1Y0MA

Crystal structure of of the sh3 domain of phospholipase c gamma-1
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
61
structure length
61
Chain Sequence
TFKSAVKALFDYKAQREDELTFTKSAIIQNVEKQDGGWWRGDYGGKKQLWFPSNYVEEMIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase ga
publication title Crystal structure of of the SH3 domain of phospholipase C Gamma-1
rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 13
structure length 61
sequence length 61
ec nomenclature ec 3.1.4.11: Phosphoinositide phospholipase C.
pdb deposition date 2004-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1y0mA00
1K0SA 2YUOA 2FO0A 4HVWA 2DX1A 1GFDA 2EYXA 1UDLA 1BU1A 1UUEA 2ECZA 2QDLA 2EPDA 3NPFA 1GBQA 3TSWA 4J9BA 2C0OA 2JM8A 2KYMA 4RTZA 3IQLA 1AZEA 1M8MA 4RTVA 1JO8A 1VYTA 3NMZC 2DMOA 4LUEA 1N5ZA 3C0CA 4RTTA 1NG2A 2O9SA 1NLOC 1JU5C 2DBMA 2RF0A 3M0QA 2CT4A 1VA7A 4F17A 1OPKA 4CC3A 4LN2A 1GBRA 2L0AA 3I9QA 2RMOA 1KJWA 3U23A 1Z9ZA 4AG2C 3VS4A 4HCKA 2DL8A 2J6FA 1J3TA 4F14A 3REBB 4OMQA 1TUCA 4KRTA 2E5KA 2P4RA 2SEMA 1K9AA 1CKBA 3LH5A 2H8HA 2JS2A 2C0TA 2L3QA 4RUGA 3RNJA 4OMNA 1CSKA 2A37A 4JPBW 2EGCA 1A0NB 1YN8A 1U3OA 5IXBA 2L2PA 2EYWA 1G83A 3O5ZA 1H92A 1OEBA 1RLPC 1PHTA 2O9VA 1SHGA 2AK5A 2EKHA 3RBBB 4J9DA 1UFFA 5EC7A 1LCKA 3JV3A 3M0PA 4HVUA 2KYBA 1AZGB 1H8KA 2K9GA 2KGTA 3EGUA 3I5SA 2JTEA 1JXOA 2D8JA 2B86A 4ZNXA 3SHWA 1HD3A 1ZUUA 2LZ6B 5IH2A 2CREA 4AFQC 1K76A 1IO6A 1PNJA 2VWFA 2L3SA 2W10A 3VS0A 2EYYA 3REAB 2M0YA 1Z9QA 2DL4A 1W70A 1S1NA 2ED1A 1SEMA 1T3SA 2CH4W 2DRKA 2HEQA 1OV3A 3KFVA 2X3WD 2OJ2A 1E6HA 4M4ZA 1BBZA 4GBQA 2RPNA 2CUBA 2HBWA 2FG0A 4AFSC 1UECA 4J9CA 2J6OA 1SHFA 1WX6A 4GLMA 2DL5A 1PKSA 1PKTA 1KIKA 2MOXA 5IHNA 1NM7A 1UJYA 2OI3A 1QKXA 5FWBA 1UJ0A 2GBQA 2AZSA 1T0JA 4OMMA 2O88A 1CKAA 1PRLC 2HCKA 2FRWA 3M0UA 4FSSA 3M0TA 4AG1C 1NYFA 1JEGA 1T0HA 1M3CA 5GJWB 1WXUA 4ORZA 2L3PA 2LQWA 3H41A 4K11A 3VS6A 2F2XA 1UHCA 5ECAA 1UHFA 1I07A 1NEBA 1W1FA 2KNBB 2KRSA 2J6KA 4OMLA 1M3BA 2JT4A 5I22A 2M51A 2HDAA 1KFZA 4A63B 2CUDA 4E6RA 1X6BA 1VYUA 5IHKA 1QCFA 3EHQA 1TG0A 4QT7A 2DA9A 2XMFA 1T3LA 2KE9A 4CC7A 2KR3A 1XOVA 2DNUA 1HJDA 2CDTA 2LJ0A 2KT8A 2K6DA 2MIOA 1ZSGA 1X69A 1QLYA 1MV0B 2YSQA 4J9GA 1QWFA 2DYBA 2EQIA 2HSPA 2KRMA 1RUWA 2DL7A 2CSIA 2GQIA 1WDXA 1OPLA 2YT6A 1YWPA 4Z8AA 2AKLA 4J9HA 3VRYA 5IXFA 4OMPA 2JMAA 2LP5A 2W0ZA 4X1VA 2DM1A 4JJDA 2RQUA 4LE9A 4IIOA 2D1XA 2K3BA 1UTIA 1AWXA 1ZUKA 1B07A 2EGAA 1HSQA 3I5RA 2YDLA 1NLPC 4HVVA 2G6FX 4Y92A 2F2WA 2JW4A 3UA7A 2PNIA 2ED0A 1ABOA 1FMKA 2BZYA 1WLPB 2J7IA 3VS1A 2I0NA 1AWJA 1PWTA 1W6XA 2DRMA 1GFCA 2EW3A 4DEXA 2LMJA 2ENMA 3QWXX 4AFZC 1M30A 1E7OA 4JJCA 1WIEA 1ABQA 5I11A 1VYVA 1TUDA 2ROTA 2RQVA 2KXCA 5L23A 1U06A 2ABLA 1X43A 1YP5A 2D8HA 3H0FA 2CH4A 3VRZA 4JZ3A 1BB9A 2AKKA 2RQTA 1K1ZA 1M27C 1K4US 2J06A 2RNAA 2RQWA 2GNCA 3VS3A 2J05A 3GBQA 2PTKA 1ZBJA 5FW9A 2DLPA 4CC2A 3ZL7C 2GTOA 3EG1A 3EHRA 2DF6A 3PVQA 4ESRA 1NYGA 1E6GA 2C0IA 4D8KA 1WFWA 1JQQA 2DJQA 3VS7A 4Z89A 2LQNA 4EIKA 1GCQC 2EVRA 1AWOA 1V1CA 1QWEA 2EYZA 2CT3A 2RQRA 4J9FA 1FYNA 1MV3A 2DILA 4LUDA 3EG2A 1UGVA 1X2KA 1SPKA 1I1JA 1ZUYA 1X27A 2BZXA 1ZX6A 2D0NA 2MCNA 1U5SA 2JXBA 3EG3A 4DEYA 2KT1A 1UG1A 2YUNA 2KBTA 1QKWA 4J9EA 3PE0A 1WA7A 2DE0X 4WCIA 2K7AA 2O31A 4IIMA 2FPEA 4AFUC 1GRIA 1NEGA 2ESWA 3UA6A 4R0KA 3UF4A 2YUQA 4RTUA 1SRLA 2DBKA 2FPDA 3VS5A 2KXDA 1AEYA 1KSWA 1UE9A 2FEIA 2A28A 2LJ1A 1AVZC 2V1QA 4D8DA 2RN8A 2O2OA 3TSZA 3SEMA 1M3AA 2PZ1A 2A08A 1B3QA 2JMCA 2EBPA 1PRMC 3FJ5A 1WYXA 1BK2A 3TVTA 2V1RA 1SRMA 2BZ8A 3I35A 3M0RA 1OOTA 2JM9A 2FRYA 4RTWA 3UATA 2A36A 2BTTA 2K2MA 4OMOA 2AZVA 1SSHA 5HCKA 2EGEA 4CC4B 1I0CA 2NWMA 2LCSA 1WI7A 2YUPA 1AOJA 3EG0A 5FWCA 2OAWA 1EFNA 3NGPA 4HXJA 2GTJA 4LNPA 2F2VA 2X3XD 3A98A 1WXTA 2KEAA 4RTYA 2LJ3A 2SRCA 4JZ4A 4F16A 1AWWA 4Z88A 3PVLA 1Y57A 1X2QA 1YCSB 2KROA 3H0HA 4J9IA 3R6NA 2NUZA 1WXBA 2DVJA 2K79A 1GCPA 5IHIA 2KRNA 2VKNA 1JXMA 1GL5A 1AD5A 1GCQA 1Y0MA 1ZLMA 2VVKA 1MUZA 2DL3A 3M0SA 1G2BA 2GGRA 2LX7A 1YWOA 3H0IA 3QWYA 2LNHB 3VS2A 2CSQA 4JJBA 2IIMA 3THKA 1RI9A 1K0XA 1RLQC 4RTXA 2FPFA 5GJVB 1H3HA 3ULRB 2JS0A 3CQTA 1X6GA 3NHNA 2ROLA 1YNZA 1ARKA
