1XZNA

Pyrr, the regulator of the pyrimidine biosynthetic operon in bacillus caldolyticus, sulfate-bound form
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
179
structure length
161
Chain Sequence
MQKAVVMDEQAIRRALTRIAHEIIERNKGIDGCVLVGIKTRGIYLARRLAERIEQIEGASVPVGELDITLYRVPFPVTERNVILVDDVLFTGRTVRAAMDAVMDLGRPARIQLAVLVDRGHRELPIRADFVGKNVPTSRSELIVVELSEVDGIDQVSIHEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PyrR bifunctional protein
publication title Structure of the Nucleotide Complex of PyrR, the pyr Attenuation Protein from Bacillus caldolyticus, Suggests Dual Regulation by Pyrimidine and Purine Nucleotides.
pubmed doi rcsb
source organism Bacillus caldolyticus
molecule tags Transcription, transferase
total genus 50
structure length 161
sequence length 179
chains with identical sequence B
ec nomenclature ec 2.4.2.9: Uracil phosphoribosyltransferase.
pdb deposition date 2004-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1xznA00
1DQPA 3ACCA 4M0KA 5EUCA 1ZN9A 4X45A 4RANA 5HIAA 4P82A 3HVUA 1BD4A 1ECJA 2XBUA 1A95A 4LYYA 4Z1OA 2H08A 4RADA 3DEZA 4JLSA 3ACBA 1QK4A 1I0IA 2P1ZA 3GGJA 2JBHA 5K51A 4X44A 1G9TA 1IBSA 2JI4A 5BSKA 3N2LA 1DKRA 2YZKA 2H06A 1G9SA 4RHTA 4MB6A 1NULA 1QB7A 1NONA 1XTVA 3OZGA 4P84A 4P81A 5ESWA 1JLSA 1VSTA 4TWBA 4KN6A 1G2PA 5BRNA 1UPUA 1YFZA 4LZAA 3EFHA 1UFRA 1O5OA 3DAHA 4PAWA 4FYMA 4JITA 4P83A 5IPFA 1ZN7A 2JKYA 2DY0A 4WMLA 1I5EA 4M0PA 4P86A 1A3CA 1PZMA 2JKZA 1QK3A 1FSGA 3DMPA 1V9SA 1ECBA 3MBIA 1A4XA 1TC1A 2H07A 4WN3A 1BZYA 1DBRA 3G6WA 1ECCA 1A97A 1QK5A 1QCDA 1DQNA 4P80A 3LPNA 1P4AA 1A96A 1G2QA 1LH0A 1VCHA 1J7JA 5IAOA 2E55A 3S5JA 1XZ8A 2AEEA 1XZNA 4P3KA 4RAOA 3QW4B 2FXVA 4OHCA 4RAQA 2HCRA 2VFAA 1HGXA 1JLRA 3NAGA 4RQAA 5BQPA 1HMPA 3GEPA 5BQOA 3H83A 1O57A 1U9ZA 4QRIA 3OZFA 3OHPA 3GGCA 1L1RA 4QYIA 2PRZA 4F8EA 3M3HA 4IJQA 1L1QA 1I13A 1BD3A 1Z7GA 2EHJA 4RHUA 2PRYA 1U9YA 5HKLA 5JSQA 1STOA 1OPRA 4LZOA 1OROA 4LYGA 1GRVA 5ESXA 1A98A 1GPH1 1P19A 4PFQA 3LRTA 1R3UA 5JV5A 4RHYA 1P17A 4RACA 1W30A 4LZNA 1P18A 4RHXA 4QYIB 3ACDA 2IGBA 1I14A 4RQBA 2WNSA 1QB8A 1ECFA 4M0UA 4S2UA 5KAPA 5E38A 3O7MA 1AO0A 3MJDA 1XTTA 1XTUA 2PS1A 1WD5A 1MZVA 1UPFA 1CJBA 2GEBA 1TC2A 1ZN8A 1DKUA 4RABA 1Y0BA 4RV4A 2C4KA 1I0LA 3KB8A 1OREA 4ZFNA 5KAMA 1D6NA 1ECGA 1VDMA 1QCCA
chains in the Genus database with same CATH superfamily
2WSSA 2ZI4A 1P9WA 5TXGA 2Y6UA 3HDJA 4ZA2A 3SHVA 4ZCLA 2QRQA 3DQQA 1HEYA 1Z8FA 3JARB 3AESA 3PJDA 5FFFA 3FTFA 1IJEA 1FSFA 3MCVA 4DMLA 3CF0A 5TPWB 3Q3IA 3PC8C 3I04M 3A6HA 4FFMA 4N5MA 3L4JA 1OV6A 4TYWA 3IAAA 4DR6B 5KDOA 2C98A 1JXQA 1EFLA 5LQNA 1PT8A 1QCYA 5H3CA 5AW9A 4C0HA 5CB6A 3DEKA 3ANXA 3R3ZA 3W05A 5M2QA 2J3JA 3E70C 1VPLA 2GF9A 3MOGA 2Z5FA 2IOQA 4NS4A 1CS0A 5I7VA 1VBFA 5FNZA 2NLOA 2HLDA 5EOVA 5HPYB 3GHHA 1SO8A 5CA0A 2Z6UA 5FWAA 1FYVA 4J3NA 5K0NA 3ZHUA 5LB2A 3O7WA 4G63A 5CNIA 3NWJA 5D8DA 1Y33E 1GZHB 2A0XA 1QGZA 3NHSA 1SZCA 1O5OA 3D2LA 4XVHA 3OH8A 3QVKA 4MW5A 3WYNA 5C8ZA 1IY2A 1L3IA 1J0AA 3OZBA 1MH1A 4CIXA 2CVFA 5JY6A 2FZLA 1VRVA 1NXTA 1JRLA 1UWCA 2FB9A 2PRKA 3IMEA 3KCQA 4O4LF 1KU0A 2VDLB 3T1VA 4B4DA 5DNWA 2R25B 3MS2A 2UVPB 1DHRA 4ECAA 3WGQA 5LYJF 1KS9A 2P5SA 4ECEA 2X0IA 4JLOA 2B1RA 4MHOA 2C31A 4IIUA 3BFVA 3ZZUA 2E0IA 1VL0A 4LTNA 3TBFA 1H2WA 2G9VA 2I1WA 2WIGA 2WFMA 4ROTA 2CJWB 3VHRA 2C4UA 1P7VA 3PVSA 3ZCPA 1P39A 1QHHA 2ZE8A 2WILA 3ZGOA 1PGOA 4LC9A 1EGAA 4KIWA 4KMMA 1JFRA 2W4IA 4LRTB 5DBOA 1RWXA 3RJ9A 1SXJC 3NGLA 3V34A 4YLYA 1SVSA 1YS6A 3HBLA 3UOGA 5JCZA 1PLLA 2OOKA 1FYFA 4U8HA 1KJ9A 4GOND 4EF4A 4LFAB 1Z2OX 1N0VC 3CXUA 2BHNA 3OOSA 4YMSA 4YR9A 1NC1A 1DXOA 3GUUA 4UNSA 2W58A 4FNAA 1GYPA 3OX2A 3QKSA 4B7AA 4M87A 3TLXA 3QXXA 1H4TA 8ATCA 1WBDA 4D3DA 4IVPA 1N5MA 4YT8A 5HYVA 1I13A 1C9NA 4IRUB 4TKLA 2WU1A 3K71B 2FPPA 2GERA 1SBZA 3EQ9A 2JK0A 4P9NA 5KQPA 8AT1A 4W7SA 5UKDA 4Z4HA 3WHKA 4ZQFA 1KEEA 2XHZA 3ZDDA 1CUEA 1WZEA 2GD0A 1RKUA 2RGGA 1FS5A 2C04A 2HCJB 3BFKA 4NCKA 5FWDA 1Z0KA 4Y2RA 2VF8A 4TYQA 4KWTA 2ATIA 2PAFA 3TI9A 2XY4A 4OJTA 1KI1A 3I0MA 3ZLTA 1MJHA 3BDIA 3S4YA 4ALMA 1SKYB 3DO6A 5HX7A 1WE2A 2MSWA 1XJ0A 3PQ3A 7MHTA 2NO5A 1G8SA 2XDWA 4RA6B 1D1PA 2MSEB 3Q3JB 1X8KA 2JLWA 4QDZA 2FEWB 1TZBA 3DKVA 4B45A 5DIFA 5CLGA 1H1DA 1OJ7A 1X1QA 4OY3A 4YQFA 4KDFA 1M1ZA 4L2IA 4LJ7A 4MYSA 5J5CA 3KB8A 4RK5A 3KC2A 2G88A 4R8VA 3NP7A 4ML3A 1FDIA 4IXWA 4TLMB 1W2WB 1DJLA 2OGSA 1E1QA 1JF8A 4OFXA 3K32A 3BD8A 5CH3A 1JU4A 4JXJA 1BHO1 3B3GA 3PUIA 4LHVA 4CKCB 4EFNA 1ZXLA 1ZUHA 4MMXB 3C97A 3G8CA 4WFQA 1EAMA 3UB2A 2CDCA 1KNXA 3B1FA 3A2NA 3EAQA 4E2XA 4HBGA 2CKDA 1I4DD 4QTUB 5JBNA 2R8YA 4QJ5A 1WY7A 1E3WA 1JPNA 1KQ3A 1XNJA 4LCBA 3CKMA 3FLEA 2YCBA 3U3XA 2KLBA 3VDXA 4C5BA 3BJMA 1XTZA 3NEPX 1Y98A 4MDHA 3W5AA 4WCFA 5DLYA 1VPDA 4TKUA 3T52A 1I3CA 3WB1A 3TVYA 3VHXA 4BY9E 2DTEA 3SN6A 4M9SA 3AEXA 5FIUA 5A7GA 1UP4A 1T9KA 1Q0UA 3GJSA 2R1UA 3LRPA 1NN3A 2ZAOA 5J2UB 3PFHA 1EBUA 5K0SA 1AQJA 4EW1A 3GEGA 1M1XB 4MI3A 4KDCA 3WNQA 4DY6A 4WJLA 1B8PA 3PGLA 1Y4UA 5E0KB 1P4HA 3TTUA 2B8NA 1WVMA 3H1FA 4L0CA 4CM7A 5JNWA 4MLPA 3U4QA 4OYRA 1OWLA 5IKPA 1QDUA 3QMMA 1U80A 2FWRA 4L8YA 3OCWA 2EQAA 4WA8A 3RBVA 3UJ7A 2XVXA 4DBLC 3H6GA 4OHKA 5A1JA 4NDAA 