1Y0GA

Crystal structure of the escherichia coli ycei protein, structural genomics
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
169
structure length
169
Chain Sequence
b'ADYKIDKEGQHAFVNFRIQHLGYSWLYGTFKDFDGTFTFDEKNPAADKVNVTINTTSVDTNHAERDKHLRSADFLNTAKYPQATFTSTSVKKDGDELDITGDLTLNGVTKPVTLEAKLIGQGDDPWGGKRAGFEAEGKIKLKDFNIKTDLGPASQEVDLIISVEGVQQK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein yceI
publication title CRYSTAL STRUCTURE OF THE ESCHERICHIA COLI YCEI PERIPLASMIC PROTEIN
rcsb
source organism Escherichia coli
molecule tags Lipid binding protein
total genus 40
structure length 169
sequence length 169
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04264 YceI YceI-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.110 Mainly Beta Beta Barrel Lipocalin Lipid/polyisoprenoid-binding, YceI-like 1y0gA00
1Y0GA 2FGSA 2X32A 2X34A 3Q34A 5IXGA 1WUBA 3HPEA
chains in the Genus database with same CATH superfamily
3T6FA 5FFHA 1UYNX 2DJGA 5F1EA 1AVEA 1ZNEA 2WUTA 1PBOA 2OL7A 4DCBA 1SXUA 3QQ2A 3HK1A 1WBIA 2AL0X 1GXAA 1X89A 2A2GA 4GGZA 1DFVA 4ALBA 1H91A 1N9YA 2Y3FA 1DZMA 4AZMA 1LPJA 3FR5A 1S2PA 3KVNA 1X8PA 2JU8A 3U03A 4ML7B 1CBQA 2K62A 1FJ1E 2OVAA 2X46A 1DF3A 4U3QA 3NQ9A 4OELA 1JJJA 2OFRX 4AZPA 1RXHA 4U8UM 2Q4NA 4N7CA 1NQMA 2X8FA 1SRFA 4XMCA 1YWAA 2LB6A 1SWUA 2FR3A 3HWFA 1HMTA 1VWRB 4XMHA 5AQ6A 3ZI8A 2QMIA 4A1HA 5EZ2A 3GE2A 5HZQA 4A60A 1VWPB 4MVEA 1VWLB 4BVMA 3P6DA 3WJDA 4FGIB 1PM1X 3RDMA 1DC9A 1MK5A 2X45A 4GUZA 4A8ZA 2G78A 3JSQA 2ASNX 2RTMA 4YH0A 2K23A 2RTFB 3BLGA 1SWKA 1UZ2X 1E5PA 1N0SA 2FHNX 2OVDA 3LTWA 1CRBA 4YCHA 2IZHB 4MIRA 3P24A 5DG4A 3VG7A 1G85A 3BS2A 3B2JA 4CPFA 4QGVA 3FEPA 1W6FA 1SRHA 1T68X 1VWMB 2WEXA 3APVA 4R0BA 3EM0A 2OY5O 5L8IA 1N43A 2X8SA 1HXZA 2BS6A 3S60A 1SWFA 3KQ0A 1PTSA 2CZTA 3EW1A 1RSUB 5BVQA 3HPEA 4HFOA 4U9CA 5K67A 2AT0X 4AW8A 3SAOA 1KZXA 1SWLA 3FA7A 4Z2VA 3EBWA 2JN3A 3PP6A 3JQOA 1KT3A 4YKMA 1AQBA 4ZCBA 4CDCA 2DJFA 3FW4A 3P6FA 4KT5A 3O19A 2FS7A 4YGGA 2JOZA 1W5RA 2OZQA 1EI5A 1OBPA 1G5WA 1STPA 1CBIA 3IA8A 1TOWA 4MVLA 1K24A 2JU7A 1YP7A 2FS6A 2OF8A 2RTAA 4GGRA 2UZ2A 1E06A 1QY2A 4GD9A 3PECA 4JHQA 3WJFA 1O1UA 1Y52X 5LJHA 1ML7A 5CE4A 4O3XB 3HOEA 1SY0A 1LNMA 4MEEA 1L6MA 3SLOA 2Z4IA 1A2DA 2ZAGA 3D96A 3RE5A 1HXLA 3DTQA 4ODDA 1ALBA 2WEWA 2AH7X 4I3BA 1HY2A 2ACOA 4ZH6A 2FTBA 3O22A 4I3DA 4KC8A 3D4RA 3RY2A 2LBAA 3CMPA 4FQBB 1YWCA 2OY1O 4LZVA 1BSYA 1BRQA 1XKIA 2AKQA 2IZIA 4PSQA 3NPOA 1ZNGA 2XKLA 5F58A 4WFUA 4XMDA 