chains in the Genus database with same CATH superfamily
2JOYA 4Z02A 2KMTA 5GANe 4HVWA 2DX1A 2O01E 3RIRA 1UDLA 2RO0A 3TCJA 4FW1A 1TXQA 4AT1B 2Y4YA 1M8VA 3KXTA 4RTZA 4FYYB 4FM4B 5CR2A 4E7SA 3IQLA 1AZEA 2VUBA 1M8MA 5CKFA 1QVGP 4M7DD 3QJYA 1VYTA 1N5ZA 1JB0E 4PJOD 1W2BP 1PD0A 4B9XA 1VA7A 4F17A 2EJGA 1QW1A 3PFSA 4JS5A 1S72T 4E7HA 2L0AA 4J7FA 3L42A 1J3TA 4PJOE 1VQ5A 2E5KA 2LT4A 3LH0A 2SEMA 1V29B 3LH5A 3ZFJA 2CYZB 2XKOC 2QQSA 5LJ5d 2EGCA 1A0NB 1YN8A 2LCLA 5GAMj 2RJCA 3OYLA 3S3MA 3ME9A 1IHVA 2EYWA 4PL6A 5CK9A 1H92A 3MEUA 2ZPEB 1Q81C 3RUXA 5EC7A 1YI2T 4GY5A 3CD6A 2GFAA 4EMKA 4HVUA 2DKGA 2KGTA 4DBHA 3I5SA 4M77E 2B86A 4ZNXA 1EZZB 3MP6A 2LZ6B 5IH2A 5AYFA 2CREA 2PVOB 1VQ6Q 2O4XB 2K5LA 2L3SA 2FL7A 3VS0A 2V8IA 4XTXA 3REAB 3CC4T 2CP6A 2P0KA 1QVFS 4M75D 2ED1A 2CH4W 2DRKA 2FZCB 2YRDA 2HEQA 3CCRT 5HK0A 4PLLA 5GAOr 1RAIB 2RPNA 1QCOA 3JCMX 2R5AA 5GAMh 4LD6A 1SHFA 3L2UA 2JNGA 1PKTA 2V8JA 2MOXA 3FB9A 3L1AA 2XI9A 5A2QE 3CCLQ 4KUDK 2QK0A 5GMKl 2PVDB 1I81A 1IGUA 2JTMA 2AZSA 1N9RA 3DB4A 1YJWA 3FEOA 2FRWA 3M0UA 3M0TA 1QVFA 5KYWB 1JEGA 2QI2A 1X75C 4M78B 1M3CA 5GJWB 1K8AC 3KUFA 3CCMQ 4RG8A 3HTRA 1EIFA 1IXDA 2LNVA 4N4HA 5ECAA 3OQ5A 3CMET 1VIFA 4OMFB 1UHFA 1NEBA 2KNBB 3H8ZA 3C4SA 4OMLA 3CCQQ 2JT4A 2A7YA 2M02A 5I22A 2M51A 3JB9J 1KFZA 2CUDA 1MNDA 1M2OA 2COZA 2CP5A 3M5AA 1QCFA 4QT7A 4CRIA 1NJIR 2LRQA 3L2QA 2DJZA 2ZPBB 1FMWA 1T3LA 2KR3A 1HJDA 3GF5A 3CMAA 3CEYA 2KT8A 1X69A 4XU3A 5GMKi 2DXCA 3EFOA 3M57A 1R0BG 1TH7A 1VQOQ 4XTYA 1QWFA 2CZ1B 3P8BB 4FCYA 2QEXQ 2HSPA 1RUWA 2DL7A 2CSIA 3META 1WDXA 2DXBA 4BUGA 2ZCFB 1OPLA 4HT9A 2YT6A 3VRYA 2CKKA 5J39A 2QTVA 3GIBA 2W0ZA 5CAIA 2NUTA 1OZ2A 3JCMb 2DM1A 4JJDA 3DB3A 2RQUA 5LL6S 4LE9A 1KD1C 4IIOA 2D1XA 3M59A 1UTIA 1VQMA 2R5MA 1HSQA 5LJ3h 1Q7YU 2MMPA 4C8QB 1IB8A 1JBMA 2JW4A 4P5NA 4M7DB 2H3EB 1WLPB 2QQRA 2J7IA 1C6VX 4BI4A 4IUVA 5CKDA 3JRZA 1OULA 5IAYA 4ANJA 1LPLA 4Y28E 1WQWA 5CQYA 1VQ6T 1WIEA 1ABQA 1VYVA 3RMSA 2KXCA 1U06A 2ABLA 2K5FA 4QKUA 1X43A 1YP5A 3INZA 4MZMA 3E9FA 1U1SA 1IRXA 4NS5A 2EQKA 3VU3C 2GNCA 2J05A 3GBQA 2PTKA 2KAFA 2LVMA 1IHWA 1ZBJA 4FYWB 3ASKA 2GCXA 3F70A 3HRUA 2F69A 3EG1A 1D3BA 2DF6A 1OZ3A 2C0IA 1M1KR 1JQQA 3S6WA 1TU0B 3CCLT 2LQNA 1RL2A 3FJPA 4EIKA 1OYXA 4EMGA 2LQKA 4WTOB 5LJ5j 3OMCA 1AWOA 4C92A 1VIEA 1BKBA 2ATCB 4CI0C 3QYHB 4A4EA 1UGVA 1Q81R 4PJOC 3CCMT 5GMKh 5GAOl 1VQKQ 1I1JA 1YITQ 1ZUYA 3OB9A 1X27A 2BZXA 2JXBA 8AT1B 4ZN1A 4DEYA 3GNGA 2C06A 2YUNA 3JB9I 2QG9B 3CCQT 1WA7A 2L5QA 5FROA 2O31A 4FYXB 3OW2S 3HFOA 3I55T 1GRIA 2QQ9A 2CZ6B 3M56A 3SWNB 5A0LA 2ESWA 1I5OB 4OB3B 3JCMQ 4RTUA 2DBKA 1M2VB 3VS5A 4F7UB 1KSWA 2FEIA 2PQWA 2JZ2A 3JCMc 2DEQA 2LJ1A 3DLLA 5LJ5h 3PNWC 4M77C 2RN8A 2LX9A 1M3AA 3QPHA 1VQOT 1VQ4A 2JMCA 1V76A 2COWA 8ATCB 2QEXT 2B8AA 3EFSA 3VUZA 2HNIA 2CS7A 1ZSZC 1OOTA 3HRSA 3OW2A 2RA2A 5DM7R 3PIPA 4IUPA 2K2MA 1KHIA 1KC8R 4O6JA 4IUUA 2NWMA 3VYHB 4A4HA 2OAWA 3FLGA 2GQVA 2P84A 3NGPA 7AT1B 4L5GA 2EQMA 1SKUB 1NPPA 1WJQA 2F2VA 2X3XD 2AIRB 3A5ZB 3N5BB 4RTYA 3CBPA 2LJ3A 3MPUB 3O8VA 2E4HA 3HKSA 4X34A 3URGA 1AWWA 3PVLA 1Y57A 4EMKC 5KYUB 1QMCA 4J9IA 4YTLA 5IHIA 1BIBA 5FU7C 4E7LA 1JXMA 4LDUA 3QSUA 2EYQA 1PC0A 2VVKA 1UGRB 3BW1A 2WSFE 5KYYA 2DL3A 3M0SA 4BE0A 3V8KA 2GGRA 4ZGEB 2OTLT 2LNHB 3A8OB 1N8RR 4JJBA 3OYKA 5A0GA 1RI9A 1M1FA 3OBYA 5GJVB 5GAN2 1H3HA 4E47A 1KD1R 2ROLA 3OYDA 4XTUA 3FDRA 1VQ5Q 2JN0A 2O4XA 1K9MR 1NPRA 3QXEB 3WVEB 2HBPA 4RTVA 2DIGA 1JO8A 2X51A 3JB9H 2O9SA 1NLOC 5GAOp 1YITT 5AT1B 3M0QA 2MAMA 3PTAA 1U1TA 2FB7A 3HFNA 2KY9A 3CD6Q 2RMOA 2K4YA 1OI1A 2ZAEA 3LWIA 2RHZA 3VS4A 2DL8A 2HAXA 3VYGA 1VQKA 4KRTA 5GAN6 4MZTA 5CCAA 2OX7A 2RI3A 1WQ7A 3QHSA 2VC8A 2X4JA 5KYWA 1KHCA 2FZKB 4A4KA 4M78A 1FXXA 3EG9B 2RI2A 4J6XA 4VUBA 3VUBA 4C0ZA 2A37A 