4CF4A 2A59A 3AVPA 4Q21A 5DTEA 2DLDA 4EMBA 2AOXA 3OWXA 4BEWA 3CEJA 2OLEA 5DHUA 1KHHA 3DVRX 3OEWA 3D5TA 4TLCA 3J7TA 3A9TA 3MCUA 2AA3A 3KOXA 4RMNA 2V6GA 2ZM5A 3N8DA 3BN3A 3QPUA 2AOVA 2HSGA 1GPBA 2EVWX 1DEKA 3KCNA 1UXGA 3A4MA 3C3PA 1W59A 4RZUA 3SCZA 1KC3A 3GRZA 4AP5A 3H99A 2MSKA 1A27A 2FTKE 4P53A 3U1BA 4CBVA 1I80A 1O6FA 3K0BA 3OEEA 4HO1X 1KZ7B 4P4TA 2Z56A 2QLLA 2IBTA 4B35A 4MHSA 1CZOA 1FQKA 1NTRA 3AKEA 2W2MA 4EPWA 1PQUA 3K4QA 4KQ6A 5AVTA 4N40A 1VHWA 4NMMA 2PJZA 4G24A 4IINA 4Z86A 4UM9B 5JO0A 4MKHA 1R6DA 1MABB 2I2WA 4UEKA 5IHPA 4TSFA 4D26A 4MVJA 5HQJA 3AB3A 3GY0A 4WBSA 2HA0A 4BX0A 1MC1A 1T2UA 2OYRA 3WWEA 3EXAA 4Z4FA 3IQHX 2B1JA 3MIIA 3QEMA 3E5HA 4X20B 3G02A 4YI3A 2QZ4A 4X85A 1GQRA 4X24A 3ZKAA 3VNQA 2UZ4A 3LTEA 1DGQA 2QL6A 4OJYA 3U81A 2OCPA 4HLQB 3TTWA 221PA 3WNDA 3R76A 3IRVA 3U7GA 1L7QA 1P8JA 1NUUA 1W5AA 2JFBA 3DUWA 5B2EA 3RT7A 4GF5A 2C2KA 4I1OA 2WFLB 3U3ZA 1U2DA 2A1UB 3N6VA 2X8JA 4FEYA 4HADA 1BMTA 3LW8A 4X6YA 5LMUB 2IP2A 1WWKA 2I4MA 3CNOA 5MHTA 3PNSA 3SS9X 1YQ9A 1JZTA 5ARDA 2JEYA 3HR8A 2P2DA 3MUNA 2ID4A 5JMPA 4DY4A 2CHGA 3JD1A 4MLCA 3UA4A 4BLPA 2OWDA 2PJDA 2PX3A 4MRPA 1WTAA 5CXXA 4CTJA 2RHJA 3LM8A 5CA1F 4NICA 4D7AA 5KJFA 1SBHA 1MQSA 4EHDA 4ZOLA 3OO0A 1ZXXA 4DV3B 3AF2A 4W5HA 4OQEA 4XB6B 5BN3A 4A2WA 1ZBQA 1AUPA 1W5FA 3CJRA 3IESA 3M1YA 1H2ZA 3QA3E 3QVLA 4EJ6A 5K0CA 1B43A 3IUQA 3NH6A 3U7JA 4MHTA 2VQ3A 5CU7A 4DEYA 1VSQA 2ZR9A 1NVUQ 5A0TA 3EPRA 3DLHA 1VSVA 3T3GA 1F2DA 1GVNB 4HLDA 1MW8X 3KKKA 5EJ7A 3ZS9A 1CR6A 3E3LA 3PEFA 1KBZA 1OBVA 3VPDA 2B4TO 3GV0A 5GZ6A 3T0FA 3RROA 3PKZA 5TJHA 5KYYA 3F78A 5HA5A 4XEUA 1LQTA 3ZV4A 3E0QA 1H9BA 1C0KA 1EAYA 3DGFC 4YPOA 1L3CA 2YNMC 4G81A 4QAJA 2F8LA 3C3BA 2EFJA 1UFRA 2VPXA 4MV8A 2O8BA 4XTRA 3NI2A 5IABA 5MGNA 4EYGA 1U0HC 1Q1BA 3EWNA 4ZP1A 3QPWA 3RRFA 4BX8A 1YKGA 4G1MB 1IIBA 1C3JA 2PL3A 3OZXA 4EJSB 5A4AA 4LMAA 1NBIA 2L0XA 1PK9A 2QLFA 3HVRA 4P4SB 4NOJA 2ZJ0A 1FMLA 1L5VA 1V3QE 3AM4A 3L41A 4RBNA 2QXYA 3C3EA 1X74A 3M6AA 4QPPA 4IMIB 4XGIA 1NX6A 721PA 2WHXA 3USES 3PRHA 3KQUA 4J0CA 2PL5A 2Z95A 5DYGA 4GAEA 1M0SA 4BFWA 2M98A 3AUXA 3TX6A 1QCZA 3EEOA 3ZDRA 5HIKA 2ZXFA 3HXTA 3L6BA 3LWBA 4MPTA 1T91A 4QGFA 4EHKA 4WDRA 3UY4A 3A1WA 4JJIA 3Q0IA 4WBXC 1G0OA 3ESXA 2GZ2A 1F8GA 3HPRA 4JC4A 3EAFA 3RRXA 3AFMA 3RJ5A 3T99A 3FSGA 2GESA 4CL8A 4MYRA 4EDFA 2ZUWA 1O57A 2VXOA 4G4SO 1D2RA 3IP5A 2X5XA 3TD2A 5K0TA 3VHQA 1C3EA 3CISA 3ET5A 4EDHA 1X94A 1IBLB 2VAVA 3DAGA 4WSOA 2EDCA 5BUSA 3EVNA 3M33A 1WUIS 1W96A 3FE2A 3WLRA 1M6HA 2AK2A 3ENQA 4E7OA 3MXOA 9ABPA 1A9XA 5CTAA 5LM3A 3NRCA 2HRZA 1DAOA 4QWMA 1SD5A 2IEIA 4OXIA 5H16A 5BOSA 2RI0A 1ZRNA 3E8XA 4Q4JB 4XQCA 2QQGA 2VJPA 3ZX5A 4J3JA 2QSZA 1KVRA 1ZH4A 3V32A 2PY6A 1MO5A 4FYHA 4YCBA 1KP9A 1AGYA 3EC2A 1ONPA 5DLQC 4HQNA 3OQ6A 5ELLA 1OT3A 2NTEA 3QJYA 4UZSA 1KAEA 3ELDA 2XA9A 1WOYA 4WZAA 2VPZA 5HW0A 3K2QA 1KO4A 4XSHA 5AJTA 1NYQA 4E6EA 3BSYA 1HDEA 2CKMA 2VKTA 4QBGB 4R2WA 2HRDA 4B7XA 4UOZA 3OA0A 1AGRA 2JEOA 2V03A 3I9OA 2PKQO 4R2IA 5KYWB 3LCJA 2XJ9A 3GBVA 1ISJA 3P2IA 4IMRA 2OGUA 1QHIA 3EGWA 4NH0A 4YRCA 1JPVA 3S2YA 4WECA 1B8VA 3ZEIA 4AMGA 3ABIA 1DQPA 1E4OA 5AQEA 5J63A 2Y9PB 4QSMA 4O63O 5JCOA 4Z3KA 4C4PA 1XLTA 4DNQA 2HF2A 3OKPA 3QU7A 1U2GC 2GAIA 2ZPAA 4PG8A 4JL6A 4DWJA 4I14A 4MW7A 4BMCA 3IEKA 2GUGA 3OCUA 3TD9A 1XMJA 3MZ0A 4UM8B 4ENUA 5DM1A 1ANKA 4PLGA 4AJPA 3IE1A 2OWEA 2FSIA 1T8TA 4MP8A 1WXWA 5I9BA 3ZYCA 4B79A 5JH7B 2H06A 3GPBA 4ZWNA 1CP3A 3UWPA 2V59A 2YRFA 5KC9A 5J4YA 1MG5A 1P0PA 5HMLA 4Q4HA 1EESA 1ECPA 2CZQA 4L73A 3ZIDA 2VIIA 1YONA 3OQ1A 4JGBA 2BCEA 4EJSC 1XEWY 1XKTA 3UMMA 2MJLA 3T1NA 4JOCA 4XWYA 2AW3A 4QU9A 2AZTA 4WVLA 1U7OA 4MQ4A 4OQQA 3WQSB 4RTJA 5BNWA 2BTQA 2H1OA 3V7WA 3F3SA 1TZKA 1Z5ZA 5F7JA 4DREA 4RQUA 3ZYZA 4OQNA 1KI3A 4ZMRA 5FWNA 3N3AC 2H65A 3FHOA 1USKA 4UCWA 2QJOA 2BR5A 1E94E 4RGYA 3U3MA 4BFUA 3NJ4A 4KITB 2HBZA 3CTPA 1J9ZA 3BPSA 4OH7A 2H2FA 5FV4A 1PW7A 3D6TB 1Q57A 5M3BA 3TG8A 4NZ9A 4IQ8A 3UHPA 2ZJ3A 4TL7A 2Q0HA 2EKLA 4G01B 2AUMA 2C20A 4G1EB 4BDSA 1KWKA 4JLMA 4EFLA 3EPHA 3GRRA 2GPBA 4Y1EA 4RGVA 2NWQA 3A6DA 1QO0A 1UBHS 1VYHA 4M53A 5DYNA 4BVLA 2OHGA 5SYNA 3X2FA 1KI7A 1I24A 3RSZA 1TYEB 4JP5A 1R4NA 1YGYA 1QGDA 1R1DA 1JL3A 1XZ8A 1M7BA 1NLUA 2GCGA 3B9BA 1EJ0A 3FNQA 1ZOPA 3Q5GA 4UPVA 3FMOB 2PJUA 3G1WA 5AKEA 621PA 3PTAA 4XYEA 3FNRA 1KJNA 3WGGA 1GU0A 4QTYA 1GRQA 3GBSA 3K8ZA 3PIDA 2YJGA 2QE6A 4RD6A 4IQ4A 1MAUA 4ZTBA 3I3SR 2WF5A 5DRYA 5ESRA 3VR2D 5AM2A 5K09A 1TX4B 3BD6A 5F9FA 2VF5X 3FVTA 3W5IA 3T61A 1SCDA 1W4BA 1Z82A 3HGQA 4KLRA 3QUSA 3SZ3A 1NXOA 5HUQA 2DQ4A 2XQJA 3RDPA 3HNPA 2YBEA 3RS3A 4DEVA 4GUAA 3QBTA 1OPRA 1BXGB 2CNKA 4LI0A 1KJJA 2BPOA 3DKPA 4BMSA 4KG7A 1U02A 3QZUA 2VP9A 4JQZA 1QUEA 2ECFA 1TEXA 4MQBA 4AIIA 3WK5A 2CK3A 3K05A 1VE9A 3GEEA 3JV7A 1QONA 1Y5RA 3H2JA 3OC6A 4L4RA 1RYHA 1F2UB 1QQTA 3AF1A 4NR0A 4M8SA 1W0KA 3O83A 1CVLA 1PL6A 2J9FA 5JZVA 1IXYA 5GONF 1RXEA 1PWXA 3DTVB 4H59A 2FW9A 2BGNA 4LGYA 5I47A 1E5VA 4PC1A 4QU5A 1ZEJA 3BB3A 3OAAD 1NWCA 1VYTA 2VYND 2WI8A 1L7RA 3B60A 3NIBA 1TQ6A 2DFDA 4WLNA 5HQ3B 1D6NA 1XRLA 4EPTA 2W8BA 3C0KA 3ICWA 2YW2A 4MGHA 2IHBA 2E37A 4W6QA 4C7OA 3TD6A 4UHCA 4E08A 1RABA 4NZYA 5F9HA 2CDNA 3A4NA 3IOEA 2EKDA 1HPLA 1WKCA 1F38A 3LPDA 3Q7TA 