3TGBA 3EW2A 4U8UN 1HMSA 5HZ8A 3OE3A 4JNJA 4FBRA 4GNWA 2QO4A 4QZUA 5AJCA 4Y0SA 3VHIA 1MEPA 4I95A 2GTLO 4Y0RA 5IO6A 1IKJA 2RTRB 2FHLA 3HWEA 2UYWA 1HMRA 4PJ2A 3FDCA 4TJZA 1VWDB 1SWDA 4I60A 4AZNA 5IXGA 4I6SA 1Y55X 2WPUA 2FGSA 3FW5A 4FBOA 1SWQA 2IZDB 4HPAA 4UU3A 4ZHCA 4I3CA 4GH7A 5LKFA 1O8VA 2NNDA 2OF9A 2RN4A 5F7GA 5HCEC 3RDSA 3RWXA 4BGFA 5H9LA 4WBKA 4Y59A 1EPAA 2OVSA 2OY7A 3U9PC 3FR4A 3NQKA 1LIFA 1I06A 3NADA 2FLJA 5HCCC 5EPQA 4DNEA 4Z2OA 2FKJA 3O2YA 1ICNA 3BU9A 2OFBA 3UEWA 1OEKA 1SWEA 3AEHA 3B2HA 4EQAC 1SWBA 1VYFA 3RSWA 2Y3EA 4YVBA 1X8NA 2X32A 3FENA 5B11O 2LBVA 4EDEA 4GZVA 1XCAA 1U17A 2ALLX 3FEKA 3RZYA 4CK4A 2X56A 4ZHDA 4BX5B 1T0VA 3LHNA 1I04A 2RTQB 1VWOB 4ORRA 2F73A 2DM5A 4ORSA 2XSTA 3PDFA 3BY0A 1LFOA 1NGLA 3KZAA 5HBSA 2WSJA 4BX5A 2LFOA 4YCEA 1LF7A 4ZFXA 3F8AA 4CV7A 3RBYA 2RCQA 2A2UA 5HA1A 2R74A 3FMZA 3EC5A 4MVKA 1HQPA 1KXOA 4NNSA 1NP1A 3ELZA 4YFQA 5D47A 1N7YA 3FIDA 1WUBA 4YBUA 5B3MO 1BSQA 1SREA 3AKNA 1RSTB 1HBQA 3UEUA 4AZOA 5IO7A 5EDBA 4GRJA 2L9CA 1RXJA 2EU7X 1A18A 4KC7A 4QAEA 2HKDA 4ZH9A 3STNA 1LKEA 2IZGB 4N7DA 3DSZA 5F6ZA 1I9HA 1SWOA 2I5VO 3B2KA 3QKGA 3AUMO 2CM4A 2KTDA 1TXLA 1PMPA 3APXA 2L5PA 3WZNA 2IFBA 4BJ8A 1ACDA 3FA6A 1RAVA 4L3RA 4CPIA 1VWHB 2ZSCA 1U0XA 4OMWA 5B5GA 5KICA 2W2AA 5B10O 4ZJ0A 1E00A 1D3SA 3NP1A 1KQXA 2RTKA 1KQWA 1MVGA 2MHDA 4GDAA 4ORWA 2E4JA 1KT7A 2Q9SA 3APWA 3NX1A 4IB8A 4GU8A 2OL6O 4Z2PA 1VWGB 1K3BA 4IMNA 4YGZA 3S5VA 3WJGA 2IZJA 1OEEA 1Y9LA 4COTA 4XMFA 1JBHA 4ID2A 1X71A 4EEJA 2LKKA 2MJIA 4BBOA 1SWAA 5F6BA 1A3YA 2FRSA 1JQPA 3VHHA 3F6ZB 4Z27A 2G5LA 1SWPA 2MM3A 2WWPA 1I05A 1DV9A 2JMBA 2RTIB 3GAQA 1Y0GA 5FQ6E 1QY0A 3SZJA 2OVEA 1YWBA 4RUNA 4IB7A 3VG6A 2GH7A 3FELA 2BC3A 2MF6A 1GGLA 1SMPI 1VWBB 4QYPA 3ZW2A 1KL4A 1KZWA 1E2TA 1SXYA 3WXQA 1SY2A 2WQ9A 3I0AA 1P6PA 2C4IA 4KCAA 2IZEB 4M7MA 4CDEA 2BSZA 2VDFA 2OL8O 4O4UA 2RTDB 1PEEA 4INNA 1KFFA 2A13A 1FDQA 3PPTA 2FR2A 2VFBA 2G79A 1YIVA 2P8GA 3N91A 1DF8A 4I9SA 2CAMA 5BVTA 5IRWA 1SWCA 3LV4A 3PK2A 2MO5A 1SLDB 4GJVA 1UREA 4HWMA 1GM6A 2CZUA 3S5XA 1GX3A 1SRJA 2L67A 4JGLA 2IZKA 3BDRA 3UEXA 1AVDA 3C78X 5HZ9A 1YP6A 1JYDA 1W4TA 2IZBA 3F9DA 4QGXA 5LJGA 3OJYC 1YWDA 1SWRA 1JJXA 1FELA 1GT1A 3FIQA 1I78A 3P6HA 4OEMA 5F2BA 3CQRA 2QOSC 1VWJB 3P6EA 3KFGA 2OFMX 2QM9A 1LCVA 1LCWA 4ORXA 5DPQA 1LCZA 1AB0A 2Y32A 4GNYA 3RKGA 1KGLA 1N9MA 2NNQA 5D45A 1YUPA 4AZQA 2LA7A 3VG2A 1GX9A 2Q39A 1O1VA 2C1QA 3MG5A 3T6LA 4GKCA 1OEJA 1OPBA 2ANSA 1MX8A 2G8CO 1BSOA 4LKTA 3ZUOA 2RTEB 5D4AA 1B56A 4ZHGA 4BCSA 1HBPA 