3EGDB 3S3NA 2L2PA 1G83A 3O5ZA 1RLPC 4M7AA 2RD1A 1SHGA 4B6MA 2JJ9A 2EKHA 1UFFA 4FIBA 3A8MB 3PMIA 2P0QA 2RM4A 3M0PA 2V8KA 1AZGB 2K9GA 4BACA 2D8JA 1NJIC 1ZUUA 4RCBA 2JTFA 1K76A 3Q1JA 1PNJA 1M4ZA 1YJWQ 3OSVA 2W10A 2HKNA 3M55A 2EYYA 4F7UF 4OGCA 5GANf 4X9CA 2DL4A 1S1NA 4A54A 2EIFA 3BDUA 1Y7XA 1SEMA 4E7JA 1Q82R 1E6HA 4M4ZA 1BBZA 2MK5A 2XG8D 3A8GB 2ZPFB 2CUBA 2FG0A 1UECA 4JRIA 2FHDA 1XTDA 3QDRB 3NFCA 1YHQQ 2L3RA 2GF7A 5IHNA 4BI8B 1K8AU 2ZPGB 1QKXA 2DTOA 2E41A 1UJ0A 3TEEA 1T0JA 1PG5B 5KCHA 4OMMA 3X28B 4HCCA 1KQSP 4C8QA 3CMAQ 4FSSA 1NYFA 2DD4A 3RMQA 1PSFA 2L3PA 3MHXA 4M7DA 2K5IA 2YLCA 3C12A 9ATCB 4N0AA 3SFMA 3C95A 2LC4A 1I07A 2KRSA 2J6KA 1M3BA 2HDAA 1VQ5T 1I4K1 1I5LA 2Y4XA 1XQHA 2VYTA 1G3TA 4BE1A 2YLBA 3V7RA 1VYUA 4LDWA 5IHKA 3KBGA 1VQMQ 4Y91A 1YJNA 1TG0A 4R56A 1UGQB 4J83A 2KE9A 2DNUA 2RJEA 2CDTA 4FU6A 2K6DA 2MIOA 3CCUA 1ZSGA 2FZGB 1QLYA 2BUDA 2PVGB 3M58A 3OYBA 1YJ9A 4J9GA 2E10A 2DYBA 2LQ8A 1RABB 2EQIA 4PFOA 2VASA 3D7SB 3CD6T 2X9HA 4E7ZA 4C0GA 5KYYB 1M1KC 1VQPA 2XDBA 4ZGJB 4M77D 4MMKA 3G6EA 2AKLA 4IUQA 5C6SA 4OMPA 4A53A 3TREA 4KGVB 1B07A 3I5RA 2YRVA 2Z0WA 3X26B 5GAOn 4HVVA 2DO3A 3MEWA 2HD0A 3EH2A 4M75A 2ZGWA 1N6AA 4C92G 3J81E 2I0NA 3LWHA 1K73R 2AT1B 3L2WA 1W6XA 5CO7A 1GFCA 2DTHA 4ZTJA 1QVPA 2KDSA 2E1HA 2ENMA 3SWNA 4AFZC 3ZBDA 4FL6A 1TUDA 1M2VA 1YJWT 4KBMB 5L23A 4F7UA 3CXCS 5GAOq 2CH4A 3H6ZA 2VGNA 4DQ2A 1BI2A 2WSCE 4XTZA 2LT1A 1QVGS 5FW9A 2DLPA 3MCAB 5CKEA 4C92F 3ZL7C 1W2BS 2GTOA 3C94A 2G3RA 3CPWP 3PMTA 3PVQA 3QZ5B 1NYGA 1KC8C 1E6GA 1YHQT 1OU8A 1M90R 2DJQA 4Z89A 5GAMe 1QWEA 2EYZA 1GXIE 2CT3A 4UC4A 3CXCA 4M7AB 4RG2A 2H3JA 3CMAT 1FYNA 2K3YA 1VQLQ 3OYEA 3E19A 5LJ3j 4JJNK 1SPKA 1YHQA 5DY9A 4XTWA 3M4YA 1QVGA 1VQ4Q 2HKQB 4F7UE 1XNIA 3EG3A 2E3IA 1W2BA 1R8OB 5KYUA 2KT1A 2KBTA 3PE0A 4BI3A 6AT1B 2DE0X 3BDLA 4IIMA 2HQEA 3X25B 2FPEA 4AFUC 3SDZA 4HT8A 4JRQA 2VXEA 4R0KA 3UF4A 1VQMT 1RAHB 2P0PA 1QP2A 4KT0E 2DZCA 4E7IA 1N8RC 2V1QA 5M9OA 4D8DA 2A0FB 4IUTA 1JJ2P 3I56A 2O2OA 2PZ1A 4WF2A 1PRMC 2DK3A 4XU2A 1Y71A 3FJ5A 5IN1A 4FW2A 2MWOA 3L2ZA 3CBOA 3G71Q 5GAN3 2HZYA 5EG2A 3JB9F 2JM9A 1K9MC 1D1BA 2Y90A 4MMLA 2AZVA 1Q86R 2QGGA 3LLRA 5HCKA 4CC4B 1I0CA 2LCSA 4PJOB 2GFUA 3OS0A 1QQJA 3JCMf 3RESA 2GTJA 3GNFB 4LNPA 3A98A 2KEAA 5FU6B 3RDVA 2SRCA 4LXCA 5GMKj 1M9SA 2M9UA 1YCSB 2E6ZA 2KROA 2QA4Q 3H0HA 2DERA 1WXBA 2DVJA 4ME7A 4BY6C 4JDSA 2KRNA 1N9SA 1HYOA 1WPYA 3QUIA 2KQWA 3CPFA 1GL5A 3JCMg 4M77B 3GOXA 2LDMA 4J5YA 4RKUE 1MHNA 1ZLMA 2EAYA 2HQHA 1G2BA 4HCZA 2EWNA 3EG9A 3H0IA 3JCMe 3GP8A 1NZ9A 3T9NA 4C0DC 3EGDA 5CIUA 1ZSZB 2IIMA 1K0XA 3OY9A 1RLQC 5GANd 1BCMA 2JS0A 3CQTA 2RHUA 2KI7A 3HSBA 4V2SA 5A0DA 3UT1A 3G1JA 4M78G 2ECZA 2COYA 2EPDA 3NPFA 3HL8A 4M75B 4XAXB 4DOWA 1P92A 2XHCA 3FRNA 2KYMA 1KQ1A 1Q82C 2AHJB 2RK1A 3FIFA 3OS5A 1VQ4T 4C92D 1JU5C 2DBMA 2RF0A 4N0AC 4NL2A 5GMKm 1OPKA 4CC3A 3OSSC 3HP9A 3NTIA 4KH0B 3X24B 3OYJA 1VQLA 1KJWA 4LDVA 3QIIA 4M78F 4HCKA 3R6OA 4F14A 3REBB 4OMQA 2CP3A 4C92E 2P4RA 3V7SA 1OU9A 1CKBA 4M7AF 2XICA 2H8HA 2JS2A 2C0TA 3H9NA 2L3QA 4RUGA 3RNJA 1MGQA 2RK2A 4XU1A 2RJFA 1VQNQ 4JPBW 3CC7A 1U3OA 4KUIA 4ELYC 2OAUA 2DD5A 5LJ5e 1HK9A 2QTXA 1PHTA 1NJIU 2X4YA 2OTJQ 2CZ7B 3E9GA 1YIJA 3OYAA 1LCKA 3JV3A 1XJWB 4C8QG 2KYBA 1H8KA 1RI0A 3EGUA 2KSSA 1JXOA 1HD3A 3EH1A 4M7DG 2HL5C 1D1CA 1H3ZA 1R0CB 2VWFA 4C0FA 3G71A 3CCVA 1G5VA 3UDCA 1T3SA 4J6YA 1OV3A 3KFVA 2X3WD 2OJ2A 5IT9E 1VOMA 1TWBA 2E5QA 1VQ9A 1UGPB 2HBWA 4J9CA 4JUVA 4MDWA 4C8QF 2J6OA 1WX6A 2EJ9A 2WACA 2DL5A 1PKSA 4M7DF 1NM7A 2OI3A 5FWBA 1YJNQ 2L89A 4N4GA 2QA4A 2O88A 4ATOA 1CKAA 1RAAB 2D6FA 4AG1C 3CCSQ 3CCJA 3CCUQ 1T0HA 2RJDA 1F1BB 1WXUA 4ORZA 1YJ9Q 2F1LA 5CKBA 3H41A 1K73C 4E7KA 4J8OA 4KULA 1FX7A 2F2XA 4PK4A 2JUFA 3RKWA 2QQBA 1VQPQ 2YHTA 4DBRA 3G6EQ 4PJNA 2E65A 2QXFA 1W4SA 4E6RA 1VQ8A 1VQKT 2XD0A 1X6BA 2YWWA 1EX4A 5D6XA 2DIQA 2V26A 3EHQA 2DA9A 1KQ2A 3SB2A 1X01A 3ZEHA 4XK8E 1S72Q 4CC7A 5GAN7 1XOVA 2LJ0A 4D6WA 3EGXB 1M1KU 4NL3A 