4FR2A 2QSJA 4GR9A 2Y0BA 1TVEA 3L9XA 2VSNA 2DUWA 4ZQGA 5AD1A 4ZT6A 4W8OA 1E2GA 4HTFA 4QDOA 4M60A 4QEDA 4NEHB 2FPXA 2JIBA 4HDSB 4RHEA 3UJ9A 5DSZA 2H8GA 3OHMA 1M0TA 4QOGA 4WN9A 3KLOA 1KMNA 4XARA 3SYTA 1QG6A 4RJTA 4WY5A 1R18A 4Y2VA 2F64A 1TYBE 4CEIB 2EHDA 5BR4A 2PCJA 2GASA 2JEZA 1JIJA 2ZIFA 3KVVA 2CVQA 2O9JA 5MF6A 4CEJA 3WYCA 2RI6A 1S1CA 2CFSA 1J8VA 1T10A 1YMUA 3HGTA 4Z6KA 1DBIA 3BOSA 3E7FA 4BNKA 5JAHA 3MWDA 3HB5X 3ZCXA 4CDGA 5DBGA 1S2IA 2R48A 4KDEA 1YR9A 4X9XA 5AI8A 1QRUA 5A0VA 3UWMA 2BUCA 2AJBA 1U2QA 3BUSA 4ZODA 4W7HA 4R05A 1N34B 1CUZA 1N2GA 3LWZA 1I5EA 4D4KA 3KOYA 2NUTB 5D51S 1R4MB 4HGZA 4ER6A 3W5DA 2BFMA 3GNSA 4ZI7F 4RZSA 4P35A 1KI9A 3S2SA 4RMJA 4UBJA 3W6ZA 1P2BA 4KYTA 1DDGA 4FR5A 5FV7A 1M2WA 1PKEA 1NVMB 1YBFA 5LQSA 4HGRA 2BFWA 1NLYA 1JVNA 1GZ4A 1RU3A 1ZJYA 2BSAA 2Z3ZA 3G6WA 3NHJA 5ALNA 2X0EA 3WTCA 3AM1A 1GZDA 1HC7A 4HXFB 3HI6A 1AT1A 5JSFA 3DE0X 1KYXA 1V1MB 4Q9HA 3ZK8A 1Z63A 3N5CA 3PVZA 3SAJA 4GR4A 4J0GA 1TLTA 1WHSB 2NO7A 2Q9AA 2QGZA 2D2FA 3HKCA 4JROA 4MB0A 1V35A 1Q7CA 3GW8A 2XX3A 1GJRA 1UBFA 2J3MA 4I3FA 3ZQKA 4EY8A 1XG5A 3SKVA 3IR7A 2DECA 3GQBA 2PXHA 3HH8A 2R6R1 1CJSA 2I67A 1ZEMA 2RH8A 1TAQA 1NBOA 2O3QA 3KT6A 4HLUA 5ITZB 4ALJA 4H0FA 2HIHA 3FDJA 1EVZA 1PLKA 2EX4A 2HU7A 2ZB4A 3FMIA 3G9TA 4G4SP 2XVYA 4QWWA 2QMZA 5IK2A 3WSTA 1THMA 3DZKA 1X7WA 3DUFA 4JL5A 4LZLA 1NZFA 3A4LA 4TKMA 4DG8A 5EQFA 1OROA 2BZSA 5AUQA 3KUUA 3C8ZA 1R10A 2VA9A 1C0EA 1MOPA 1P61B 1R3UA 3SR3A 4UPEA 1G17A 5KYKA 1RMQA 3SF8B 1XQYA 3W04A 1W5BA 2XMPA 3CH7A 4WK0B 2QY6A 4FPXA 4Y6QA 1J4AA 4O2AB 2XDAA 3SQXA 1J56A 1C2YA 1M8GA 3JASB 4U7TB 2IEYA 2HJRA 2VN8A 3KJFA 3ISJA 2CCJA 3N8KA 3WLEA 3BREA 3FBWA 3IIIA 5D3ZA 3VBCA 4ZTZB 1LPNA 2PU5A 4RA9A 5BN4B 4V0ME 2RJOA 1Q1NA 3RSFA 1YRHA 2X1LA 3NC1C 3AHEA 4R1OA 3GLTA 4MKZA 4BXOA 2G67A 3NGMA 3AZOA 4G0XA 3SMQA 2OECA 5AM3A 3H9GA 2QVYX 4MX8A 2VPTA 4ZT2A 3W9UA 3DM5A 3NBUA 4ILKA 1QANA 2FWNA 2J5KA 1PO7A 2A8YA 4NEQA 2Z8YM 1Q0PA 3JRXA 3FFWA 4Z7JA 2O8DB 4RVSA 4W82A 5EMKA 3K9GA 3ZR4B 1K89A 5JRJA 2FZEA 4QRDA 1CS4C 2IHKA 4KLCA 1KPHA 5M34A 3TAXA 1JAIA 1FYWA 5LXTA 2IU6A 4XASA 5JRZA 2VPQA 1X42A 3EN0A 2RB4A 3N87A 1UPXA 5C1OA 3FRHA 1IK4A 1XMQB 4ZDIA 4ACBA 3G59A 4DVGA 1NP3A 4GXTA 2FF5A 4B3RB 4IG4A 1RMYA 1KY5A 2WJZB 3OOHA 5AKIA 5LWHA 1YZKA 3QWAA 5LOVF 1U8CB 4KMRA 3PX7A 1XEXA 1YR1A 2XTAA 2XRZA 4JJZA 3QBEA 3EUWA 3AOEC 1IN1A 1U98A 5JROA 3H2KA 4HAUA 1WB4A 2E21A 5EE1A 3HZRA 1XZHA 1VKRA 2P7IA 4BVAA 4ARCA 1XTJA 2ODQA 1T5BA 4JCOA 2YV1A 1DBSA 2PK3A 3P8ZA 3TI7A 2PQ2A 3V9AA 4BJ1A 3EMKA 3EGEA 4ZAXA 5LLSA 4C1NA 5K0JA 2JIZD 1SM4A 3BULA 1SHLA 4KQ9A 3VR1A 1WPRA 5BUQA 3NAZA 4TTQA 2GNPA 4UAVA 4ZEXA 3SZRA 1JLLA 4R16A 4YJHA 4DJDC 5JANA 5BUZA 4HFJA 1E4VA 3MWKA 1M5UA 3N2ZB 2X7XA 4M9ZA 1SKBA 2VK1A 4HQKA 1PR3A 4PCUA 4D1YA 1NBHA 1AKRA 2VLBA 3ZGVA 1EFAA 5JYEA 3O31A 1K3TA 3HFGA 5EWLB 5FLYA 1HDOA 2WKRA 7YASA 1UJMA 3FNBA 1NT2A 3GVCA 4OGGA 3QE2A 1Q5PA 3BXOA 1P9OA 1UZLA 1GA6A 4DA0A 1H42A 1NY5A 1R8YA 3FX2A 3GRYA 3OZWA 3PUYA 4UZEA 1T35A 4G1VA 2A3NA 1Z4QA 1SHZA 1B8NA 1M6EX 5F9MA 2ZDQA 4ZHSA 3NALA 2FPMA 4ZYVA 5KYXA 2JZCA 4Q82A 3CUSA 1TQ2A 2DQSA 2IHYA 3FPSA 2Q4RA 4CKEB 2OFFA 1ODKA 3K8YA 3ZOZA 1EK1A 1UBMS 5GJBA 1W29A 3AKDA 2JJ1D 3PENA 2RMKA 2VATA 3GFTA 3QKUA 3RUFA 3VKVA 2HHAA 3QPVA 3MT9A 4AP9A 1U8UA 3AM3A 5G0SA 5SY9A 4EUSA 2NSJA 4GMFA 4ALLA 1ZHHA 4HNUA 5AESA 1YUMA 5C80A 1LB1B 4FINA 3W79A 3I45A 3OICA 2Q3MA 3U4MA 3G2OA 1T2FA 1OIVA 4YUAA 1AVTA 1N75A 2NV6A 2X77A 1W4ZA 1YK1A 3AIMA 5FTMA 1A8IA 3UWDA 1K63A 2LDBA 1HT1E 1TVKA 1Z6QA 3DNFA 1XK7A 3QF4B 3S2IA 4CF7A 3DDOA 4H1HA 1HWYA 3HMQA 1FDWA 4Z8XA 1K7YA 1E6WA 2Q6LA 4UEOA 4BLVA 4OH1A 2DY1A 4Z54A 2CV1A 1UBLS 1EG2A 3DZHA 3TZLA 1U7DA 5JO9A 1TIBA 5A3SA 5E7QA 5IBCA 1OCEA 2EL7A 4M0DA 3EPLA 1N2JA 5G3ZA 1U7TA 3AY0A 3KG2A 2VYVD 5DM0A 2D59A 2ZJFA 3BIJA 4MRRA 3T9EA 2MSDB 5JD5A 5FWXB 3GP3A 2B1IA 5IC5A 5TT1A 1KAQA 4RDHA 2R8PA 3IJRA 4A27A 3V8VA 3OMXA 2R8EA 4RY9A 1Q20A 4P32A 3A6LA 2P67A 1C3LA 5A5GA 2YHSA 1EE1A 5KNCA 1QIIA 3BDVA 3OPXA 1UH5A 4H1VA 3RU7A 2RGRA 1ZC3A 3K2EA 1WMEA 1P72A 3LC2O 1G59A 1GUZA 4N0QA 1FJ2A 3DT6A 4CF3A 3P2JA 1U5CA 2FVXA 2NT3A 5EJ8A 4QDKA 3T15A 2ATEA 2WVGA 3BRQA 3QWBA 1KE1A 5DBIA 5TNXA 3SIPA 2HPHA 4P4NA 2MMGA 1NUQA 1GKIA 2FPOA 2IW1A 2QVCA 2WIJA 2HEIA 4GM1A 1OXXK 1HDZA 4R2JA 4Y9SA 5DISB 1IHOA 3E6AA 5G0VA 5TE9A 3K2IA 2PIAA 3A7EA 4M0PA 4CEHA 1JJFA 4LY6A 2PFKA 3OLYA 1G63A 1NDHA 1WQ1R 3C43A 3WFIA 2CT8A 2H2AA 2I4NA 1GWNA 3F98A 2R9VA 4HYQA 3IBYA 4RE6A 1QF6A 4B76A 5FKJA 4EMUA 3ABSB 3SEAA 1MQ9A 2AFHB 3V8EA 3C3XA 1NP6A 2CL7X 2VH1A 421PA 4G67A 4OHFA 1YOBA 4XYMA 1HDCA 4LOLA 3L7OA 4KPUB 1Z5OA 4MW6A 5GV8A 2GAAA 1FFCA 2YW9A 1LVGA 1NASA 3L4EA 1JR2A 2OZKA 3AVUA 1FF9A 2QJRA 1ISSA 2C8LA 1SXQA 1WETA 1Y9ZA 5F7OA 2M1XA 4TMKA 1N2BA 1G20B 2QM8A 3FY4A 2N0SA 4OG2A 3VR5A 1C3OB 3OZFA 5K6AA 5ALSA 3HB1A 2O14A 3MJFA 4L7VA 3BB1A 3TM5A 3OKFA 3ZI7A 1U3VA 4D9KA 3VR6D 1N5RA 4BBAA 5H1YA 2GRJA 2OILA 1BD3A 2PKEA 2EW8A 4MRNA 5D3KA 1JA9A 4GLLA 3MQ4A 3DFFA 1B7GO 1TE2A 1U8EA 2GPTA 2WOJA 1I9GA 3QX8A 1HE2A 3IERA 2UV8A 2B8TA 4H7JA 4LIPD 1Z9BA 4R8SA 2ZPUA 2E89A 1GYQA 1P7YA 3C7TA 1SCKA 4K5QA 2IBSA 1BS2A 1GGHA 3BXHA 3HDGA 5CX1A 1RRVA 4OXXA 5FPQA 