3RDQA 5KIDA 3HTYA 1AELA 1SXWA 2M4LA 2O62A 2RD7C 3MBTA 3NBXX 2X34A 2OYBO 5HCDC 5FAZA 1IW2A 1FEMA 2NP1A 2GTLN 3Q6LA 2F09A 3L4RA 3TGCA 1EIOA 3X00A 3TZSA 1QY1A 5D8JA 2AT3X 3BSZE 5EEDA 1SRIA 1SWJA 4O3WA 3RY1A 4CSBA 4QZTA 3ZW1B 1STSB 1LIEA 2W2BA 3WJCA 2A8GA 3ZZVA 1BWYA 1DZPA 2QO5A 2ZAIA 3FLLA 4IBAA 4YKOA 1UYOX 3V8UA 3EMMA 1KL3A 3ZWEA 4BX7B 3P02A 2BS5A 4KH8A 3ZW1A 3I17A 1QFTA 1SA8A 3NR3A 5C0NA 2G7BA 2RTJA 1B8EA 1FTPA 2QO6A 2FT9A 2OFAA 3C76X 1VPRA 2R73A 4RUUA 3S26A 2GTFX 4GJSA 3VE1A 1VWAB 1FENA 4BX7A 3OD9A 1X8UA 4O3YA 4WFVA 2N93A 4QRLA 1GT4A 5L3YA 1SWNA 2Q2PA 3H3IA 5LKEA 1KT4A 3PQSA 5BVSA 4UU2A 1LUQA 2FKGA 4CDDA 1RXKA 5K06A 4OS8A 4D6BA 2HYSA 4GGTA 3VG5A 5HZ6A 2RQ0A 2A0AA 3ZQ3A 4DQ4A 4HPBA 5AEOA 1GKAB 1JMXA 3MVFA 4DQ3A 2IZAA 4ZR2A 3RE6A 2JGSA 1SLEB 5H9NA 2IZCB 2JW1A 4ORUA 1SY1A 2KTSA 4ZHHA 2R56A 5EEEA 3VG4A 3Q34A 4O3ZA 1N4JA 5H9AA 1Y9TA 3RDXA 3CKFA 4GETA 1EW3A 5HA0A 1VYOA 1KT5A 3T2XA 2HZQA 3WYQA 5B29A 3B2LA 4M6SA 5FQ8E 2CBSA 2OY8A 5LJBA 3P6CA 2YMSA 4NW4A 3STMX 2WR6A 4IMOA 4ZGUA 2NNEA 4IRWA 1STRB 2L68A 1JIWI 4BX6B 1EUOA 2I5ZO 4BOEA 1SWTA 2RTGB 1DZKA 2GC9A 4QNIA 2AT8X 2GJ5A 3CR6A 2W2FA 3KFIA 4O49A 5CYBA 3VHMA 4TKBA 2HNXA 2AMMX 2RTBB 4Y0PA 2FWVA 1OBQA 1KOIA 2A3FX 1GX8A 3VU1A 4BX6A 1NDJA 1MX7A 3CKGA 1SWHA 3WYPA 1NQNA 2AVIA 1KT6A 2GTLM 4KIIA 4NP1A 1SY3A 2AT6X 2BT9A 5B27A 4Z6JA 1OBUA 2KW1A 3C77X 4LKPA 1ZNLA 4TKHA 1NP4A 1ERBA 5HWZA 4OKAA 1JMZA 1LDQA 3BX7A 1HQQA 4TKJA 3BU1A 1G74A 1I4UA 2Z4HA 3D9WA 3NQ3A 3EBKA 2RA6A 3OBLA 3ZW0B 5BYPA 2QOMA 3SZHA 3SZIA 1SRGA 2HZRA 4Y5DA 4YMYA 2RCTA 2CM9A 1CBSA 2MWHA 1DZJA 2RTCB 4I9RA 1OSPO 3HWGA 1ADLA 1FE3A 1G7NA 4NLJA 1IFBA 1ZRYA 3WJEA 1TOUA 1B4MA 1QABE 2C1SA 3CWKA 3HOLA 1IKEA 3ZW0A 1SWSA 1VWCB 4ON1A 4BQUA 4ARHA 4AYHA 2ACPX 4EFGA 5B5FA 1ZNHA 3FA8A 5K68A 5KHPA 3KFHA 5FENA 4LZUA 1QG5A 2JU3A 2RTOB 4O4SA 4CPHB 1S44A 3UAQA 1SXXA 5JD2A 4ZGFA 3G7XA 3FYFA 4ES7A 3BX8A 1R0UA 2RTPB 1A57A 2YG2A 3VGWA 3CBSA 4WHIA 4C5PA 1PBYA 1RLBE 5D48A 1VWFB 4U46A 2CBRA 3WBGA 4O4XA 2BHVA 4HPDA 4O4OA 4CPHA 5LJEA 2A5CA 1BRPA 1NC9A 1BM5A 3CBCA 1U18A 4QGWA 4AZRA 1LIBA 4JO6A 1CJ5A 5EDCA 1LIDA 2X8TA 3UEVA 3AKMA 2AF5A 5AJBA 1VWNB 5HTDA 2PY1A 3PH5A 2QCBA 4O9SA 4IAXA 1BBPA 4NV8A 4ORYA 1LDOA 3D95A 2IZLB 3WZOA 1VWQB 1VYGA 3PH6A 1LELA 4GE1A 4NV7A 3E3CA 2AT5X 1JJUA 5CHKA 4NNTA 1AVGI 1OPAA 1CBRA 5CSEA 4ZHFA 1T8VA 1SWGA 1IIUA 1EALA 1KL5A 1MOYA 3WZQA 3FR2A 2KT4B 3K3LA 1SLFB 3ZUIA 2HLVA 2RTHB 1Y53X 3ELXA 4TLJA 4YDAA 1MDCA 3D97A 3RDOA 1NBXA 4OMXA 4U8UO 3U0DA 