU8A 5L3SA 4RETA 2BSQA 5TGZA 2W6QA 3I6QA 4B5KA 3OOHA 1BQ3A 4U9IS 4B87A 4FS3A 3UATA 2HXGA 1R9GA 2XPCA 2ZQZA 3NHMA 4FZJA 4KXYA 1UZAA 4IV5A 4BVEA 3U44A 2IUEA 1JPJA 2OMKA 5FV4A 2VDOB 4E5VA 3VI3B 1KYYA 2YDYA 1TM5E 2BHLA 4BX0A 1BWQA 3LYLA 1K7YA 2CBGA 1YJ5A 3FRHA 4HAUA 1VDMA 2IHVA 4ZVRA 2NQ8A 2VH1A 2KQUA 2V54A 5L95A 2VDWA 4O8ZA 5IVDA 1M33A 4QEDA 5KTRA 1VKNA 2ZS7A 4RVNA 4QGSA 3VKUA 1X0XA 3KVYA 4RK0A 4BV9A 4PLHA 3DUWA 1OTYA 2A5YB 4YAGA 1HMPA 1L1EA 2A57A 1TM1E 1VP9A 2DFDA 2F6RA 3QF4A 4DABA 1UMDA 1Z08A 5E7MA 2C3UA 1PR3A 2V3WA 3ES9A 3I5MA 4DDMA 2YZ7A 1RIFA 1RFGE 4DA8A 5JCPA 2IS4A 2OQIA 1JSXA 4GOOD 4ZTBA 1LPMA 5AW3A 2FX5A 4X8LA 5BYKA 3BORA 4FFLA 4D02A 5DHTA 4EY6A 4ZEMA 4PGHA 4UTRA 1SXJB 3E70C 2ON6A 1VBFA 1NN5A 2ZWMA 4H3VA 1XPUA 3UN1A 2NM0A 2BGMA 4Q9JA 1BX0A 4Y9UA 1G6Q1 1OAOC 3D0RA 5KHLB 2DQSA 2VKTA 1O94D 2FN3A 3VR3D 5HGJA 2VXBA 3K35A 3A6EA 4WKGA 2IYZA 3FTFA 5DNEA 1P6QA 3AHJA 4RJJA 4AP5A 4PN3A 1DO0A 4XVUA 1Y9AA 3V7FA 3G9QA 3KWJA 4G23A 4M53A 3RSQA 1EHIA 1US8A 3AP3A 1JDZA 1RXCA 4MJ3A 1LPOA 1XIVA 2JH8A 3T7AA 4KZKA 3QVXA 1II8A 4DIKA 3P0EA 2EIXA 2HK7A 1KSJA 2ZT8A 2WSLA 4MGEA 3FUVA 3GGDA 3HM9A 2VWPA 3AW8A 5DMXA 3TVYA 4UTVA 5FTJA 2OBBA 3AGQA 4P2GA 3QELA 5MN5A 2PXCA 2C2GA 3EEYA 3JR7A 1IMJA 1WM1A 2VSQA 4D81A 3NT2A 2NO6A 3PF9A 1YB1A 3OZWA 4KLNA 1W35A 2Z9CA 1D3AA 1VRWA 5M04A 4WKOA 3KOOA 4PHTA 3RU2A 2JFPA 2OXTA 4L5IA 1FVHA 1AUXA 1CG6A 2YUTA 5I9NA 4WE3A 4RF3A 4IGKA 2VHVA 4OI4A 1PE0A 1ZHHA 1G98A 2CF5A 3EYAA 4ALIA 2JLQA 3GDOA 2FN8A 4RK1A 1KNXA 1XC7A 4AF6A 1YQUA 3CVOA 1CVLA 3FFTA 1W1IA 2ZKIA 3KEQA 3Q6NA 1WW2A 4L74A 1LBTA 4BNJA 2DFNA 3ORRA 3A1NA 3DDSA 4EZBA 3WRYA 5ADUS 2PD6A 1JI3A 1DO2A 1H2HA 2ROQA 3AZQA 2QN9A 5SYNA 2KMLA 2HA6A 1VIMA 3DFFA 1MJ5A 3P19A 3PLNA 4IUCS 1OF1A 2PK3A 4K2AA 3PQ6A 6AT1A 2GN0A 4AURA 2O3QA 4TT3A 5G3ZA 1U2DA 4OTZA 1N2HA 4D92A 2VRCA 2HRRA 1RJ9A 3ZX5A 3MLEA 2JJ2D 4NFYA 4CMIA 5ICSA 2GF0A 4RJKA 4Z7OB 3CVJA 3AZOA 5IWCA 3RUPA 3VNUA 1CT9A 2HY7A 1J9ZA 2WFAA 1QG4A 3E9NA 1W36C 4KN8A 3W90A 4OQFA 4QT0A 5LA6B 1WL8A 1ENPA 1HFWA 1Y5MA 2BGTA 2DHRA 2X8BA 3F7MA 3L0IB 1NW4A 2BLNA 2ZTSA 2NO1A 3PQ8A 3KQTA 5FLKA 4H6VA 1I5EA 3TQRA 4YXFA 5AVYA 3Q7IA 3SJCA 2A9OA 5D3KA 2D5CA 1IBCA 2HQBA 4TTTS 3V8QA 5C8ZA 5K4HA 2PTHA 2C7GA 1H0HA 1LSOA 2VTDA 5LXTA 1Y82A 2WILA 3VNBA 4ARIA 1ZLXA 1YJQA 2V65A 3EOAI 3I9LA 1UJMA 1FJ2A 1ZH0A 2DECA 3FFAA 4I9UA 4MIEA 1LJUA 1NMXA 4PZLA 5TMDA 3TUJC 4EYQA 5LIPA 4NCKA 4TUYB 2GA8A 2DFLA 3UHJA 1AZLA 1P72A 4Y6PA 3TZQA 1JU9A 3A58B 1RQ2A 3UUEA 5ALFA 5JRDS 2WOOA 4IQFA 2GJ9A 3ROZA 4ILKA 3MRTA 2C31A 3NNDA 3UFXB 4O4HB 2FX3A 2QBYA 2B8WA 5EXTA 2QV0A 1R6VA 1RNLA 1VMDA 4KB5A 4R8SA 3BC1A 3F6PA 4AJEA 5CG2A 3VZBA 2H2WA 5HTOA 1GU0A 4L9AA 4UNRA 2CUTA 5B30A 4WA8A 5KSWB 3BAFA 2FZ5A 5BW4A 3O1IC 1N1GA 4KWCA 3EPLA 1ZGZA 3IEIA 3LGSA 4NL4H 1XXHE 4A6DA 2VT3A 5KCZA 4BO7A 3TMYA 3ZQKA 2XWJI 2YWBA 3L8MA 3LD9A 1GZDA 1BS2A 1EJBA 1U3UA 2AIRA 4EG1A 1B2RA 2DGDA 4JSTA 2IPMA 1KDYA 3LDFA 4KP7A 2GX6A 4Z9YA 5JXJA 2IKQA 4UUMA 4EEXA 1LNQA 3BSSA 1H5QA 4QRHA 4MGHA 5K8CA 4RZXA 3TLCA 4E5YA 1C7JA 4F6RA 4AZ0B 2IKSA 4QOFA 5GZ6A 2OCPA 4BC0A 5HRCA 1YFKA 3QX8A 5AW8A 3IP7A 1KRWA 2HLDD 3MELA 3MQ4A 4HN4B