1BA2A 1L4GA 4PYIA 2BELA 3E53A 3DDHA 2NXJA 4NCAA 3EZ9A 3N2GA 4L8FA 3UF0A 3OZIA 5DBHX 3KL2A 2QE7A 4HRAA 3RLIA 4TQGA 3T54A 7ADHA 1F7VA 4M9UA 1TAUA 5FUBA 4CYMA 2H7CA 2C1XA 3KOWA 4AQYB 3IDOA 5CT5A 3KTOA 2I99A 3O9MA 4D9FA 1TC2A 2P6PA 3PRJA 3BGDA 1GCOA 4RFLA 1KNQA 4DGQA 2XUJA 4HZUA 1GRRA 1DBQA 3FPBA 4C5AA 4MVYA 2PUAA 1M1YA 2J0UB 1G6Q1 5F5NA 1PK8A 3TW6A 1BQ3A 3GQVA 3OT1A 4C3ZA 2IYSA 3JYNA 3ACCA 1G21B 1TUBA 3DPSA 5EQJB 1W87A 2OZEA 1GY8A 4K9PA 3R74A 4YT2A 5C8VA 3AG6A 4GQBA 3BE4A 5DLEA 3KHUA 4Y2TA 4OU4A 5CFNA 2I22A 4XJVA 1UXOA 3IO5A 1K8XB 4BB9A 5IJ0A 1XTIA 1Y3BE 1Z2CA 4JU8A 1N2XA 2W2KA 5FOTA 1LDEA 1IY8A 2F4VB 3RRYA 1RKBA 4XCQA 3SF0A 1JR3D 2L2QA 3UW1A 4Z7NB 3OCYA 2Q28A 4YAKA 3OFNA 3K92A 1PZXA 1CJTC 1L7AA 4QOHA 2DR3A 4ONEA 4YN3A 4GOKA 1LRJA 3BG5A 1QB7A 2ZRAA 3T4XA 3WGHA 4DTIA 4YCMA 2YMLA 3MA0A 2CLMB 3VPFA 1SQ6A 5EJIA 4XM2A 4FLMA 1V4VA 2A14A 3I9V1 4Y67A 5BP7A 3W8EA 2WRZA 1Y3FE 1KIMA 1DKPA 5IM4A 3JX9A 4I2NA 2WSLA 2R6JA 2W48A 3LPAA 5REQB 3NUZA 4JITA 3LRXA 4JKIA 5FD8A 2J9XB 1JQAA 3B9PA 4TTJA 1U5BB 2E3JA 1R0RE 4MPJA 3FR7A 5B1DA 3RFCA 4H15A 4FDVA 4CTKA 5EG5A 2NZ2A 4LJRA 1UM9A 2NU7B 3KLPX 3WBKA 4CJXA 5BN5B 2NU8A 4JDPA 4K03A 4D8VA 3KSUA 4CM1A 1QOZA 2Z1NA 2RGWA 4Q1VA 2NNLD 1RYDA 1ZK4A 1JYSA 3HJGA 4HPJB 4AZSA 2NG1A 3NKFA 2MT9A 3QMPA 5EIEA 3A4VA 2RHOA 4HB4A 1MPTA 3PFGA 2BTOA 5B36A 1B15A 5IF3A 1L1EA 3L07A 4G5QA 3DE1X 4M99A 3W2EA 1JEYA 1NJSA 1EGVB 3CLRC 4IHJF 4PONA 2K2WA 5E9AA 1KJIA 3RC9A 1DAIA 4QEZA 4QREA 4J0EA 2PMKA 2Y1KA 1N6NA 1U9IC 2QUKA 2VDQB 1Q21A 3H17A 1FSSA 3QK7A 3LVBA 3AB8A 3L43A 4HNGA 5IEBA 1TKAA 2G25A 1C4OA 1MN6A 5M5BA 1YVUA 4MZDA 5CNJA 4RW0A 1JEOA 5A02A 1Y8RA 1OZAA 4HTAA 1I2MA 1A72A 5C18A 1QRSA 3HJFA 1XXLA 1T9DA 1XTRA 2YXPX 4MXDA 5JDCC 4BVFA 1JB1A 4DL9A 1J2UA 2BFDB 4OAQA 2FSUA 3VYWA 1D04A 3E22A 1IQPA 5A3QA 4CM9D 2ZVDA 4YWHA 3U9TA 3R6TA 1IM2A 4G36A 3LGSA 4WUTA 1FDTA 3QBJA 5FOUA 3GF4A 4ND8B 2H1CA 3PFWO 1SFRA 2JCXA 1SUDA 4UNRA 1IYZA 4HDAA 2ZB2A 4DG9A 2O06A 1MTOA 1N2CA 2R8XA 5DWDA 3E2PA 2XUAA 5I4KA 2PS1A 4LC1A 2A78A 2CWDA 4NZNA 3EHEA 5IAJA 3IHTA 1JG3A 1Y42X 2O2XA 4O5AA 3I5MA 3D1JA 4PX5A 3ZXXA 1TJ4A 2XCIA 4J4BA 4MIOA 2O05A 5B2ZA 5ULLA 1U94A 3GFPA 3OZGA 1KEKA 2ONZA 1VA5A 3PLNA 4R1LA 4UNNA 5DYWA 5B4TA 4JKOA 1XD2A 1QGUB 2J09A 2NSLA 5K0EA 3TDNA 3QX3A 2R7AA 1LQUA 3LHKA 3AF4A 1YQQA 3HP7A 3PR1A 3TZHA 3NT4A 3ER9A 1BD4A 2IKQA 2QB5A 2GTHA 4ENWA 3UPUA 1KERA 2GDZA 3HMKA 3K70B 3FCYA 2CVOA 3Q8MA 3JQAD 2TRSB 3GGJA 4Y2SA 4L6CA 1DUVG 2IGTA 4QODA 1PL7A 5F64A 4QHYA 5KJ6A 4W5OA 3ZK9A 1KDPA 2GBCA 4JUAA 3IPRA 2R3SA 1SVLA 2BZGA 1QLJA 2JRCA 4MKRA 3GGDA 3K1AB 4XLTA 3RREA 3OZ7A 4PPNA 3LYHA 4RYLA 3NIDB 3WJ7A 3D2CA 2WMNB 4ZCTA 3EWSA 3HUUA 1WO8A 5AW2A 5JASA 4FYPA 4P1ZA 2I3AA 3KNZA 1YRQA 2YICA 5F98A 2QS9A 1XX6A 3SKXA 3GZ4A 1XRMA 2A67A 1PR2A 5A62A 3E2MA 1J8DA 1YJ5A 5HMMA 5LLDA 3GD7A 3FPEA 3U61B 1PQYA 2HSJA 4GX0A 4C22A 1QBGA 1FL9A 3NDRA 5TQ0B 4PTYA 3CT4A 2ZXEA 1E1YA 1I6KA 5KCMA 5J2TB 1T9CA 4LHXA 1AKWA 3B6MA 1Z4IA 2JI7A 4F60A 1NUAA 2AI3A 3G0OA 1LD3A 2V7PA 3HZOA 3V1MA 4DAOA 2B3TA 3PC3A 1HY3A 1QV7A 5CM2Z 3IEIA 5FFMA 3IA7A 3B89A 3CRVA 1AURA 1BRMA 1MOZA 4FQ7A 2F7SA 3UYLA 3ZD7A 1KEVA 4KQ1A 4O4IA 2FN9A 4LSZA 4KBYA 4QO7A 1LBQA 3OQIA 4J0IA 1BS9A 2GD6A 3A3KA 2ILVA 4GOLD 1BDHA 2F59A 5FPSA 1Z45A 2D7DA 1OX4B 1L4MA 2WTEA 2JD2A 2YS6A 3JPYA 4ZVUA 3ZXUB 1Z5GA 5K8UA 2IQIA 3QLJA 1WJGA 3MHPA 5ES4B 1M7GA 4UD6A 2ESRA 2X0KA 3A26A 1HG1A 2QUAA 2IPNA 1R37A 5CPBA 5B1IA 1XVLA 1NM5C 1RJWA 3PD7A 1CUYA 1P2GA 2Q0SA 1ZGGA 2HJVA 2P9QA 2YV5A 2AS0A 9LDTA 3Q0EA 4Y6OA 1EVJA 4IVQA 2I2AA 3ROFA 2I71A 4MR9A 4J90A 3LS2A 4C78A 4INOA 3QNUA 1JAYA 1I3MA 4C0LA 1F51E 2QX7A 2VEDA 2B35A 3VI4B 3RUEA 5KPDA 4PY2A 5HRCA 2YRWA 4H6WA 2CLOB 3CJQA 3K9BA 2QTAA 3IEPA 2HMWA 1UBUS 2G04A 5E3IA 3RBZA 1SUCA 1Q74A 3VPXA 4QTXA 3D5EA 1RZRD 2C42A 5BV1A 4DSZA 2CE2X 4R1NA 1BU8A 4J07A 4HXYA 2PZMA 3E7PA 1USVA 1LZKA 2CVHA 1XTKA 5HF9A 1EVKA 1M2JA 1RQ2A 4RACA 4F7DA 3MJCA 3TQSA 1P18A 3GPCA 4IWXA 3GFVA 4JUIA 2WNSA 2JB9A 3VC3A 2W22A 3LHIA 5HTOA 1AB6A 3DULA 1H0KA 1JEDA 1BJKA 3M83A 3AR3A 3PWTA 3JWEA 4Z5XA 4ZRNA 5K03A 1XTTA 4MRSA 2JHAA 1YFLA 1DAEA 1NLZA 3H9UA 3CLUC 3N2YA 3EGXB 1PV2A 4JFRA 4KWCA 2IIPA 3IDQA 3L8CA 3GC6A 3V55A 1R9MA 5BN1A 1WUHS 1WHTB 1UOEA 3L8DA 1E7SA 3OPYI 3CSSA 2ZI3A 1Y8QA 5JXWA 1QJCA 2V7QA 3ETJA 3GFRA 2WM3A 3LCCA 4XRRA 4ZEOA 2B0CA 4R7GA 3RI3A 2IU0A 2AMLA 3M2TA 1C30B 2IWRA 1VYVA 2PUJA 3PQDA 4PQRA 3TIXB 2XBMA 1CY6A 2OVFA 2FEMA 4NFHA 4ZOQI 1G4HA 3TGLA 1H22A 1JVSA 1W47A 4CI9A 5ILOA 3HN2A 5JNUA 3C14C 3FYUA 1X19A 2CDBA 2FSHA 1SUEA 1I3OA 3IAUA 3L1JA 1LDYA 3EC1A 3HXLA 4ZPJA 3L0YA 1IN6A 2IS6A 4JOBA 5JLAA 1BE1A 1ATZA 1EU1A 4GPAA 6ABPA 4RVGA 3R5XA 4G3XA 4C7KA 2ZI5A 2JFNA 3CZAA 3G89A 3IUBA 2XLBA 4XOIA 1Z88A 3N28A 3J81A 2Y1FA 4AYXA 4KH1A 1FP4A 4D4IA 3TJZA 3TKYA 3UK1A 1QBKC 1YA8A 1C1XA 3PXXA 3UC9A 1BGWA 1UZUA 3VU0A 3N7TA 1PIWA 3A25A 1X38A 5AVRA 4GOJA 2BISA 4H0NA 5AK4A 3HI4A 2G36A 4BO6A 2R86A 3A04A 5BNIA 1YU6A 3FGOA 3QE4A 4C7MA 4R2LA 3G2PA 3GJ8A 3OCJA 1AHIA 1M8KA 3E3NA 1NP7A 3KQPA 5AHRA 5A03A 1JHXA 3FZGA 4I5DA 3RS0A 5EHZA 5KNDA 3AL3A 3FPFA 4FHCA 1HDIA 5DNYB 4JK3A 4R8KA 4QAQA 2OCAA 1I2CA 4UJ5A 1I4OA 1A8QA 