4QQ1A 4HPCA 4OS0A 5IRAA 3PEDA 4Z28A 2IZFB 2WQAE 3MM0A 3P6GA 4K19A 1QQSA 1VWEB 5H9KA 4IABA 2PI3O 4YFPA 2X55A 1EPBA 3FA9A 1QWDA 1JYJA 5LJDA 3PQUA 3RDUA 3T2WA 3VG3A 1BLRA 4D6AA 5B2AO 1VWIB 2HMBA 3HWDA 4YDBA 1LICA 4ALOA 4EXZA 4YBPA 1GT3A 1S7DA 3TF6A 3VE2A 5JR8A 4XMGA 4QYNA 4TNNA 4MVIA 1QFVA 3WOVA 3T1DA 2RTNB 1IFCA 3SLTA 3STKA 3EYCA 3WZPA 5L8OA 3JS1A 3NX2A 1ICMA 2F01A 1SLGB 4XMEA 5H8TA 2POAA 1IJ8A 1ERXA 4MISA 1MM9A 4YFRA 4A1YA 1EIIA 2X4MA 3MX7A 1X8OA 4EKVA 4Y0QA 1TW4A 1EXSA 1RBPA 4OS3A 5L8NA 1HN2A 5LJKA 1EQDA 3WJBA 1VWKB 4CPEA 1X8QA 4L1NA 4LQZA 3BRNA 1MUPA 4YGHA 5FQ7E 4NLIA 1JZUA 5HTEA 1ZNKA 4CDFA 1BJ7A 3IFBA 1D2UA 1GT5A 5IO5A 4GK9A 3B2IA 2A5BA 3APUA 3KFFA 3CQNA 4IB9A 3WVMA 3SLJA 5HZ5A 1BEBA 1E02A 2BLGA 3VPJE 4B55A 5LJCA 1ZNDA 1Z24A 2KD2A 1JV4A 1B0OA 5IRUA 5HAEA 3SOTA 1GKAA 2VFCA 4NYQA 2RTLA 4IAWA 3TGAA 2Q2MA 4TQ2A 4GDZA 4FBVA 4NYRA 4IB6A 1TVQA
chains in the Genus database with same CATH topology
1Y0GA 2FGSA 2X32A 2X34A 3Q34A 5IXGA 1WUBA 3HPEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y0G A;  2FGS A;  2X32 A;  2X34 A;  3Q34 A;  5IXG A;  1WUB A;  3HPE A; 
#chains in the Genus database with same CATH topology
 3T6F A;  5FFH A;  1UYN X;  2DJG A;  5F1E A;  1AVE A;  1ZNE A;  2WUT A;  1PBO A;  2OL7 A;  4DCB A;  1SXU A;  3QQ2 A;  3HK1 A;  1WBI A;  2AL0 X;  1GXA A;  1X89 A;  2A2G A;  4GGZ A;  1DFV A;  4ALB A;  1H91 A;  1N9Y A;  2Y3F A;  1DZM A;  4AZM A;  1LPJ A;  3FR5 A;  1S2P A;  3KVN A;  1X8P A;  2JU8 A;  3U03 A;  4ML7 B;  1CBQ A;  2K62 A;  1FJ1 E;  2OVA A;  2X46 A;  1DF3 A;  4U3Q A;  3NQ9 A;  4OEL A;  1JJJ A;  2OFR X;  4AZP A;  1RXH A;  4U8U M;  2Q4N A;  4N7C A;  1NQM A;  2X8F A;  1SRF A;  4XMC A;  1YWA A;  2LB6 A;  1SWU A;  2FR3 A;  3HWF A;  1HMT A;  1VWR B;  4XMH A;  5AQ6 A;  3ZI8 A;  2QMI A;  4A1H A;  5EZ2 A;  3GE2 A;  5HZQ A;  4A60 A;  1VWP B;  4MVE A;  1VWL B;  4BVM A;  3P6D A;  3WJD A;  4FGI B;  1PM1 X;  3RDM A;  1DC9 A;  1MK5 A;  2X45 A;  4GUZ A;  4A8Z A;  2G78 A;  3JSQ A;  2ASN X;  2RTM A;  4YH0 A;  2K23 A;  2RTF B;  3BLG A;  1SWK A;  1UZ2 X;  1E5P A;  1N0S A;  2FHN X;  2OVD A;  3LTW A;  1CRB A;  4YCH A;  2IZH B;  4MIR A;  3P24 A;  5DG4 A;  3VG7 A;  1G85 A;  3BS2 A;  3B2J A;  4CPF A;  4QGV A;  3FEP A;  1W6F A;  1SRH A;  1T68 X;  1VWM B;  2WEX A;  3APV A;  4R0B A;  3EM0 A;  2OY5 O;  5L8I A;  1N43 A;  2X8S A;  1HXZ A;  2BS6 A;  3S60 A;  1SWF A;  3KQ0 A;  1PTS A;  2CZT A;  3EW1 A;  1RSU B;  5BVQ A;  3HPE A;  4HFO A;  