4A4GA 4PNOA 2BE9B 3MKDA 1BI1A 4ZN3A 1DJ7B 2DAQA 4F7UG 4PKCC 1X6OA 2WSEE 5FRMA 1M90C 1Q81U 2FYKA 2IG0A 3SD4A 4Z8AA 1VQ7A 2JMAA 2LP5A 4X1VA 5GAOm 5KE3A 4M75F 1ZUKA 2EGAA 4B9WA 3CCST 3BY7A 5GANj 5I21A 2F2WA 2PNIA 2ED0A 1FMKA 2BZYA 1PCXA 2ZPHB 1IZ6A 2CP2A 3ER0A 3PT9A 2XIDA 1PWTA 1WHKA 2EW3A 3CC4Q 3L2RA 4XU0A 2LMJA 2QDYB 3QWXX 1O9SA 1M30A 1VQNA 1E7OA 2HSEB 3M53A 2E12A 3CCRQ 2RQVA 2ROTA 2D8HA 3G4SA 2OTJA 3H0FA 4M78E 3CCEA 4JZ3A 1BB9A 2AKKA 1MMGA 1M27C 3RKXA 1K4US 2J06A 4PLIA 2RNAA 2RQWA 2VGMA 1KC8U 4M7AE 1M1GA 2E64A 5GANh 2E3HA 2DZ9A 1D0YA 2FVUA 3JCMd 3EHRA 1LJOA 5KYXB 2RHXA 1Q86C 1BYMA 1WFWA 1O75A 3VS7A 2EVRA 1YJNT 4PJOA 2NUPA 1QVFP 4EPCA 5CKHA 1NBEB 4O5VA 2CP0A 1MV3A 4LD9K 4LUDA 3CCUT 3EG2A 3I56Q 4C92C 1OX9A 1YJ9T 3MP8A 3CXCP 2D0NA 2MCNA 3PGGA 1U5SA 4C8QD 4OB1B 1HXDA 1VQPT 3CC2A 1ZHIA 1RAEB 4JLIA 1Q7YR 3G6ET 4WCIA 2K7AA 1SSFA 3CCSA 1SG5A 1G3YA 5KE2A 5KH6A 1N8RU 4BDZA 1G8XA 4M77A 2YUQA 1LNXA 1SRLA 2I2LA 4DBFA 4C8QE 1AEYA 2KXDA 1KD1U 3EFRA 1UE9A 1WHHA 4ZGDB 2A28A 4M7DE 4EDUA 3SEMA 1ZSZA 1K9MU 1B3QA 4A4FA 3M4GA 1WYXA 1BK2A 3TVTA 2V1RA 1S72A 2NYSA 1SRMA 2BZ8A 4PFZA 1FWZA 1WHMA 1WNLA 2RB6A 1PM3A 4HA8A 3A1PA 3UATA 4OMOA 2KK4A 1IREB 1U8RA 1SSHA 4MZPA 2EGEA 4OP0A 3LGLA 1QP3A 1WI7A 1B34B 1AOJA 3JCMV 3OYGA 4DA4A 1EFNA 4HXJA 1MMDA 1BCOA 5D6WA 3GPLA 1KQSS 5GAMf 1UEBA 4XQ3A 4JZ4A 1TSFA 4F16A 2CP7A 2PUKB 4C5HA 2BIVA 2E6NA 4FT4A 3R6NA 2K79A 1YI2A 4TVRA 2F5TX 3WVDB 3EAEA 3OYIA 3QYGB 1Y96B 3DKMA 4QVZA 1AD5A 1GCQA 5GAMg 4LDXA 5DLQE 2BKDN 4OB0B 4C5GA 2LX7A 4BD3A 1YWOA 1NE8A 3CC4A 4JRKA 5FRNA 1TTHB 1R77A 4M75E 4DBQA 1KQSA 4LDYA 5D7UA 3THKA 3CCRA 2CGHA 2DXUA 4OVAA 1FMVA 5KYNA 1BI3A 1X6GA 4JS4A 1YNZA 1ARKA 1K0SA 2YUOA 3HHTB 5J26A 2FO0A 1VUBA 1GFDA 1Q82U 2EYXA 1RACB 1BU1A 1UUEA 2QDLA 1GBQA 3TSWA 4J9BA 2C0OA 2R58A 2JM8A 1I8FA 2M0OA 2DVEA 4ZTFA 5DLOA 1ACMB 2MF2A 4X9DA 3JB9G 2IPOB 1YFNA 4II1A 3NMZC 2DMOA 4LUEA 3I56T 3C0CA 3HPWA 3CC7Q 4RTTA 1NG2A 3I55Q 1ZQ1A 4BY6B 2CT4A 1UGSB 3CBMA 3PIOA 4NOYA 4ELZC 1WGSA 2LTOA 4LN2A 1GBRA 1WZOA 1YIJQ 1SF9A 3I9QA 3CMEA 3OS2A 3OMGA 3QDFA 2DEUA 3U23A 2MWPA 1Z9ZA 4AG2C 2J6FA 1G3SA 2JVVA 5LJ3f 1TUCA 3P8HA 4C5IA 3AT1B 4XTVA 4C0DB 1K9AA 3CCVQ 1WHJA 4OMNA 1CSKA 2D9TA 2DFUA 2QYZA 1Y07A 2IVWA 3NTKA 3J7AF 2VV5A 4Q5WA 5IXBA 1VQ9Q 4JLGA 1OEBA 2O9VA 2NUPB 5I2MA 5LJ3g 2K3XA 3A8HB 1ZA1B 4M78C 2AK5A 1BIAA 3OW2P 3RBBB 2L8DA 4J9DA 3TU4K 4L6V5 5J3BA 1QCNA 5CQXA 3TQ7P 2JTEA 1LOJA 2XU8A 1JRIA 4M7AC 1WHGA 3SHWA 5LJ3e 2PUOB 2QAZA 3CPWS 4AFQC 3OYHA 1IO6A 3MP1A 1MMAA 5HKCA 1G3WA 3X20B 2HL3A 2X35A 2M0YA 1Z9QA 3CCJQ 1W70A 2ZPIB 5C0MA 3EGXA 2EJFA 5L8RE 2YRCA 1RADB 4GBQA 2M1HA 3JCMh 1TS9A 3RKYA 1UB4A 2QGFB 4AFSC 2A3LA 3A8LB 1WHLA 2EQJA 4GLMA 1VQ8Q 3M9QA 3OYYA 2OTLQ 4IKFA 2K2VA 3CPWA 1KIKA 2RHIA 2XDPA 1UJYA 1VQ6A 2GBQA 3E2UA 4KGXB 1K73U 1PRLC 2HCKA 2DYIA 2XDDA 3OYCA 3QG1A 1YCYA 4BE2A 1IGQA 4EMHA 1ZBXA 2CZ0B 2LQWA 5GAN5 4DOVA 4K11A 5D6YA 3VS6A 1UHCA 4C8QC 1JJ2S 1BI0A 4QVCA 4M7AG 1VQLT 3JCMJ 1TOVA 1AHJB 3BE3A 1W1FA 4M7DC 2D0QB 1MMNA 4EMKB 3LYIA 4FYVB 1VQ7Q 4A63B 3GLXA 3J80E 5LJ5f 3CCLA 4OF1A 5GAN4 5FU7B 5GMKe 3UPUA 2XMFA 5FU6C 2MPXC 1D1AA 4OB2B 1M5Q1 4BB7A 1D0ZA 3CC7T 3BFMA 3OYNA 1M90U 1H641 1MV0B 3CCMA 2YSQA 3WXMB 1JJ2A 3JSCA 2XK0A 1YIJT 2KRMA 5LJ5g 1RAGB 5KYXA 3MJXA 2GQIA 1OX8A 4HCBA 4F04B 3CCQA 1YWPA 4J9HA 1C0MA 5IXFA 2MYSA 3AHUA 3I55A 4RCCA 3V7CA 2F5KA 4AMCA 2K3BA 3V8LA 3G4SQ 1AWXA 4RMOA 3G71T 3CCEQ 3CCVT 3E1SA 3OBWA 2YDLA 1YBYA 3RERA 1NLPC 3LW5E 4IURA 3JCMP 2G6FX 5KCOA 4Y92A 3UA7A 1VQ9T 1ABOA 1K8AR 1Q7YC 1RAFB 3VS1A 1VQOA 4PJOG 1WJRA 2QEXA 1AWJA 2HMAA 4KH1B 2EFIA 2DRMA 4DEXA 4M75C 4QW2A 3QKJA 4R55A 4JJCA 5I11A 2QA4T 3MO8A 3JB9D 4MDXA 5HY6A 4BDYA 3VRZA 3CCJT 3SWNC 2RQTA 3QZ9B 1K1ZA 2E70A 5CVIA 1Q86U 3VS3A 2DPPB 3G7ZA 3FC3A 4PJJA 3OYMA 3EFOB 2P4TA 3MEVA 4PJOF 4M77G 4CC2A 3VV0A 3CC2Q 4QQGA 4PFPA 2X4XA 1VQ8T 4ESRA 5GAMd 4D8KA 1GCQC 2NUTB 3OYFA 1V1CA 3HRTA 4QVDA 