3E15A 4IL5A 3HO8A 2MYPA 3N05A 3UFXA 3TLCA 3BWDD 1Z5WA 1XZNA 5C81A 2R0QC 1NYRA 4GS5A 3ZIAA 4RXTA 4NXNB 3RS9A 4YWJA 3REQB 1IZ8A 2QRJA 3WWCA 4YAUA 4OLHA 2NV0A 2FPKA 3OMLA 3I8XA 4TWAA 1GAJA 4HAVA 4XQGA 2I1VB 5HK9A 1JMVA 3MAJA 1CLUA 2XV1A 2G9NA 1T3HA 3VV3A 1JDVA 3RTEA 2X86A 3AVTA 1SRRA 2JI8A 4B2PA 4MUMA 5CDYA 2H1HA 4KYIB 5MN5A 1D6MA 3IL2A 4N7BA 3FZQA 3KFVA 1E1MA 1W75A 1XFAA 4ZAZA 4KUGA 2FRDA 2ZLBA 3DV2A 1RYNA 1N36B 2A94A 1ZH2A 2WWVD 1H9AA 3A70A 1E6EA 5IWAB 5F7ZA 4S0ZA 5EXTA 1RXCA 1XZQA 3PQFA 4L8LA 3NTUA 1FU4A 1K6XA 1HOXA 4GYYA 1DAFA 3F96A 5K3BA 3WLKX 5CG2A 1EWKA 1GG8A 3CE6A 4HQ6A 2FDCA 4NI5A 4ZHQB 2H16A 1I9CA 1QDEA 1PTKA 2FQ1A 2H59A 5KAPA 5PGMA 3RSOA 4EO4A 3D6NB 3ED1A 4M46A 1XCJA 1EDZA 3UV3A 1ZOIA 3JYOA 3PP8A 1L5OA 3V6LA 3H3XA 4RUKA 1MFZA 2G70A 4TYPA 2CL0X 2VHZA 3M34A 4QFBA 4BNFA 2I6XA 3WNCA 3QVUA 3KD2A 2XCUA 5CDFE 3DMNA 4WOPA 3H1TA 4AQ7A 4A91A 4K6FA 4DZRA 1Z4PX 1QS0B 1K5DA 2EWWA 4GQAA 3W1WA 1WA5A 3FIUA 4K8RB 3LOUA 3ANLA 2YHIA 4MUKA 4OL0A 5TGTA 2LRHA 1V8BA 3HP4A 2PSHA 3DWEX 2X8LA 1OYOA 1POWA 2XBUA 2ZRFA 1MENA 2GJSA 3E27A 3K4PA 4RSHA 2VXCA 2WFAA 4HB3A 2E4UA 3DEJA 1CIVA 2DBRA 2A30A 5TGDA 3PGMA 4KKXB 4XWTA 4B0OA 3GDFA 3H5NA 5FBKA 3ZHTA 2EP5A 4KQXA 1XAIA 2AEJA 2WU3A 4QD3A 1JIUA 2WHRA 4ILEA 1IJKA 2UUAB 2BGKA 5K3DA 4R8MA 1R9GA 2FG6C 4NAVA 4BIMA 4DXHA 3G2IA 2GILA 5TSDA 2AOUA 4XVQA 4R2XA 4TSRA 4P5EA 5CVUA 4IW3B 4ZZ0A 1OLXB 2H1RA 3ZW8A 3B1ZA 2DOKA 4F2PA 2VQSA 3RC8A 4IGKA 5CYPA 3D9QX 2YN4A 3ROGA 2Z83A 5JSKA 4BNLA 2PGOA 4FN4A 4LBYA 4BFTA 1SHUX 3GXBA 3FOBA 3Q5EA 4I46A 4II7A 5AHOA 4CG2A 1CRPA 4BQEA 1VE3A 3VR4D 4F5WA 3ECCA 4FOTA 4LSGA 5HKKA 3HO6A 1E9RA 3W5VA 1RYYA 2ZROA 1HK7A 1UPTA 2XT9A 4F38A 4U0JA 5K8CA 1G2IA 3I9LA 1ZG3A 2IE8A 3IHKA 4R9NA 5LBIA 4UBKA 4BJ6A 3U7FB 3Q40A 3GZNB 3AW8A 1H5UA 4UAJA 4YRIA 3H97A 1OFIA 4BMPB 1W73A 1QCDA 2R47A 1T2CA 2FPLA 4X7BA 4TOIA 3AVYA 3EZNA 1F6DA 4B6EA 5LNK6 5J5AA 2VP3A 2WABA 3AV0B 3CT6A 1Q0RA 1DQYA 3F9IA 2C0PA 3K09A 4OSEA 3NNSA 1CJKC 4N5HX 1I33A 3CJTA 1SEVA 4FCCA 3UHFA 3P9RA 3TNFA 2JBWA 2E4VA 3RFVA 3KRTA 1Y6JA 1DARA 5FLEX 3O84A 1XGKA 3QEJA 3T0GA 4A73A 3CCBA 4KW7A 2XA1A 4Q24A 2CMDA 2O48X 3COVA 3FNHA 3HV0A 3A58B 2ZAGA 2FN4A 4M76B 1VXOA 3IUPA 1E1QD 2ZRIA 3TOSA 5CT4A 2VNHA 3Q7SA 3QYAA 4BP3A 4NY1A 4DJTA 4HG2A 1FK8A 3PIRA 3TR6A 1LZLA 4J75A 1F0YA 3OBIA 4WW0A 1T36B 1VG9B 1OFTA 1YDWA 5CB4B 3KVYA 2HQSA 4OM7A 3H11A 2OV1A 5J47A 4LW8A 2W6ZA 4O4HF 2F3TA 1E0DA 3EIXA 3G7NA 4CKWB 5BXQC 3WQQA 2HPAA 4F4HA 3E1SA 3H4IA 1N33B 5AKLA 1AQLA 3SIXA 3NT2A 1WPXA 5B7QA 1V5IA 4RORA 4AY2A 1VGVA 4UPDA 4LN1A 1O0CA 2X42A 5EL0A 3QLUC 2Y77A 2B82A 2ISQA 3GROA 2X2EA 5EQDA 3WFZA 3WWPA 3T7CA 4B3IA 4YV0A 2WZDA 2YXLA 4HYTA 2J0EA 4KHPB 3CV3A 3LT5A 4CV1A 4CHGA 4ARUA 4B4WA 1LV7A 4G8CA 1H8EA 4Q39A 2Y93A 4DUYB 3L02A 3TCXB 5NULA 3CF6R 4NDZA 5COAA 4GKKB 3WYEA 3OLWA 3EGIA 3UJ8A 1A7UA 1NRIA 2WHPA 3I2KA 3V7NA 5I51A 2DSNA 1JR3E 2QM0A 1GAXA 2BDTA 1P31A 1Z35A 1IMOA 4P92A 5FBVB 5F4BA 5GP1A 3KSBC 5F1KA 4AZTA 2ZIEA 2R1VA 4NLLA 1FS6A 5L3SA 2VYCA 2HJSA 3EMDA 5JFGA 1DOAA 3ABZA 3BMNB 2EBFX 1YB1A 2VQDA 3A1NA 5EKSA 3L4KA 1DO8A 2O3RA 2QM3A 1AKTA 3C8MA 1AXGA 4MV1A 3CX6A 4MGKR 1DIRA 1UMKA 2QT9A 3FZNA 4WNYA 3TF5A 3RYIB 1R5NA 2DYKA 3DR3A 1BRTA 2DHQA 3B9QA 4B84A 3U1TA 3OEED 3ELYA 1OXTA 5KVCA 3JVDA 5KX5B 3N3BC 1OH7A 1GDHA 1FXSA 3LU1A 1E3DA 1K6JA 2BC9A 3T8YA 4ES6A 1J22A 1LA2A 2MR6A 2E18A 1NMYA 4CTMA 3V4PB 1U81A 4ACAA 4YJGB 5KB3A 2A9KA 2W6ID 3KQNA 4QJBA 4MVJD 1YK0A 2D06A 2GSDA 3B12A 1MD9A 1LVUA 4AY5A 3GMTA 4AY6A 3HXMA 5B53A 2AK3A 4PC6A 4WVFA 1JKMA 2AHOA 1T8YA 3U7QB 2W83A 1V16B 3W0LB 1PBNA 1ZJZA 4ZJYA 2AZ4A 2FJ0A 2WP0A 3AF0A 2UXBB 1UT8A 1UEIA 4HMOA 1VHJA 4S12A 2J6IA 2O5CA 1NMSA 1S8AA 2H4XA 3O1JC 1WBBA 1RADA 3DVSX 4HUJA 4R01A 4FQ5A 1GIAA 2YZGA 1AZSC 2QTFA 3BH0A 1W8DA 1ONBA 4GWGA 4B31A 1M2KA 1QORA 1UINA 4JYBA 4PPGA 3RBAA 4AVYA 4NE9A 2XJ4A 4NSNA 5JS6A 4M36A 1EUDB 3IP6A 5E0OA 1IE3A 3HJBA 3OCCA 4Q3NA 1P2VA 4XRGA 4UXHA 4X90A 4EHIA 4LPSA 3PHGA 4EQ6B 1OILA 3CEPB 2RJ3A 2RGDA 1XMVA 3NOXA 4G41A 1EVQA 4I1IA 3QTTA 2W2VA 1E79A 4IDGA 1IVNA 2QGFA 3F5MA 4O4LB 3V4OA 2ZBFA 4DCPA 5F7XA 5MFZA 3ECAA 1C4KA 5DNVA 4COKA 1RI1A 2VSFA 5GIOE 1P2FA 4PTZA 3M2PA 1NNLA 2WWFA 3W6OA 5LYJB 4FHFA 5U4XA 2QTZA 4HSGA 1CDZA 1M5TA 1Q14A 2JAHA 1E6UA 1BFDA 1BMFA 1GCUA 3TL6A 3UH0A 4DQLA 1H5NA 5G3YA 3Q9NA 3OU6A 3Q8KA 4PGHA 3M8KA 2H2IA 2UYOA 2FXIA 4YDSA 1UXIA 4Z1MA 4A5SA 1M3SA 2OB1A 2REQB 1ST2A 4IXNA 3U26A 5E38A 2PMEA 3QIVA 1IONA 1L9XA 1ILEA 3MJVA 4WK4B 3ETLA 1PZEA 3M5CA 2PJRA 2O54A 2NYUA 4XVUA 4NP6A 3SM3A 3U3RA 1LJ8A 4E4YA 1ACJA 1HT3A 2GJ8A 3SK0A 2CLLB 4G5FA 4RV4A 4XPIA 3GARA 1RQ7A 4DQVA 3UM9A 2UYCA 1F3OA 3IIJA 4ZO8A 1D0SA 1M67A 3RYCB 2HUNA 3DW1X 1WU7A 2OFXA 3V8NA 2CCGA 3WMEA 1H85A 5DDIP 4KFUA 5K8TA 4LVUA 1A9QA 3ZHXA 1OF1A 1ZD2P 2EBUA 3KQSA 4MTCA 1YOVB 2A5FA 2QD2A 4AMBA 1JKXA 2WSMA 1F06A 1IBKB 3PGA1 2V6MA 1T0UA 1FUIA 3ONFA 4V39A 2E48A 3EWAA 4TTSA 5AFSA 2PWBA 1UXKA 5J58A 3FOCA 4FP9A 3PVCA 4AMYA 5IU6A 4EGSA 3W2FA 2W2QA 1JBQA 5JTTA 3DBHB 3PJGA 4DR7B 3E9MA 2EWMA 2BGMA 1DC8A 1BDMA 2ZGVA 3VVBA 1MVLA 3RIYA 2X22A 3LSTA 1JNYA 4FS3A 1CEYA 1GXSB 3AUSA 2OORA 3OPNA 2C54A 4D9MA 4XWOA 4DDKA 1Z18A 2A1TR 