4U9C A;  5K67 A;  2AT0 X;  4AW8 A;  3SAO A;  1KZX A;  1SWL A;  3FA7 A;  4Z2V A;  3EBW A;  2JN3 A;  3PP6 A;  3JQO A;  1KT3 A;  4YKM A;  1AQB A;  4ZCB A;  4CDC A;  2DJF A;  3FW4 A;  3P6F A;  4KT5 A;  3O19 A;  2FS7 A;  4YGG A;  2JOZ A;  1W5R A;  2OZQ A;  1EI5 A;  1OBP A;  1G5W A;  1STP A;  1CBI A;  3IA8 A;  1TOW A;  4MVL A;  1K24 A;  2JU7 A;  1YP7 A;  2FS6 A;  2OF8 A;  2RTA A;  4GGR A;  2UZ2 A;  1E06 A;  1QY2 A;  4GD9 A;  3PEC A;  4JHQ A;  3WJF A;  1O1U A;  1Y52 X;  5LJH A;  1ML7 A;  5CE4 A;  4O3X B;  3HOE A;  1SY0 A;  1LNM A;  4MEE A;  1L6M A;  3SLO A;  2Z4I A;  1A2D A;  2ZAG A;  3D96 A;  3RE5 A;  1HXL A;  3DTQ A;  4ODD A;  1ALB A;  2WEW A;  2AH7 X;  4I3B A;  1HY2 A;  2ACO A;  4ZH6 A;  2FTB A;  3O22 A;  4I3D A;  4KC8 A;  3D4R A;  3RY2 A;  2LBA A;  3CMP A;  4FQB B;  1YWC A;  2OY1 O;  4LZV A;  1BSY A;  1BRQ A;  1XKI A;  2AKQ A;  2IZI A;  4PSQ A;  3NPO A;  1ZNG A;  2XKL A;  5F58 A;  4WFU A;  4XMD A;  3TGB A;  3EW2 A;  4U8U N;  1HMS A;  5HZ8 A;  3OE3 A;  4JNJ A;  4FBR A;  4GNW A;  2QO4 A;  4QZU A;  5AJC A;  4Y0S A;  3VHI A;  1MEP A;  4I95 A;  2GTL O;  4Y0R A;  5IO6 A;  1IKJ A;  2RTR B;  2FHL A;  3HWE A;  2UYW A;  1HMR A;  4PJ2 A;  3FDC A;  4TJZ A;  1VWD B;  1SWD A;  4I60 A;  4AZN A;  5IXG A;  4I6S A;  1Y55 X;  2WPU A;  2FGS A;  3FW5 A;  4FBO A;  1SWQ A;  2IZD B;  4HPA A;  4UU3 A;  4ZHC A;  4I3C A;  4GH7 A;  5LKF A;  1O8V A;  2NND A;  2OF9 A;  2RN4 A;  5F7G A;  5HCE C;  3RDS A;  3RWX A;  4BGF A;  5H9L A;  4WBK A;  4Y59 A;  1EPA A;  2OVS A;  2OY7 A;  3U9P C;  3FR4 A;  3NQK A;  1LIF A;  1I06 A;  3NAD A;  2FLJ A;  5HCC C;  5EPQ A;  4DNE A;  4Z2O A;  2FKJ A;  3O2Y A;  1ICN A;  3BU9 A;  2OFB A;  3UEW A;  1OEK A;  1SWE A;  3AEH A;  3B2H A;  4EQA C;  1SWB A;  1VYF A;  3RSW A;  2Y3E A;  4YVB A;  1X8N A;  2X32 A;  3FEN A;  5B11 O;  2LBV A;  4EDE A;  4GZV A;  1XCA A;  1U17 A;  2ALL X;  3FEK A;  3RZY A;  4CK4 A;  2X56 A;  4ZHD A;  4BX5 B;  1T0V A;  3LHN A;  1I04 A;  2RTQ B;  1VWO B;  4ORR A;  2F73 A;  2DM5 A;  4ORS A;  2XST A;  3PDF A;  3BY0 A;  1LFO A;  1NGL A;  3KZA A;  5HBS A;  2WSJ A;  4BX5 A;  2LFO A;  4YCE A;  1LF7 A;  4ZFX A;  3F8A A;  4CV7 A;  3RBY A;  2RCQ A;  2A2U A;  5HA1 A;  2R74 A;  3FMZ A;  3EC5 A;  4MVK A;  1HQP A;  1KXO A;  4NNS A;  1NP1 A;  3ELZ A;  4YFQ A;  5D47 A;  1N7Y A;  3FID A;  1WUB A;  4YBU A;  5B3M O;  1BSQ A;  1SRE A;  3AKN A;  1RST B;  1HBQ A;  3UEU A;  4AZO A;  5IO7 A;  5EDB A;  4GRJ A;  2L9C A;  1RXJ A;  2EU7 X;  