1B34A 2RQRA 4J9FA 2DILA 1KG1A 3QJ6A 3LX7A 5FLXE 1X2KA 2K57A 2RI5A 2OTLA 3RR6A 1ZX6A 4M77F 4M75G 4OGEA 1PSEA 1UG1A 3V8JA 1QKWA 4J6WA 4FSXA 4HKEA 2EKOA 4J9EA 2VXFA 1VQ7T 1LVKA 2KVQG 2HQXA 1Y96A 4PJLA 4GLKA 1NEGA 3UA6A 1Q95G 2RHYA 1ZA2B 2FPDA 1WJSA 3VJPA 3UWNA 4QQ6A 4E2FB 2DXTA 1AVZC 1C1AA 1D0XA 1B7TA 2X4WA 3TSZA 2A08A 2EBPA 1YITA 2M16A 1MNEA 3JCMW 1YI2Q 1D3BB 3M0RA 3I35A 4JRPA 3NTHA 1PD1A 2NLUA 1VQNT 2FRYA 4RTWA 2PU9B 4FT2A 2A36A 2BTTA 3DLMA 2LCCA 3P8DA 4N4IA 4J7IA 2DETA 4PJMA 3G4ST 2OTJT 4C92B 2YUPA 3CCET 4M78D 3EG0A 5FWCA 5GAN8 5LJ3d 5I2SA 2MI6A 3VKIA 1WXTA 4M7AD 3OA6A 1OQKA 2VB6A 4Z88A 1X2QA 5HK3A 2NUZA 1AT1B 3JAME 3OS1A 1GCPA 2YXYA 3QO3A 3MEAA 4L59A 1KK7A 2BE7D 2VKNA 1D09B 2QQAA 2QASA 1Y0MA 3LGFA 3L2VA 1MUZA 2ZZDA 4C5EA 2RH2A 1TUGB 3QWYA 3M54A 2DTIA 3VS2A 2CSQA 5GANg 3QBYA 2R57A 4QQDA 3S3OA 4RTXA 3CC2T 2FPFA 4KGZB 2EQUA 3CMEQ 3ULRB 3NHNA 1N27A
chains in the Genus database with same CATH topology
1K0SA 2YUOA 2FO0A 4HVWA 2DX1A 1GFDA 2EYXA 1UDLA 1BU1A 1UUEA 2ECZA 2QDLA 2EPDA 3NPFA 1GBQA 3TSWA 4J9BA 2C0OA 2JM8A 2KYMA 4RTZA 3IQLA 1AZEA 1M8MA 4RTVA 1JO8A 1VYTA 3NMZC 2DMOA 4LUEA 1N5ZA 3C0CA 4RTTA 1NG2A 2O9SA 1NLOC 1JU5C 2DBMA 2RF0A 3M0QA 2CT4A 1VA7A 4F17A 1OPKA 4CC3A 4LN2A 1GBRA 2L0AA 3I9QA 2RMOA 1KJWA 3U23A 1Z9ZA 4AG2C 3VS4A 4HCKA 2DL8A 2J6FA 1J3TA 4F14A 3REBB 4OMQA 1TUCA 4KRTA 2E5KA 2P4RA 2SEMA 1K9AA 1CKBA 3LH5A 2H8HA 2JS2A 2C0TA 2L3QA 4RUGA 3RNJA 4OMNA 1CSKA 2A37A 4JPBW 2EGCA 1A0NB 1YN8A 1U3OA 5IXBA 2L2PA 2EYWA 1G83A 3O5ZA 1H92A 1OEBA 1RLPC 1PHTA 2O9VA 1SHGA 2AK5A 2EKHA 3RBBB 4J9DA 1UFFA 5EC7A 1LCKA 3JV3A 3M0PA 4HVUA 2KYBA 1AZGB 1H8KA 2K9GA 2KGTA 3EGUA 3I5SA 2JTEA 1JXOA 2D8JA 2B86A 4ZNXA 3SHWA 1HD3A 1ZUUA 2LZ6B 5IH2A 2CREA 4AFQC 1K76A 1IO6A 1PNJA 2VWFA 2L3SA 2W10A 3VS0A 2EYYA 3REAB 2M0YA 1Z9QA 2DL4A 1W70A 1S1NA 2ED1A 1SEMA 1T3SA 2CH4W 2DRKA 2HEQA 1OV3A 3KFVA 2X3WD 2OJ2A 1E6HA 4M4ZA 1BBZA 4GBQA 2RPNA 2CUBA 2HBWA 2FG0A 4AFSC 1UECA 4J9CA 2J6OA 1SHFA 1WX6A 4GLMA 2DL5A 1PKSA 1PKTA 1KIKA 2MOXA 5IHNA 1NM7A 1UJYA 2OI3A 1QKXA 5FWBA 1UJ0A 2GBQA 2AZSA 1T0JA 4OMMA 2O88A 1CKAA 1PRLC 2HCKA 2FRWA 3M0UA 4FSSA 3M0TA 4AG1C 1NYFA 1JEGA 1T0HA 1M3CA 5GJWB 1WXUA 4ORZA 2L3PA 2LQWA 3H41A 4K11A 3VS6A 2F2XA 1UHCA 5ECAA 1UHFA 1I07A 1NEBA 1W1FA 2KNBB 2KRSA 2J6KA 4OMLA 1M3BA 2JT4A 5I22A 2M51A 2HDAA 1KFZA 4A63B 2CUDA 4E6RA 1X6BA 1VYUA 5IHKA 1QCFA 3EHQA 1TG0A 4QT7A 2DA9A 2XMFA 1T3LA 2KE9A 4CC7A 2KR3A 1XOVA 2DNUA 1HJDA 2CDTA 2LJ0A 2KT8A 2K6DA 2MIOA 1ZSGA 1X69A 1QLYA 1MV0B 2YSQA 4J9GA 1QWFA 2DYBA 2EQIA 2HSPA 2KRMA 1RUWA 2DL7A 2CSIA 2GQIA 1WDXA 1OPLA 2YT6A 1YWPA 4Z8AA 2AKLA 4J9HA 3VRYA 5IXFA 4OMPA 2JMAA 2LP5A 2W0ZA 4X1VA 2DM1A 4JJDA 2RQUA 4LE9A 4IIOA 2D1XA 2K3BA 1UTIA 1AWXA 1ZUKA 1B07A 2EGAA 1HSQA 3I5RA 2YDLA 1NLPC 4HVVA 2G6FX 4Y92A 2F2WA 2JW4A 3UA7A 2PNIA 2ED0A 1ABOA 1FMKA 2BZYA 1WLPB 2J7IA 3VS1A 2I0NA 1AWJA 1PWTA 1W6XA 2DRMA 1GFCA 2EW3A 4DEXA 2LMJA 2ENMA 3QWXX 4AFZC 1M30A 1E7OA 4JJCA 1WIEA 1ABQA 5I11A 1VYVA 1TUDA 2ROTA 2RQVA 2KXCA 5L23A 1U06A 2ABLA 1X43A 1YP5A 2D8HA 3H0FA 2CH4A 3VRZA 4JZ3A 1BB9A 2AKKA 2RQTA 1K1ZA 1M27C 1K4US 2J06A 2RNAA 2RQWA 2GNCA 3VS3A 2J05A 3GBQA 2PTKA 1ZBJA 5FW9A 2DLPA 4CC2A 3ZL7C 2GTOA 3EG1A 3EHRA 2DF6A 3PVQA 4ESRA 1NYGA 1E6GA 2C0IA 4D8KA 1WFWA 1JQQA 2DJQA 3VS7A 4Z89A 2LQNA 4EIKA 1GCQC 2EVRA 1AWOA 1V1CA 1QWEA 2EYZA 2CT3A 2RQRA 4J9FA 1FYNA 1MV3A 2DILA 4LUDA 3EG2A 1UGVA 1X2KA 1SPKA 1I1JA 1ZUYA 1X27A 2BZXA 1ZX6A 2D0NA 2MCNA 1U5SA 2JXBA 3EG3A 4DEYA 2KT1A 1UG1A 2YUNA 2KBTA 1QKWA 4J9EA 3PE0A 1WA7A 2DE0X 4WCIA 2K7AA 2O31A 4IIMA 2FPEA 4AFUC 1GRIA 1NEGA 2ESWA 3UA6A 4R0KA 3UF4A 2YUQA 4RTUA 1SRLA 2DBKA 2FPDA 3VS5A 2KXDA 1AEYA 1KSWA 1UE9A 2FEIA 2A28A 2LJ1A 1AVZC 2V1QA 4D8DA 2RN8A 2O2OA 3TSZA 3SEMA 1M3AA 2PZ1A 2A08A 1B3QA 2JMCA 2EBPA 1PRMC 3FJ5A 1WYXA 1BK2A 3TVTA 2V1RA 1SRMA 2BZ8A 3I35A 3M0RA 1OOTA 2JM9A 2FRYA 4RTWA 3UATA 2A36A 2BTTA 2K2MA 4OMOA 2AZVA 1SSHA 