4L74A 1PJSA 3DOIA 3RU3A 1RCUA 5GPBA 3EOAI 1A4RA 3FSGD 4HCJA 4PW0A 3V80A 5ALJA 2DJ5A 4Q3EA 2VL7A 1KTIA 1KU6A 2JFXA 4EB8A 1Y4ZA 2I4LA 5ERXA 4QELA 4CIBA 3UYKA 4DPMA 3IDFA 3QI2A 4F56A 1IULA 4WESB 1C1HA 4YMUA 5A4MS 4QKQA 4OFWA 4BNTA 4BQFA 2JGJA 2FW6A 2KW5A 1DKNA 1KTVA 2Q0XA 3T4EA 4CN8A 4F21A 2XCLA 4J7UA 4DLRA 1LBIA 1CWUA 5CHEA 3JAKB 2ZBUA 4WZ6A 5IYZF 4RYDA 5EINA 4JENA 2JJYA 5T64A 3VNAA 4ENVA 1W49A 1Q83A 3U62A 3OZDA 4WZBA 5CGZA 1CE8B 3HJRA 4JJ7A 3AJRA 1QK5A 1K08A 3WGNA 1VKJA 2ZKIA 5K5EA 3IVXA 3DBIA 1MXHA 4Q9KA 2P3OA 5TMEA 4XDGA 1WP9A 3PLRA 4ENSA 2NSYA 1FPMA 3K6SA 1HTBA 4D43A 1H05A 1I4EB 1L8AA 2EC5A 1BYIA 2IQ5A 2BF7A 1X1AA 1N2EA 1DPFA 1P7WA 1UP6A 3GJXC 3M89A 1R4AA 1U2TA 3BXZA 1HFWA 3FVWA 3QMWA 3LUJA 3R0XA 4FT4A 1T9AA 1JIXA 4INZA 1FP1D 4K0RA 3TKAA 1EUCA 1N92A 2KE5A 1OFUA 3EASA 3GCZA 3QE3A 2J6BA 4NMHA 3KKMA 4P58A 4BE9A 1W5TA 3NR2A 4EKYA 3FDIA 1K97A 3WK9A 4BGIA 2KB0A 1T1SA 4ID3A 5CK4A 1WCIA 4CQMB 1GRCA 1I7LA 3LX8A 2AYZA 3KT3A 4P0PB 1MUUA 2PGAA 2Q4TA 1YR3A 2CHUA 3HEBA 4MVJF 2NO0A 5T41A 4AJJA 4HVCA 4IKPA 1J49A 1FFWA 5C8YF 1X3SA 4TKVB 3TW0A 3Q3VA 3B7GA 3BMCB 3Q7QA 3T5AA 1ZD1A 4U9IS 1WUYA 5IVDA 3OUTA 3SHWA 3QUAA 4DMGA 4V1CA 3FYDA 4W7IA 4ERXA 2JI9A 2C07A 3HA5A 3KT0A 4OMUA 1RXUA 1R4ZA 3I2JA 3WRVA 2BEWA 1NJ1A 3INNA 3X1JA 4MW4A 4UQLA 5JXJA 2C9MA 4IIJA 4DZZA 2WJ6A 3OUUA 4FX2A 1CQJB 4BKUA 2G3YA 5EY5B 3VBEA 2VDRB 3PNBA 4JMLA 1XZKA 3FKSD 4Y6LA 4DR5B 4YYZA 5CITA 5HZKA 3FWHA 3RSCA 4G25A 4TV8A 4W9NC 4KAXA 4RKEA 2GK4A 2WPNA 3L92A 1E58A 2OFPA 2EW1A 3GLHE 4MP6A 3HBAA 1IQ0A 1I7PA 5EXXA 5C1IA 1X9HA 1NMZA 2WUEA 4NE7A 2DKFA 2C5AA 5E6SB 5ED0A 2HB6A 4RKYA 2O8FB 3AF3A 5ENZA 4FE4A 2YJ5A 4NAHA 4Q03A 4Q7JB 1F5SA 4N0DA 1JSLA 5H5JA 3UT5A 3LT0A 2P1ZA 3G8AA 5EZSA 4D4GA 3VNUA 2PDAA 4QU8A 4QUJA 1G9TA 3IAS1 2HQ1A 1ULAA 3M4ZA 2ODTX 1KQFA 5KYNA 1N6HA 3A6KA 4E2ZA 4Y2XA 1DS6A 4URHA 3LLVA 3B38A 3I0NA 4UDNA 5GV7A 3O1LA 3HYTA 5IC6A 3QP9A 2Q21A 1KYVA 3IXQA 4IV5A 4BO3A 1H4SA 1VSTA 2GHQA 2A4MA 4H3VA 3HV2A 1R0YA 5EIOA 5E9QA 3LD9A 3GHYA 2DXIA 2PMWB 4E2YA 3HR7A 1EDEA 1V1RA 3S55A 1HNWB 4TXJA 1HE5A 4PO8A 4NCHA 3RFXA 4BLTA 1WZ2A 1PS9A 1BDIA 1Y3DE 2BV3A 3JWHA 1AKEA 4HK4A 4CLHA 5DO9A 5CA1B 3TRIA 4WRRA 1EVYA 1J2RA 1M8JA 2X19A 4PFJA 3A0RB 4W9RA 1ZU4A 3R2JA 4N4AA 5KHAA 4POOA 4LF6B 5F2OA 4RF4A 3QY0A 4CMHA 5KMGB 1WKVA 3SQWA 2IEAA 4DBVO 2FG5A 3C16C 1A8SA 2QMYA 4RK7A 4CV3A 3I6BA 1P9RA 4NOLA 4UMVA 4N82A 2CK3D 1FCJA 1T6XA 2HZ7A 3AHIA 4IVRA 3BXEA 2XRYA 3L8YA 3RR2A 3NHYA 2VJMB 2AEEA 2P11A 4NJEA 1P8AA 2IYNA 4GRIA 3REGA 4D96A 1JJIA 1WXIA 1VJ1A 2VRNA 4MUEA 4X61A 3JALA 3U5ZB 3M1IA 1SXPA 4DQUA 1MRSA 1SEPA 3BA6A 3OFSA 1EWTA 4Z53A 1WQ4A 1JH8A 1QTRA 5E7IA 5ITVA 3VPBA 1U2ZA 1ISRA 5CDUA 1SU4A 4D4JA 3ZCVA 5JAPA 5JVDA 5LLTA 3S7TA 3AF6A 3IV7A 2Z6QA 4P5PA 1PCXA 3C41J 1X70A 4ZU6X 1ID8A 5EMJA 2NVOA 1MEJA 3QUBA 4IIHA 4W4TA 1VKNA 4R83A 2QRZA 3SZLA 5KKAA 3VSAA 5JADA 2HDNB 2VSYA 3IV9A 3FUWA 3QOYA 1ZUIA 1T3TA 1AKNA 5F35A 4UZFA 1AS0A 2R8OA 2CFOA 1M8PA 3OZAA 2JH3A 2PRSA 2GOYA 4WKNA 2VTBB 4C2TA 3QIAA 2H0QA 5JPIA 2YIJA 1ETHA 5C37A 1YAHA 3QNMA 5DM60 3QUCA 3ACDA 4URVR 2YV4A 2Z57A 5I9SA 1NAHA 3PWSA 3FI9A 3UKJA 3UOAB 4E22A 2A0WA 4IYRA 5JS7A 5EKXA 4KAAA 4Z0TA 4J1SA 4LISA 2RJNA 1RI3A 4MWBA 4G5YA 1YSCA 5KTSA 1RNLA 1FLVA 4RF5A 4Z3DA 1ZYUA 1UPFA 2GEBA 4GDMA 2WSIA 4L78A 5COBA 3PD1A 2CC2A 4PO3X 4Y8VA 4BASA 1I7DA 1A2BA 2H7YA 4TMTA 3IMCA 1BFUA 3PNQA 4Y1GA 4AS2A 5LIRA 1ESDA 1XZGA 2R44A 4ZI2A 1VDMA 4QPDA 3OURA 4UTZA 5T7BA 2FCRA 4A92A 1C1YA 1G66A 1KGDA 3PYMA 1UPCA 4M1QA 4PCLA 3D8TA 1PLJA 2JIRA 2PLFA 4NC9A 1Q2UA 5CUQA 2MR5A 1NI4B 4X1YA 4ARSA 3ADCA 1C4WA 5B37A 1PDVA 4EF6A 1GGJA 1GKKA 3CUYA 4KQWA 2V74B 4MRMA 2V58A 4AFNA 4DJJA 4MCAA 3IS3A 3F3MA 3O1HB 1JHAA 2ZR8A 4PINA 1II8B 4RGQA 4UCXA 2C1ZA 3AUUA 4MO9A 4TRJA 5A3JA 3CRZA 3OF2A 5IDWA 5AKHA 2GHIA 2A3RA 1TYZA 2GYUA 1EUYA 2W93A 4HJXA 4QVGA 1K9VF 3CLTD 3KQMA 3LMKA 3RTCA 1PEDA 2HA6A 4N03A 3R0VA 1NURA 3UQYS 1UKCA 4PZZA 3D0RA 3LT2A 2E4ZA 2NW6A 1VRCA 3MOSA 1KSFX 2GPAA 3CUTA 2M6KA 3TK1A 1HR0B 1N2SA 1TKBA 4I50F 3BWXA 2WAXA 2J87A 2OQIA 3G5AA 1E2UA 2NVUB 1Z34A 3EX7C 2PPLA 2QN6A 3H8SA 1JSXA 1NHWA 2I3BA 2JKYA 2QG6A 4MR8B 2C92A 2XYQA 1ZOOA 3SXPA 3TTYA 3ZZNA 2FSVA 2OCDA 3BJEA 4X94A 3TAUA 2Y68A 4P86A 4B4OA 1M6NA 2QAGA 2I7XA 3G3EA 4N7JA 1E7RA 3ZWVA 3I53A 4KDRA 3FUVA 4PAQA 2K7FA 1PG5A 4Y1FA 2JLBA 3LFTA 1E3IA 4CDRA 4IDPA 1RS0A 4ZC1A 2HJGA 1LCIA 5JIBA 2LD4A 1DDIA 1Y34E 3NCHA 4JI2B 2ZRBA 2QYSA 4UTXA 3G2HA 1V5GA 2XWJI 1KMHA 2PUHA 2ZUUA 1J7JA 4E1BA 3NVKI 1TJ5A 3ORFA 2C2HA 3BMXA 4KEAA 1YQDA 2WWHA 2GKOA 3E5RA 3F47A 4JT8A 4PR3A 1OR8A 2JLSA 2NTVA 5BOVA 3I58A 4LY3A 4M1ZA 2Q6IA 1HDXA 1P7CA 3TLJA 4AKGA 1PFGA 3O91A 2A4KA 4X1IA 5F3DA 4ZD6A 1YCHA 1LNSA 1NVVR 1KPIA 1QQ6A 1QZXA 3MGBA 4KVFA 4PS1A 3S29A 4BRZA 3PXDA 2VDNB 2XGMA 2QZJA 3NHMA 4GOXA 4F46A 3R9KA 3E3OA 3O9ZA 3X1ZA 4RHUA 2PXXA 1G8MA 2FW8A 4TV9A 4CTOA 3TVDA 4X65B 4ZCIA 3JQPA 3B1XA 3C15C 1LBHA 5KI6A 3CVWA 3LFHA 3I92A 3ILXA 3FF1A 3PPIA 5IH7A 2VK4A 3HKBA 3KWMA 3W5BA 3IQXA 3R0JA 2X41A 2OOSA 2G6TA 3TXXA 1A9SA 4CV0A 2DBVO 5A4KA 1XUOA 2BRUC 4BTVA 3KWFA 1J7KA 4QTTB 3THOA 2IYQA 4KRGA 4MUBA 3RS8A 4DSAA 4WOJA 3JARA 3VR5H 4BPRA 3CRNA 