1A18 A;  4KC7 A;  4QAE A;  2HKD A;  4ZH9 A;  3STN A;  1LKE A;  2IZG B;  4N7D A;  3DSZ A;  5F6Z A;  1I9H A;  1SWO A;  2I5V O;  3B2K A;  3QKG A;  3AUM O;  2CM4 A;  2KTD A;  1TXL A;  1PMP A;  3APX A;  2L5P A;  3WZN A;  2IFB A;  4BJ8 A;  1ACD A;  3FA6 A;  1RAV A;  4L3R A;  4CPI A;  1VWH B;  2ZSC A;  1U0X A;  4OMW A;  5B5G A;  5KIC A;  2W2A A;  5B10 O;  4ZJ0 A;  1E00 A;  1D3S A;  3NP1 A;  1KQX A;  2RTK A;  1KQW A;  1MVG A;  2MHD A;  4GDA A;  4ORW A;  2E4J A;  1KT7 A;  2Q9S A;  3APW A;  3NX1 A;  4IB8 A;  4GU8 A;  2OL6 O;  4Z2P A;  1VWG B;  1K3B A;  4IMN A;  4YGZ A;  3S5V A;  3WJG A;  2IZJ A;  1OEE A;  1Y9L A;  4COT A;  4XMF A;  1JBH A;  4ID2 A;  1X71 A;  4EEJ A;  2LKK A;  2MJI A;  4BBO A;  1SWA A;  5F6B A;  1A3Y A;  2FRS A;  1JQP A;  3VHH A;  3F6Z B;  4Z27 A;  2G5L A;  1SWP A;  2MM3 A;  2WWP A;  1I05 A;  1DV9 A;  2JMB A;  2RTI B;  3GAQ A;  1Y0G A;  5FQ6 E;  1QY0 A;  3SZJ A;  2OVE A;  1YWB A;  4RUN A;  4IB7 A;  3VG6 A;  2GH7 A;  3FEL A;  2BC3 A;  2MF6 A;  1GGL A;  1SMP I;  1VWB B;  4QYP A;  3ZW2 A;  1KL4 A;  1KZW A;  1E2T A;  1SXY A;  3WXQ A;  1SY2 A;  2WQ9 A;  3I0A A;  1P6P A;  2C4I A;  4KCA A;  2IZE B;  4M7M A;  4CDE A;  2BSZ A;  2VDF A;  2OL8 O;  4O4U A;  2RTD B;  1PEE A;  4INN A;  1KFF A;  2A13 A;  1FDQ A;  3PPT A;  2FR2 A;  2VFB A;  2G79 A;  1YIV A;  2P8G A;  3N91 A;  1DF8 A;  4I9S A;  2CAM A;  5BVT A;  5IRW A;  1SWC A;  3LV4 A;  3PK2 A;  2MO5 A;  1SLD B;  4GJV A;  1URE A;  4HWM A;  1GM6 A;  2CZU A;  3S5X A;  1GX3 A;  1SRJ A;  2L67 A;  4JGL A;  2IZK A;  3BDR A;  3UEX A;  1AVD A;  3C78 X;  5HZ9 A;  1YP6 A;  1JYD A;  1W4T A;  2IZB A;  3F9D A;  4QGX A;  5LJG A;  3OJY C;  1YWD A;  1SWR A;  1JJX A;  1FEL A;  1GT1 A;  3FIQ A;  1I78 A;  3P6H A;  4OEM A;  5F2B A;  3CQR A;  2QOS C;  1VWJ B;  3P6E A;  3KFG A;  2OFM X;  2QM9 A;  1LCV A;  1LCW A;  4ORX A;  5DPQ A;  1LCZ A;  1AB0 A;  2Y32 A;  4GNY A;  3RKG A;  1KGL A;  1N9M A;  2NNQ A;  5D45 A;  1YUP A;  4AZQ A;  2LA7 A;  3VG2 A;  1GX9 A;  2Q39 A;  1O1V A;  2C1Q A;  3MG5 A;  3T6L A;  4GKC A;  1OEJ A;  1OPB A;  2ANS A;  1MX8 A;  2G8C O;  1BSO A;  4LKT A;  3ZUO A;  2RTE B;  5D4A A;  1B56 A;  4ZHG A;  4BCS A;  1HBP A;  3RDQ A;  5KID A;  3HTY A;  1AEL A;  1SXW A;  2M4L A;  2O62 A;  2RD7 C;  3MBT A;  3NBX X;  2X34 A;  2OYB O;  5HCD C;  5FAZ A;  1IW2 A;  1FEM A;  2NP1 A;  2GTL N;  3Q6L A;  2F09 A;  3L4R A;  3TGC A;  1EIO A;  3X00 A;  3TZS A;  1QY1 A;  5D8J A;  2AT3 X;  3BSZ E;  5EED A;  1SRI A;  