5HCKA 2EGEA 4CC4B 1I0CA 2NWMA 2LCSA 1WI7A 2YUPA 1AOJA 3EG0A 5FWCA 2OAWA 1EFNA 3NGPA 4HXJA 2GTJA 4LNPA 2F2VA 2X3XD 3A98A 1WXTA 2KEAA 4RTYA 2LJ3A 2SRCA 4JZ4A 4F16A 1AWWA 4Z88A 3PVLA 1Y57A 1X2QA 1YCSB 2KROA 3H0HA 4J9IA 3R6NA 2NUZA 1WXBA 2DVJA 2K79A 1GCPA 5IHIA 2KRNA 2VKNA 1JXMA 1GL5A 1AD5A 1GCQA 1Y0MA 1ZLMA 2VVKA 1MUZA 2DL3A 3M0SA 1G2BA 2GGRA 2LX7A 1YWOA 3H0IA 3QWYA 2LNHB 3VS2A 2CSQA 4JJBA 2IIMA 3THKA 1RI9A 1K0XA 1RLQC 4RTXA 2FPFA 5GJVB 1H3HA 3ULRB 2JS0A 3CQTA 1X6GA 3NHNA 2ROLA 1YNZA 1ARKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K0S A;  2YUO A;  2FO0 A;  4HVW A;  2DX1 A;  1GFD A;  2EYX A;  1UDL A;  1BU1 A;  1UUE A;  2ECZ A;  2QDL A;  2EPD A;  3NPF A;  1GBQ A;  3TSW A;  4J9B A;  2C0O A;  2JM8 A;  2KYM A;  4RTZ A;  3IQL A;  1AZE A;  1M8M A;  4RTV A;  1JO8 A;  1VYT A;  3NMZ C;  2DMO A;  4LUE A;  1N5Z A;  3C0C A;  4RTT A;  1NG2 A;  2O9S A;  1NLO C;  1JU5 C;  2DBM A;  2RF0 A;  3M0Q A;  2CT4 A;  1VA7 A;  4F17 A;  1OPK A;  4CC3 A;  4LN2 A;  1GBR A;  2L0A A;  3I9Q A;  2RMO A;  1KJW A;  3U23 A;  1Z9Z A;  4AG2 C;  3VS4 A;  4HCK A;  2DL8 A;  2J6F A;  1J3T A;  4F14 A;  3REB B;  4OMQ A;  1TUC A;  4KRT A;  2E5K A;  2P4R A;  2SEM A;  1K9A A;  1CKB A;  3LH5 A;  2H8H A;  2JS2 A;  2C0T A;  2L3Q A;  4RUG A;  3RNJ A;  4OMN A;  1CSK A;  2A37 A;  4JPB W;  2EGC A;  1A0N B;  1YN8 A;  1U3O A;  5IXB A;  2L2P A;  2EYW A;  1G83 A;  3O5Z A;  1H92 A;  1OEB A;  1RLP C;  1PHT A;  2O9V A;  1SHG A;  2AK5 A;  2EKH A;  3RBB B;  4J9D A;  1UFF A;  5EC7 A;  1LCK A;  3JV3 A;  3M0P A;  4HVU A;  2KYB A;  1AZG B;  1H8K A;  2K9G A;  2KGT A;  3EGU A;  3I5S A;  2JTE A;  1JXO A;  2D8J A;  2B86 A;  4ZNX A;  3SHW A;  1HD3 A;  1ZUU A;  2LZ6 B;  5IH2 A;  2CRE A;  4AFQ C;  1K76 A;  1IO6 A;  1PNJ A;  2VWF A;  2L3S A;  2W10 A;  3VS0 A;  2EYY A;  3REA B;  2M0Y A;  1Z9Q A;  2DL4 A;  1W70 A;  1S1N A;  2ED1 A;  1SEM A;  1T3S A;  2CH4 W;  2DRK A;  2HEQ A;  1OV3 A;  3KFV A;  2X3W D;  2OJ2 A;  1E6H A;  4M4Z A;  1BBZ A;  4GBQ A;  2RPN A;  2CUB A;  2HBW A;  2FG0 A;  4AFS C;  1UEC A;  4J9C A;  2J6O A;  1SHF A;  1WX6 A;  4GLM A;  2DL5 A;  1PKS A;  1PKT A;  1KIK A;  2MOX A;  5IHN A;  1NM7 A;  1UJY A;  2OI3 A;  1QKX A;  5FWB A;  1UJ0 A;  2GBQ A;  2AZS A;  1T0J A;  4OMM A;  2O88 A;  1CKA A;  1PRL C;  2HCK A;  2FRW A;  3M0U A;  4FSS A;  3M0T A;  4AG1 C;  1NYF A;  1JEG A;  1T0H A;  1M3C A;  5GJW B;  1WXU A;  4ORZ A;  2L3P A;  2LQW A;  3H41 A;  4K11 A;  3VS6 A;  2F2X A;  1UHC A;  5ECA A;  1UHF A;  1I07 A;  1NEB A;  1W1F A;  2KNB B;  2KRS A;  2J6K A;  4OML A;  1M3B A;  2JT4 A;  5I22 A;  2M51 A;  2HDA A;  1KFZ A;  4A63 B;  2CUD A;  4E6R A;  1X6B A;  1VYU A;  5IHK A;  1QCF A;  3EHQ A;  1TG0 A;  4QT7 A;  2DA9 A;  2XMF A;  1T3L A;  2KE9 A;  4CC7 A;  2KR3 A;  1XOV A;  2DNU A;  1HJD A;  2CDT A;  2LJ0 A;  2KT8 A;  2K6D A;  2MIO A;  1ZSG A;  1X69 A;  1QLY A;  1MV0 B;  2YSQ A;  4J9G A;  1QWF A;  2DYB A;  2EQI A;  2HSP A;  2KRM A;  1RUW A;  2DL7 A;  2CSI A;  2GQI A;  1WDX A;  1OPL A;  2YT6 A;  1YWP A;  4Z8A A;  2AKL A;  4J9H A;  3VRY A;  5IXF A;  4OMP A;  2JMA A;  2LP5 A;  2W0Z A;  4X1V A;  2DM1 A;  4JJD A;  2RQU A;  4LE9 A;  4IIO A;  2D1X A;  2K3B A;  1UTI A;  1AWX A;  1ZUK A;  1B07 A;  2EGA A;  1HSQ A;  3I5R A;  2YDL A;  1NLP C;  4HVV A;  2G6F X;  4Y92 A;  2F2W A;  2JW4 A;  3UA7 A;  2PNI A;  2ED0 A;  1ABO A;  1FMK A;  2BZY A;  1WLP B;  2J7I A;  3VS1 A;  2I0N A;  1AWJ A;  1PWT A;  1W6X A;  2DRM A;  1GFC A;  2EW3 A;  4DEX A;  2LMJ A;  2ENM A;  3QWX X;  4AFZ C;  1M30 A;  1E7O A;  4JJC A;  1WIE A;  1ABQ A;  5I11 A;  1VYV A;  1TUD A;  2ROT A;  2RQV A;  2KXC A;  5L23 A;  1U06 A;  2ABL A;  1X43 A;  1YP5 A;  2D8H A;  3H0F A;  2CH4 A;  3VRZ A;  4JZ3 A;  1BB9 A;  2AKK A;  2RQT A;  1K1Z A;  1M27 C;  1K4U S;  2J06 A;  2RNA A;  2RQW A;  2GNC A;  3VS3 A;  2J05 A;  3GBQ A;  2PTK A;  1ZBJ A;  5FW9 A;  2DLP A;  4CC2 A;  