5HFJA 1FMCA 2J30A 3HRIA 2VRCA 3KZKA 4OLAA 1HUQA 2XUFA 1ONSA 3JWIA 1D4OA 3GAMA 4HGYA 4OFZA 3VNSA 5B30A 2XXAA 1AUQA 2ZS7A 3U3JA 1BWSA 1P6UA 3OTIA 4ON9A 1EX6A 2WT9A 3I30X 1N5OX 2JGAA 1NW3A 2XMCA 2WVJA 2M6RA 4DR3B 3AXSA 3NJ8A 3IC5A 5HF6A 1GLNA 3I76A 1GQYA 2GR9A 4DCCA 2HMAA 5FF9A 3EDYA 4UUPA 3RVLA 1XMPA 1VMIA 2PBLA 4GRDA 4NK4A 1ZM2A 2PE5A 2OLKA 3B36A 1DJNA 2ZYVX 3AEUA 3G85A 3VR0A 4TZ0A 3C85A 4GHWA 4YREA 4X44A 4IIYA 1BVHA 1DNPA 3PDIA 4MUIA 3CF2A 1JU9A 1RDFA 3LZCA 4NNJA 1N8SA 5C4IA 1RQNA 2Y6VA 1ND5A 3Q6NA 4H17A 5DK4A 2GN0A 2BVNA 4EG7A 5DN6D 3K5PA 3T1TA 5KDDA 6AT1A 4DMFA 2YWFA 1HT2E 3EZXA 3MRTA 3Q9SA 4AJ4A 4MVJE 2MWMA 2CZGA 3QTLA 5IMBA 3OTGA 3P9QA 1H0RA 5HJ2A 3T06B 1L0BA 4JLDA 3ZNQA 1ZVMA 1OI3A 1P1JA 2PX2A 5GONB 1YJCA 2B30A 3L7CA 1UZMA 3EFHA 4BWVA 4U5XA 2BMDA 4MEAA 4CRWB 2CJWA 2GYVA 3DHNA 4WLFA 4DUPA 1U0TA 2H5EA 2BFNA 1Z5PA 1G5RA 2YQ5A 2H4HA 3B78A 3KQWA 3G1UA 4I99A 4BRUA 4DB4A 1BJRE 2O0HA 1NJ6A 2QG4A 2V8OA 3SYMA 3NHAA 3AMVA 3BCUA 3FFBA 1A50B 2PD3A 2OHIA 2YNMD 3SFTA 3EFOB 1AD2A 5C5EA 5HZGA 3WSVA 1H2YA 3OVMA 3R24A 5CNKA 2I65A 1TAHA 3HCRA 4C7BA 4RTOA 3CNEA 1ZL2A 4ENTA 3H8WA 5FYQA 1Q0QA 1TC1A 1FLDA 2V7VA 3UHJA 4IVNA 1E2KA 4CT4B 1ENPA 2XZTA 3GLGA 4ND2A 1S2OA 4Q7EA 2CXSA 2F3PA 3FJ1A 1YA6A 2GAOA 1LSJA 4J9VA 1K0FA 3R09A 4FFPA 5MGBA 1VSUA 3H16A 4EAAA 2P4HX 1KZ4A 1TEZA 1Y89A 3DNPA 3DZGA 3NFYA 4A8TA 4RAOA 2VTVA 3O8RA 4JP3A 1QXSA 5ALTA 3AKZA 2HLHA 2NZVG 5FOXA 1ZICA 2FEOA 2H52A 3D3KA 4DARA 4RTKA 5JYDA 5DXAA 2G1AA 2QPLA 1HMPA 3IUEA 1O4VA 1WG8A 2JW5A 5BQOA 3G23A 4QRIA 3TXYA 4OK6A 3P27A 2BZ0A 2LWIA 5LD2B 2BM0A 1X3LA 3FB1A 3ZGXA 4DIOA 2Y8EA 4CIVA 1R6VA 3FI0A 4M1MA 3P96A 4TL8A 4EZBA 3NMUF 1NOKA 2C4NA 4ISBA 4QOJA 3UWOA 4Y98A 4IJMA 6REQA 5KINB 1JTFA 1DUSA 2ROQA 2YHUA 2W2LA 5LBTA 3VYRB 2ORIA 4ZI7B 4A16A 4M8IA 3DFZA 5GVRA 2VUTA 1DQRA 1E9CA 4EI7A 4LAFA 3GN2A 3VR6H 3NUGA 4NXMB 1A8UA 4MA5A 4LZNA 1SCQA 1YB5A 1UMCB 1Y5IA 3Q98A 1JZQA 2D4AA 2JDIA 2X4DA 1NLFA 1SVIA 1NBEA 1Y81A 2NP7A 4I9FA 3SEFA 1YZQA 1LBEA 2BFAA 4HC4A 2DHCA 3JCZA 1SMKA 5FBLB 5JR3A 2BGRA 2AN3A 3C8HA 1YUNA 4ALKA 5IZ4A 3VFDA 4IDEA 3MXTA 1JG2A 4TPKA 2B2CA 1OYVA 3AY6A 1UF9A 2VC2B 3I8OA 2JC3A 4S0XA 5BMVB 1W76A 3G2QA 3OPYB 3F5DA 4IAOA 1RRMA 4E5MA 3NTOA 3D59A 3ZOKA 1IK6A 4MEBA 1VLLA 2WG0A 4M0LA 1WXFA 1IAQA 2BP7A 4NZMA 5J2UA 2ZFUA 3D6UA 1E4YA 2E6UX 3M6FA 5JXIA 1QQ7A 2XCRB 1FX0A 1SKUA 2HBRA 1ARZA 3WB0A 2RHRA 4NCXA 2I2DA 2PLWA 2YZMA 4RPHA 1II9A 5FX2A 3IKVA 1PJ2A 4NMXB 1J0CA 1T43A 1PJ8A 4PG4A 1OYYA 2JARA 3BD7A 1W4LA 3ZD8A 1NQUA 5LXTF 1CD5A 2Z5GA 3FYSA 3SBXA 1E99A 1WBJB 5I01A 3TIVA 3KX2A 2ECKA 1GZ7A 1S2GA 2GCOB 1N9GB 4JYAB 2HBYA 2PH7A 2ECQA 4K9MA 2IHZA 2JHFA 1MT0A 3EXFB 3FR8A 1OI7A 1XA4A 1G7SA 1V3VA 5DTRA 3P4UA 2IZZA 3ZI4A 2DH5A 2P2CA 2QSUA 2G6BA 4MYDA 2VDWA 4PO1A 4OGWA 4H3SA 4J43A 4D97A 4MS3A 4XOUA 3CNHA 4N8SA 4PU0A 1D2EA 2EW2A 4R9VA 3WLOA 4CFSA 3GP8A 2GBLC 4DSNA 1FPQA 2OUKA 2YYYA 3VH4A 2C61A 3CZ4A 2QLMA 3OJWA 1ZI9A 3WG9A 1DOHA 1PZHA 1ZXBA 1ECBA 4PYQA 4F93B 2BHTA 4JNCA 1Q7RA 3B5IA 1XCPA 3ZWYA 1SK9A 5ALVA 4Z3OA 3FZEA 1C8LA 3N74A 4DA6A 3R9XB 4RL4A 1V2GA 1UDWA 4ZVOA 5C31A 4QQFA 1L4YA 3STUA 3CXRA 1NUTA 3CE9A 5DN9A 4OI1A 4RIGA 5LD2C 2I3GA 3TZEA 4FSDA 2JG3A 4BS9A 3SIRA 4C76A 1RXIA 1E89A 4KWEA 4JQOA 3BIWA 1GVHA 5ADUS 5E4YA 4OL9A 3O8LA 3U1VA 4G5XA 1MOSA 5LOVB 2Q8NA 4R3NA 3AETB 3L06A 1H6AA 4WERA 1R5OA 3DCNA 3CR8A 3JVIA 3VO1A 3PJFA 9GPBA 3MWEB 3AK4A 4P38A 3NC0C 3WR5A 3WJAA 2WFLA 3W5CA 4B80A 5J40A 1YL6A 2B6NA 4MGYR 4V2UA 4BV8A 2AGVA 4Z4EA 1YZGA 4L50A 4QNMA 2XUZA 3G13A 3E5NA 4UJ3A 1UC9A 5ALRA 2RGNC 1JEEA 1O95A 2YN0A 1TK9A 3RKUA 4OI4A 1QZUA 3VJRA 1RHUA 2D00A 2VZ8A 1NT4A 7MDHA 5A06A 5IVHA 2HHHB 4RKFA 1BX0A 2F1OA 5E6RB 3UKDA 1I6LA 1EFUA 1QZZA 3IBFA 5HDBB 1GR0A 2B7CA 3WWYA 4JV5B 2PHZA 4L16A 1QFSA 3JTMA 2O57A 1GGMA 3IJPA 3A9UA 5D6NA 2B69A 2YOGA 2X2FA 1SUWA 3LG2A 2ZE5A 4NBUA 2QUHA 4PSUA 3WNVA 4ME6A 1FFYA 4RIIA 2PKRA 3B52X 1HORA 3IBTA 3TW4A 5FNVB 4BLSA 2HMVA 2VPPA 1CC1S 3SVZA 3H1AA 2BGIA 2VTEA 2O1EA 3M82A 5FO0A 1EG7A 1U2GA 4FHZA 1U7WA 1D5WA 2D1YA 2EFCB 2OD7A 4G1UC 4IH4A 1Z0AA 2DUMA 4MWDA 3JVVA 2K5UA 5ALUA 3QVWA 4IIXA 4K9RA 5FULA 1UMBA 1AQIA 4X45A 5E6UB 1QP0A 1PYGA 1K75A 2Q4EA 3L6OO 4I4TA 1UL1X 3OLZA 4D9GA 2GN1A 1Y1TA 4MVJI 1HV8A 2ZUDA 2NTJA 3SG0A 1XWWA 1XPUA 2QZSA 3DDZX 4UCFA 1SHKA 2AE2A 1A9ZA 2C1EA 1L4UA 1YRYE 1J25A 4G84A 4QYMA 3THWB 2XOEA 1RRPA 2XDQA 5FT9A 3LHFA 1GNLA 4HNVA 1N5JA 1TMOA 2BHSA 3PKJA 1CVIA 1GPNA 5AW8A 3C98A 1NULA 3T4UA 1WDLA 1KAOA 1QFJA 3H4MA 3MVEA 1AY0A 2J1LA 3P26A 1ZCFA 4A6DA 3N8HA 4R2MA 1YTLA 2QI9F 3A9RA 3F3YA 1GFIA 3FFTA 4P4SA 3H9JA 5EWJB 5J23A 1BNCA 1CR2A 2GHTA 3KYCA 5AK3A 4ZQIA 4EK9A 4IEIA 1PZGA 3NANA 5JMTA 3ZTTA 1ZX1A 3RVKA 3K4HA 4IDQA 2PX4A 1EJ6A 1NNSA 2CLCX 3OTHA 2Q1UA 1HLPA 1H9CA 1JW9B 3I5AA 1XDWA 4PZDA 1SVUA 2D1QA 2JGDB 4HQRA 4FDMA 3DONA 3KZXA 3IPAA 3NX4A 1DMSA 2GEJA 1F60A 4JJFA 3VDMA 3J81k 1SZPA 5AW0A 1JJ7A 2PQ6A 3PHHA 1W93A 4ZYXA 1XU4A 1IY9A 1Z0UA 3PZBA 3MWLA 4J0FA 1C7EA 2PX5A 3GRPA 2Y99A 3KPYA 5EN4A 3K0CA 1MX1A 3UC5A 3THRA 5KJ1A 2A2ZA 3A6ZA 1AMUA 3TDMA 4R5MA 2VF7A 3NHPA 2Q3DA 1PZFA 3JQQA 4MV4A 3ESDA 4PN7A 4Z51A 1XAJA 3JQ7A 3H2IA 3G5LA 4TUYA 2HV9A 