1SWJ A;  4O3W A;  3RY1 A;  4CSB A;  4QZT A;  3ZW1 B;  1STS B;  1LIE A;  2W2B A;  3WJC A;  2A8G A;  3ZZV A;  1BWY A;  1DZP A;  2QO5 A;  2ZAI A;  3FLL A;  4IBA A;  4YKO A;  1UYO X;  3V8U A;  3EMM A;  1KL3 A;  3ZWE A;  4BX7 B;  3P02 A;  2BS5 A;  4KH8 A;  3ZW1 A;  3I17 A;  1QFT A;  1SA8 A;  3NR3 A;  5C0N A;  2G7B A;  2RTJ A;  1B8E A;  1FTP A;  2QO6 A;  2FT9 A;  2OFA A;  3C76 X;  1VPR A;  2R73 A;  4RUU A;  3S26 A;  2GTF X;  4GJS A;  3VE1 A;  1VWA B;  1FEN A;  4BX7 A;  3OD9 A;  1X8U A;  4O3Y A;  4WFV A;  2N93 A;  4QRL A;  1GT4 A;  5L3Y A;  1SWN A;  2Q2P A;  3H3I A;  5LKE A;  1KT4 A;  3PQS A;  5BVS A;  4UU2 A;  1LUQ A;  2FKG A;  4CDD A;  1RXK A;  5K06 A;  4OS8 A;  4D6B A;  2HYS A;  4GGT A;  3VG5 A;  5HZ6 A;  2RQ0 A;  2A0A A;  3ZQ3 A;  4DQ4 A;  4HPB A;  5AEO A;  1GKA B;  1JMX A;  3MVF A;  4DQ3 A;  2IZA A;  4ZR2 A;  3RE6 A;  2JGS A;  1SLE B;  5H9N A;  2IZC B;  2JW1 A;  4ORU A;  1SY1 A;  2KTS A;  4ZHH A;  2R56 A;  5EEE A;  3VG4 A;  3Q34 A;  4O3Z A;  1N4J A;  5H9A A;  1Y9T A;  3RDX A;  3CKF A;  4GET A;  1EW3 A;  5HA0 A;  1VYO A;  1KT5 A;  3T2X A;  2HZQ A;  3WYQ A;  5B29 A;  3B2L A;  4M6S A;  5FQ8 E;  2CBS A;  2OY8 A;  5LJB A;  3P6C A;  2YMS A;  4NW4 A;  3STM X;  2WR6 A;  4IMO A;  4ZGU A;  2NNE A;  4IRW A;  1STR B;  2L68 A;  1JIW I;  4BX6 B;  1EUO A;  2I5Z O;  4BOE A;  1SWT A;  2RTG B;  1DZK A;  2GC9 A;  4QNI A;  2AT8 X;  2GJ5 A;  3CR6 A;  2W2F A;  3KFI A;  4O49 A;  5CYB A;  3VHM A;  4TKB A;  2HNX A;  2AMM X;  2RTB B;  4Y0P A;  2FWV A;  1OBQ A;  1KOI A;  2A3F X;  1GX8 A;  3VU1 A;  4BX6 A;  1NDJ A;  1MX7 A;  3CKG A;  1SWH A;  3WYP A;  1NQN A;  2AVI A;  1KT6 A;  2GTL M;  4KII A;  4NP1 A;  1SY3 A;  2AT6 X;  2BT9 A;  5B27 A;  4Z6J A;  1OBU A;  2KW1 A;  3C77 X;  4LKP A;  1ZNL A;  4TKH A;  1NP4 A;  1ERB A;  5HWZ A;  4OKA A;  1JMZ A;  1LDQ A;  3BX7 A;  1HQQ A;  4TKJ A;  3BU1 A;  1G74 A;  1I4U A;  2Z4H A;  3D9W A;  3NQ3 A;  3EBK A;  2RA6 A;  3OBL A;  3ZW0 B;  5BYP A;  2QOM A;  3SZH A;  3SZI A;  1SRG A;  2HZR A;  4Y5D A;  4YMY A;  2RCT A;  2CM9 A;  1CBS A;  2MWH A;  1DZJ A;  2RTC B;  4I9R A;  1OSP O;  3HWG A;  1ADL A;  1FE3 A;  1G7N A;  4NLJ A;  1IFB A;  1ZRY A;  3WJE A;  1TOU A;  1B4M A;  1QAB E;  2C1S A;  3CWK A;  3HOL A;  1IKE A;  3ZW0 A;  1SWS A;  1VWC B;  4ON1 A;  4BQU A;  4ARH A;  4AYH A;  2ACP X;  4EFG A;  5B5F A;  1ZNH A;  3FA8 A;  5K68 A;  5KHP A;  3KFH A;  5FEN A;  4LZU A;  1QG5 A;  2JU3 A;  2RTO B;  4O4S A;  4CPH B;  1S44 A;  3UAQ A;  