3ZL7 C;  2GTO A;  3EG1 A;  3EHR A;  2DF6 A;  3PVQ A;  4ESR A;  1NYG A;  1E6G A;  2C0I A;  4D8K A;  1WFW A;  1JQQ A;  2DJQ A;  3VS7 A;  4Z89 A;  2LQN A;  4EIK A;  1GCQ C;  2EVR A;  1AWO A;  1V1C A;  1QWE A;  2EYZ A;  2CT3 A;  2RQR A;  4J9F A;  1FYN A;  1MV3 A;  2DIL A;  4LUD A;  3EG2 A;  1UGV A;  1X2K A;  1SPK A;  1I1J A;  1ZUY A;  1X27 A;  2BZX A;  1ZX6 A;  2D0N A;  2MCN A;  1U5S A;  2JXB A;  3EG3 A;  4DEY A;  2KT1 A;  1UG1 A;  2YUN A;  2KBT A;  1QKW A;  4J9E A;  3PE0 A;  1WA7 A;  2DE0 X;  4WCI A;  2K7A A;  2O31 A;  4IIM A;  2FPE A;  4AFU C;  1GRI A;  1NEG A;  2ESW A;  3UA6 A;  4R0K A;  3UF4 A;  2YUQ A;  4RTU A;  1SRL A;  2DBK A;  2FPD A;  3VS5 A;  2KXD A;  1AEY A;  1KSW A;  1UE9 A;  2FEI A;  2A28 A;  2LJ1 A;  1AVZ C;  2V1Q A;  4D8D A;  2RN8 A;  2O2O A;  3TSZ A;  3SEM A;  1M3A A;  2PZ1 A;  2A08 A;  1B3Q A;  2JMC A;  2EBP A;  1PRM C;  3FJ5 A;  1WYX A;  1BK2 A;  3TVT A;  2V1R A;  1SRM A;  2BZ8 A;  3I35 A;  3M0R A;  1OOT A;  2JM9 A;  2FRY A;  4RTW A;  3UAT A;  2A36 A;  2BTT A;  2K2M A;  4OMO A;  2AZV A;  1SSH A;  5HCK A;  2EGE A;  4CC4 B;  1I0C A;  2NWM A;  2LCS A;  1WI7 A;  2YUP A;  1AOJ A;  3EG0 A;  5FWC A;  2OAW A;  1EFN A;  3NGP A;  4HXJ A;  2GTJ A;  4LNP A;  2F2V A;  2X3X D;  3A98 A;  1WXT A;  2KEA A;  4RTY A;  2LJ3 A;  2SRC A;  4JZ4 A;  4F16 A;  1AWW A;  4Z88 A;  3PVL A;  1Y57 A;  1X2Q A;  1YCS B;  2KRO A;  3H0H A;  4J9I A;  3R6N A;  2NUZ A;  1WXB A;  2DVJ A;  2K79 A;  1GCP A;  5IHI A;  2KRN A;  2VKN A;  1JXM A;  1GL5 A;  1AD5 A;  1GCQ A;  1Y0M A;  1ZLM A;  2VVK A;  1MUZ A;  2DL3 A;  3M0S A;  1G2B A;  2GGR A;  2LX7 A;  1YWO A;  3H0I A;  3QWY A;  2LNH B;  3VS2 A;  2CSQ A;  4JJB A;  2IIM A;  3THK A;  1RI9 A;  1K0X A;  1RLQ C;  4RTX A;  2FPF A;  5GJV B;  1H3H A;  3ULR B;  2JS0 A;  3CQT A;  1X6G A;  3NHN A;  2ROL A;  1YNZ A;  1ARK A; 
#chains in the Genus database with same CATH topology
 2JOY A;  4Z02 A;  2KMT A;  5GAN e;  4HVW A;  2DX1 A;  2O01 E;  3RIR A;  1UDL A;  2RO0 A;  3TCJ A;  4FW1 A;  1TXQ A;  4AT1 B;  2Y4Y A;  1M8V A;  3KXT A;  4RTZ A;  4FYY B;  4FM4 B;  5CR2 A;  4E7S A;  3IQL A;  1AZE A;  2VUB A;  1M8M A;  5CKF A;  1QVG P;  4M7D D;  3QJY A;  1VYT A;  1N5Z A;  1JB0 E;  4PJO D;  1W2B P;  1PD0 A;  4B9X A;  1VA7 A;  4F17 A;  2EJG A;  1QW1 A;  3PFS A;  4JS5 A;  1S72 T;  4E7H A;  2L0A A;  4J7F A;  3L42 A;  1J3T A;  4PJO E;  1VQ5 A;  2E5K A;  2LT4 A;  3LH0 A;  2SEM A;  1V29 B;  3LH5 A;  3ZFJ A;  2CYZ B;  2XKO C;  2QQS A;  5LJ5 d;  2EGC A;  1A0N B;  1YN8 A;  2LCL A;  5GAM j;  2RJC A;  3OYL A;  3S3M A;  3ME9 A;  1IHV A;  2EYW A;  4PL6 A;  5CK9 A;  1H92 A;  3MEU A;  2ZPE B;  1Q81 C;  3RUX A;  5EC7 A;  1YI2 T;  4GY5 A;  3CD6 A;  2GFA A;  4EMK A;  4HVU A;  2DKG A;  2KGT A;  4DBH A;  3I5S A;  4M77 E;  2B86 A;  4ZNX A;  1EZZ B;  3MP6 A;  2LZ6 B;  5IH2 A;  5AYF A;  2CRE A;  2PVO B;  1VQ6 Q;  2O4X B;  2K5L A;  2L3S A;  2FL7 A;  3VS0 A;  2V8I A;  4XTX A;  3REA B;  3CC4 T;  2CP6 A;  2P0K A;  1QVF S;  4M75 D;  2ED1 A;  2CH4 W;  2DRK A;  2FZC B;  2YRD A;  2HEQ A;  3CCR T;  5HK0 A;  4PLL A;  5GAO r;  1RAI B;  2RPN A;  1QCO A;  3JCM X;  2R5A A;  5GAM h;  4LD6 A;  1SHF A;  3L2U A;  2JNG A;  1PKT A;  2V8J A;  2MOX A;  3FB9 A;  3L1A A;  2XI9 A;  5A2Q E;  3CCL Q;  4KUD K;  2QK0 A;  5GMK l;  2PVD B;  1I81 A;  1IGU A;  2JTM A;  2AZS A;  1N9R A;  3DB4 A;  1YJW A;  3FEO A;  2FRW A;  3M0U A;  3M0T A;  1QVF A;  5KYW B;  1JEG A;  2QI2 A;  1X75 C;  4M78 B;  1M3C A;  5GJW B;  1K8A C;  3KUF A;  3CCM Q;  4RG8 A;  3HTR A;  1EIF A;  1IXD A;  2LNV A;  4N4H A;  5ECA A;  3OQ5 A;  3CME T;  1VIF A;  4OMF B;  1UHF A;  1NEB A;  2KNB B;  3H8Z A;  3C4S A;  4OML A;  3CCQ Q;  2JT4 A;  2A7Y A;  2M02 A;  5I22 A;  2M51 A;  3JB9 J;  1KFZ A;  2CUD A;  1MND A;  1M2O A;  2COZ A;  2CP5 A;  3M5A A;  1QCF A;  4QT7 A;  4CRI A;  1NJI R;  2LRQ A;  3L2Q A;  2DJZ A;  2ZPB B;  1FMW A;  