1KSHA 3C6KA 3MMPA 3ESCA 3Q3HA 4UCQA 4HNTA 4XQ0A 5SYMA 3LCMA 1I5OA 1DI0A 5KO2A 1CW2B 3R3VA 2P9BA 2Z3WA 2PZ8A 4FJ1A 3HS3A 3NS7A 1N5LA 3B3JA 1PN3A 1Z4JA 4JLAA 1JQJC 3HB0A 4JB8A 3KXKA 1AQYA 1APBA 3QELA 2NADA 1ZJJA 4G09A 4XIFA 4ARVA 4FTWA 2D5BA 5CFMA 2HPVA 1K5HA 3H6KA 1XVUA 1B0UA 4GICA 4NU6A 3R7BA 4CKBA 1F7UA 1CUCA 4N12A 3R44A 4Q3CA 3OF3A 5KNDH 4Q7MB 3ELBA 2CFTA 2ZAIA 3PFIA 4G2TA 3KALA 3LUHA 4D81A 2JRLA 2REBA 3PGVA 5TRTA 1LXCA 1ZU5A 3SYNA 1M6VA 4NENA 3MUOA 4CUJA 5KYWA 3HCWA 1UBRS 2B9VA 3VH2A 4CI0B 1T34A 4S1TA 4X8MA 4ZALA 1XJ5A 1QR2A 5LJLA 5F77A 4P54A 1X7YA 4WHMA 2ZWIA 4IZOA 5IC4A 4ZU1X 1NRXA 1EM8B 2INGX 2HTEA 4ODIA 4RZ2A 3DMDA 2RGBA 2BM8A 1X13A 4F1WA 5GVSA 2F1HA 2EIXA 3F8WA 3WIOA 5DLPA 1GTMA 2C7VA 5DMHA 1GZSA 1TW3A 3C5WP 1V3UA 4I4IA 2CFCA 4YUWA 1W7AA 4L5JA 4U8GA 4DDWA 3LVFO 3HO1A 1J2YA 4GIBA 3PXAA 1XHLA 3NASA 3QKRA 1HOTA 3O4VA 3RSSA 1ORRA 2PH1A 1Z56C 2JJQA 2ZBGA 5H82A 5C0OE 2VAPA 3NEAA 5JH7A 4XLLA 3I2FA 2PYDA 2WLTA 5AJVB 4PLZA 1NJ8A 3OE7A 4URUR 3RB8A 1P73A 5KTPA 3AUYA 3ICCA 5EJ9A 3WLHA 4DT1B 4E5KA 1G19A 2VWPA 4NFLA 3H1BA 1ZINA 1ZW6A 2MYUA 4NYJR 3RSQA 5IT4A 4BGUA 1JQDA 2WMOB 1KI2A 2AE1A 4GPTA 1I10A 1QH8A 5BVGA 1DKRA 2APJA 3ESRA 3NPMA 1AK2A 1U28C 4LKRA 2YY6A 1XZJA 2EBHX 2LNDA 1WTCA 2QTVB 3IVRA 1A9RA 2OQ2A 2VJOA 4BAGA 2IUFA 3NCTA 5K99A 5I7OA 2DEUA 3F5QA 3CKLA 3ASZA 2OD2A 3NFRA 4KMOA 4HNRA 2GBIA 2WUVA 3OJLA 8ABPA 5IXSA 1SCBA 1ULHA 3MB8A 3OG9A 4AYWA 5CXQA 3MILA 4WFJA 2RHBA 5JBQA 4FYMA 2PO7A 5IM4F 4RJKA 1ZM4A 4I5GA 1IUNA 3VX4A 3EXIA 3TEMA 3TSAA 3WA7A 1INLA 4IOMA 1VRWA 2CUZA 1KVSA 1DV1A 3DWIA 9MHTA 3LGAA 1CT9A 4Y6PA 2GPJA 3C6QA 3V4VB 4EYOA 1RC0A 2Q5JA 3TLGB 3ITNA 4PRYA 5ILQA 1S9DA 4B17A 4P7JA 1I7NA 2H18A 4RL6A 3R40A 2H07A 2OPHA 4G5GA 4WCVA 3DEIA 4ZV4A 2DZDA 3A05A 4IGFA 1GSOA 1Z4LA 1NPTO 1Z0JA 3N9IA 1FE8A 2Z4TA 2ONYA 4YCAA 1LBTA 3GZJA 3WLAA 3UCXA 4BKOA 1KF0A 2I78A 2B61A 2B7BA 3K6KA 5B3LA 2C03A 1AH2A 2C57A 1NZDA 4Y6SA 1QGED 3I9JA 5KWSA 1URPA 3D6HA 1C9JA 4HV4A 4KXNA 1S3IA 4UATA 3BAZA 3QXCA 1V6AA 4ND5A 4FILA 4PSVA 4QBTA 2EU8A 3KSZO 4J3FA 1U5AA 4QFDA 1ZJ6A 3K0AB 4AZ0B 4B6RA 4BX3A 3BE6A 2REOA 1PAUA 3ZLVA 1BVUA 2FPGA 4BLWA 2V7QD 3QLVC 1F2UA 1WEHA 2H5LA 1C4XA 1Z7EA 2B25A 3A1FA 1QNFA 3OJOA 4ICIA 4IJ6A 5AKGA 3T7AA 5JSQA 1BCRA 1QLHA 2VHUA 2D2IA 2C94A 3DTVA 3HDQA 4EG0A 5M7EA 3TRJA 1Z2EA 2ON6A 4PFQA 3BE8A 1GDTA 5B1SA 1O89A 4KR0A 5EZYF 4PXYA 2GZAA 3KKLA 1Y3IA 1NMEA 3UWKA 1I0ZA 2XYPA 1GYRA 1DO2A 2ZJ6A 4F8JA 3WGYA 1GPYA 3HN7A 1NRJB 4YJ2A 3EDCA 3TFQA 2JAOA 3BRSA 5FI1B 2R60A 2AIRA 3EIUA 1V47A 3BXFA 2QIOA 3SJ7A 3ONEA 2YC2C 2QP4A 2KWIA 2O7VA 3H84A 4QUBA 2J6HA 4U7PB 4LOIA 3NB0A 1KQNA 3UAYA 2ZK7A 2W71A 4IHJB 5TPZD 1VECA 3R20A 4LMRA 2JGFA 2ZYUX 1OTYA 5DE3A 1BCSA 4WA7A 1H3EA 2V96A 2ANBA 4KRYA 4WTOA 4YNBA 1XN1A 5EPOA 4F4JA 4YHBA 2X6QA 3O2JA 4BCCA 4F71A 2HRRA 1MQ8B 2J41A 3AINA 1O1YA 4OLJA 3FPKA 4AU1A 3Q7PA 4DMHA 2V9ZA 3EQZA 4KACA 1CQIB 4MVJM 3KKEA 4ROSA 2QXUA 2SKCA 1TZCA 3QWFA 4NG5A 5IJWA 2RCNA 3SQOA 3Q0TA 1JA0A 1MB9A 4S24A 2EL9A 5CT8A 2O2DA 1QP7A 1E3SA 1SVOA 5EHXA 4WXHA 2FF7A 1HZZA 1XVTA 2J8ZA 3D31A 2Z09A 3KEOA 3N2KB 4BNXA 2VJBA 1PTJC 3G17A 4NYMR 5I8PA 1M66A 4A2PA 2VJLA 3I9V6 5EJ2A 4AMVA 2I6FA 5BRJA 3ICEA 4EWLA 5JJBA 3E7DA 3H5AA 4YJFB 4EGFA 3WV4A 1DT5A 1RBZA 3DL4A 1J42A 2V97A 3H5IA 1XLWA 5JEDA 2D1TA 1XD9A 1BH6A 3EGDB 1CHNA 4WMLA 5CM8B 5LJIA 1R0SA 1TK2A 5FEUA 1V1MA 3MLEA 3OSUA 1TADA 2PZEA 1RD4A 1V7QA 3RC2A 1WHSA 5LQRA 1N77A 4XW2A 1H1LA 1SQ0A 5JS1A 2HNKA 2X3FA 1KK0A 4A1FA 1VCNA 1WRBA 3PI7A 1LC0A 1Y8AA 1N6RA 3HSKA 3JQFC 3L5OA 3L7NA 2BM9A 4JH0A 3E58A 1GQFA 5B3AA 1Y7LA 4HN4B 2TSYB 3IA2A 4TMZA 4X7PA 2WYIA 2PMCA 2X5KO 5ITZA 1LI7A 2ZYDA 3ESBA 4F7WA 3N0XA 4QLBA 1QYWA 5KWIA 2HSEA 2I6SA 2PRIA 1Q6ZA 1PV1A 3DMHA 3ON5A 3PB3A 2I7TA 4AKTA 4OHCA 1LV8A 3T5TA 1O3YA 1HE8B 3T1QA 3THSA 2F67A 2G0NA 3ZHCA 1HQDA 3CUKA 2WNIA 5DOZA 1S0UA 3ZWCA 1XPRA 4FFRA 4Q18A 2CCKA 3COPA 1XO1A 3L6UA 4FNGA 4Q1BA 5IS2A 3SF8A 1Q7GA 3NG1A 4N54A 1E2MA 2XOKA 4X60A 3VJKA 1VHQA 3RHFA 2WBLC 2HD4A 4B32A 1V7PC 1V6CA 2RHTA 1QIJA 4HDMB 4HWPA 4O2AA 3CVUA 4GSKA 3E8MA 3E9ZA 2MMCA 3D4OA 5L4LA 4JC5A 2YOFA 4X62B 4IV0A 3GLSA 3RF6A 3T3HA 5TIIA 1GT91 2A9JA 3NWBA 2K2QB 2HA2A 3P4XA 1UXJA 4MPDA 1SC4A 4HAZA 4LGMA 1GRNA 4RX1A 1RJDA 1LNQA 1N57A 3B2QA 1MIOB 3DD1A 4RCYA 2IGBA 4K46A 3EULA 4ZVQA 5THXA 3M4JA 4XA8A 1OAOC 3ZHYA 4GVLA 4RIEA 4RXUA 4CT0A 3CPJB 3UCEA 2MINB 1JQLB 8GPBA 2QVLA 3JYPA 4KLZA 3PRYA 4FDUA 2W6JD 3EZGA 4JLJA 3CURA 4UU7A 3RYHB 2CMKA 5TARA 1PU2A 1U7XA 3TSZA 1UOOA 3I04A 3OP4A 2W6MA 4RTPA 4KV9A 2EOAA 1B0PA 1I2AA 3JRWA 4F4FA 5DWVA 4DR1B 3Q12A 4OHMA 3ROMA 3WTBA 3ANSA 5IP5A 1SB9A 3AEKA 4D6YA 1ZBDA 5PNTA 4QUHA 1X92A 2RBEA 3BF8A 4Z0HO 4OO3A 1VPEA 1JIIA 1FBNA 1PT6A 2BR4A 1IVYA 1LK7A 3T1HB 4R71A 4L3VA 3DL0A 2JIDA 4UAGA 2JHGA 4DIFA 1JHPA 3O3CA 4XZ3A 1NSTA 2BEVB 1L4NA 1CLEA 1RPNA 2D2XA 2JJMA 2ECOA 4CUZA 5F3WB 3ASUA 4MKGA 5KSYA 3G7UA 4UUAA 3IJEB 2NU6B 4CF6A 1FYXA 1A82A 1QTQA 3ZLBA 2RGUA 4HH1A 5JJIA 3NO4A 2P7HA 4MK4A 4BDTA 3N59A 5JJLA 3G82C 4OXYA 4LNUB 4UHBA 3KWJA 3SJAA 1MU0A 1CUGA 1NOJA 2HHJA 5D00A 3LY5A 4F12A 5JI2E 4OXKA 5HJ7A 1ZMXA 2C7GA 2OB2A 3RH0A 2IOHA 4HJRA 4ABYA 1VBKA 3X44A 4TQU