1SXX A;  5JD2 A;  4ZGF A;  3G7X A;  3FYF A;  4ES7 A;  3BX8 A;  1R0U A;  2RTP B;  1A57 A;  2YG2 A;  3VGW A;  3CBS A;  4WHI A;  4C5P A;  1PBY A;  1RLB E;  5D48 A;  1VWF B;  4U46 A;  2CBR A;  3WBG A;  4O4X A;  2BHV A;  4HPD A;  4O4O A;  4CPH A;  5LJE A;  2A5C A;  1BRP A;  1NC9 A;  1BM5 A;  3CBC A;  1U18 A;  4QGW A;  4AZR A;  1LIB A;  4JO6 A;  1CJ5 A;  5EDC A;  1LID A;  2X8T A;  3UEV A;  3AKM A;  2AF5 A;  5AJB A;  1VWN B;  5HTD A;  2PY1 A;  3PH5 A;  2QCB A;  4O9S A;  4IAX A;  1BBP A;  4NV8 A;  4ORY A;  1LDO A;  3D95 A;  2IZL B;  3WZO A;  1VWQ B;  1VYG A;  3PH6 A;  1LEL A;  4GE1 A;  4NV7 A;  3E3C A;  2AT5 X;  1JJU A;  5CHK A;  4NNT A;  1AVG I;  1OPA A;  1CBR A;  5CSE A;  4ZHF A;  1T8V A;  1SWG A;  1IIU A;  1EAL A;  1KL5 A;  1MOY A;  3WZQ A;  3FR2 A;  2KT4 B;  3K3L A;  1SLF B;  3ZUI A;  2HLV A;  2RTH B;  1Y53 X;  3ELX A;  4TLJ A;  4YDA A;  1MDC A;  3D97 A;  3RDO A;  1NBX A;  4OMX A;  4U8U O;  3U0D A;  4QQ1 A;  4HPC A;  4OS0 A;  5IRA A;  3PED A;  4Z28 A;  2IZF B;  2WQA E;  3MM0 A;  3P6G A;  4K19 A;  1QQS A;  1VWE B;  5H9K A;  4IAB A;  2PI3 O;  4YFP A;  2X55 A;  1EPB A;  3FA9 A;  1QWD A;  1JYJ A;  5LJD A;  3PQU A;  3RDU A;  3T2W A;  3VG3 A;  1BLR A;  4D6A A;  5B2A O;  1VWI B;  2HMB A;  3HWD A;  4YDB A;  1LIC A;  4ALO A;  4EXZ A;  4YBP A;  1GT3 A;  1S7D A;  3TF6 A;  3VE2 A;  5JR8 A;  4XMG A;  4QYN A;  4TNN A;  4MVI A;  1QFV A;  3WOV A;  3T1D A;  2RTN B;  1IFC A;  3SLT A;  3STK A;  3EYC A;  3WZP A;  5L8O A;  3JS1 A;  3NX2 A;  1ICM A;  2F01 A;  1SLG B;  4XME A;  5H8T A;  2POA A;  1IJ8 A;  1ERX A;  4MIS A;  1MM9 A;  4YFR A;  4A1Y A;  1EII A;  2X4M A;  3MX7 A;  1X8O A;  4EKV A;  4Y0Q A;  1TW4 A;  1EXS A;  1RBP A;  4OS3 A;  5L8N A;  1HN2 A;  5LJK A;  1EQD A;  3WJB A;  1VWK B;  4CPE A;  1X8Q A;  4L1N A;  4LQZ A;  3BRN A;  1MUP A;  4YGH A;  5FQ7 E;  4NLI A;  1JZU A;  5HTE A;  1ZNK A;  4CDF A;  1BJ7 A;  3IFB A;  1D2U A;  1GT5 A;  5IO5 A;  4GK9 A;  3B2I A;  2A5B A;  3APU A;  3KFF A;  3CQN A;  4IB9 A;  3WVM A;  3SLJ A;  5HZ5 A;  1BEB A;  1E02 A;  2BLG A;  3VPJ E;  4B55 A;  5LJC A;  1ZND A;  1Z24 A;  2KD2 A;  1JV4 A;  1B0O A;  5IRU A;  5HAE A;  3SOT A;  1GKA A;  2VFC A;  4NYQ A;  2RTL A;  4IAW A;  3TGA A;  2Q2M A;  4TQ2 A;  4GDZ A;  4FBV A;  4NYR A;  4IB6 A;  1TVQ A; 
#chains in the Genus database with same CATH homology
 1Y0G A;  2FGS A;  2X32 A;  2X34 A;  3Q34 A;  5IXG A;  1WUB A;  3HPE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...