1T3L A;  2KR3 A;  1HJD A;  3GF5 A;  3CMA A;  3CEY A;  2KT8 A;  1X69 A;  4XU3 A;  5GMK i;  2DXC A;  3EFO A;  3M57 A;  1R0B G;  1TH7 A;  1VQO Q;  4XTY A;  1QWF A;  2CZ1 B;  3P8B B;  4FCY A;  2QEX Q;  2HSP A;  1RUW A;  2DL7 A;  2CSI A;  3MET A;  1WDX A;  2DXB A;  4BUG A;  2ZCF B;  1OPL A;  4HT9 A;  2YT6 A;  3VRY A;  2CKK A;  5J39 A;  2QTV A;  3GIB A;  2W0Z A;  5CAI A;  2NUT A;  1OZ2 A;  3JCM b;  2DM1 A;  4JJD A;  3DB3 A;  2RQU A;  5LL6 S;  4LE9 A;  1KD1 C;  4IIO A;  2D1X A;  3M59 A;  1UTI A;  1VQM A;  2R5M A;  1HSQ A;  5LJ3 h;  1Q7Y U;  2MMP A;  4C8Q B;  1IB8 A;  1JBM A;  2JW4 A;  4P5N A;  4M7D B;  2H3E B;  1WLP B;  2QQR A;  2J7I A;  1C6V X;  4BI4 A;  4IUV A;  5CKD A;  3JRZ A;  1OUL A;  5IAY A;  4ANJ A;  1LPL A;  4Y28 E;  1WQW A;  5CQY A;  1VQ6 T;  1WIE A;  1ABQ A;  1VYV A;  3RMS A;  2KXC A;  1U06 A;  2ABL A;  2K5F A;  4QKU A;  1X43 A;  1YP5 A;  3INZ A;  4MZM A;  3E9F A;  1U1S A;  1IRX A;  4NS5 A;  2EQK A;  3VU3 C;  2GNC A;  2J05 A;  3GBQ A;  2PTK A;  2KAF A;  2LVM A;  1IHW A;  1ZBJ A;  4FYW B;  3ASK A;  2GCX A;  3F70 A;  3HRU A;  2F69 A;  3EG1 A;  1D3B A;  2DF6 A;  1OZ3 A;  2C0I A;  1M1K R;  1JQQ A;  3S6W A;  1TU0 B;  3CCL T;  2LQN A;  1RL2 A;  3FJP A;  4EIK A;  1OYX A;  4EMG A;  2LQK A;  4WTO B;  5LJ5 j;  3OMC A;  1AWO A;  4C92 A;  1VIE A;  1BKB A;  2ATC B;  4CI0 C;  3QYH B;  4A4E A;  1UGV A;  1Q81 R;  4PJO C;  3CCM T;  5GMK h;  5GAO l;  1VQK Q;  1I1J A;  1YIT Q;  1ZUY A;  3OB9 A;  1X27 A;  2BZX A;  2JXB A;  8AT1 B;  4ZN1 A;  4DEY A;  3GNG A;  2C06 A;  2YUN A;  3JB9 I;  2QG9 B;  3CCQ T;  1WA7 A;  2L5Q A;  5FRO A;  2O31 A;  4FYX B;  3OW2 S;  3HFO A;  3I55 T;  1GRI A;  2QQ9 A;  2CZ6 B;  3M56 A;  3SWN B;  5A0L A;  2ESW A;  1I5O B;  4OB3 B;  3JCM Q;  4RTU A;  2DBK A;  1M2V B;  3VS5 A;  4F7U B;  1KSW A;  2FEI A;  2PQW A;  2JZ2 A;  3JCM c;  2DEQ A;  2LJ1 A;  3DLL A;  5LJ5 h;  3PNW C;  4M77 C;  2RN8 A;  2LX9 A;  1M3A A;  3QPH A;  1VQO T;  1VQ4 A;  2JMC A;  1V76 A;  2COW A;  8ATC B;  2QEX T;  2B8A A;  3EFS A;  3VUZ A;  2HNI A;  2CS7 A;  1ZSZ C;  1OOT A;  3HRS A;  3OW2 A;  2RA2 A;  5DM7 R;  3PIP A;  4IUP A;  2K2M A;  1KHI A;  1KC8 R;  4O6J A;  4IUU A;  2NWM A;  3VYH B;  4A4H A;  2OAW A;  3FLG A;  2GQV A;  2P84 A;  3NGP A;  7AT1 B;  4L5G A;  2EQM A;  1SKU B;  1NPP A;  1WJQ A;  2F2V A;  2X3X D;  2AIR B;  3A5Z B;  3N5B B;  4RTY A;  3CBP A;  2LJ3 A;  3MPU B;  3O8V A;  2E4H A;  3HKS A;  4X34 A;  3URG A;  1AWW A;  3PVL A;  1Y57 A;  4EMK C;  5KYU B;  1QMC A;  4J9I A;  4YTL A;  5IHI A;  1BIB A;  5FU7 C;  4E7L A;  1JXM A;  4LDU A;  3QSU A;  2EYQ A;  1PC0 A;  2VVK A;  1UGR B;  3BW1 A;  2WSF E;  5KYY A;  2DL3 A;  3M0S A;  4BE0 A;  3V8K A;  2GGR A;  4ZGE B;  2OTL T;  2LNH B;  3A8O B;  1N8R R;  4JJB A;  3OYK A;  5A0G A;  1RI9 A;  1M1F A;  3OBY A;  5GJV B;  5GAN 2;  1H3H A;  4E47 A;  1KD1 R;  2ROL A;  3OYD A;  4XTU A;  3FDR A;  1VQ5 Q;  2JN0 A;  2O4X A;  1K9M R;  1NPR A;  3QXE B;  3WVE B;  2HBP A;  4RTV A;  2DIG A;  1JO8 A;  2X51 A;  3JB9 H;  2O9S A;  1NLO C;  5GAO p;  1YIT T;  5AT1 B;  3M0Q A;  2MAM A;  3PTA A;  1U1T A;  2FB7 A;  3HFN A;  2KY9 A;  3CD6 Q;  2RMO A;  2K4Y A;  1OI1 A;  2ZAE A;  3LWI A;  2RHZ A;  3VS4 A;  2DL8 A;  2HAX A;  3VYG A;  1VQK A;  4KRT A;  5GAN 6;  4MZT A;  5CCA A;  2OX7 A;  2RI3 A;  1WQ7 A;  3QHS A;  2VC8 A;  2X4J A;  5KYW A;  1KHC A;  2FZK B;  4A4K A;  4M78 A;  1FXX A;  3EG9 B;  2RI2 A;  4J6X A;  4VUB A;  3VUB A;  4C0Z A;  2A37 A;  3EGD B;  3S3N A;  2L2P A;  1G83 A;  3O5Z A;  1RLP C;  4M7A A;  2RD1 A;  1SHG A;  4B6M A;  2JJ9 A;  2EKH A;  1UFF A;  4FIB A;  3A8M B;  3PMI A;  2P0Q A;  2RM4 A;  3M0P A;  2V8K A;  1AZG B;  2K9G A;  4BAC A;  2D8J A;  1NJI C;  1ZUU A;  4RCB A;  2JTF A;  1K76 A;  3Q1J A;  1PNJ A;  1M4Z A;  1YJW Q;  3OSV A;  2W10 A;  2HKN A;  3M55 A;  2EYY A;  4F7U F;  4OGC A;  5GAN f;  4X9C A;  2DL4 A;  1S1N A;  4A54 A;  2EIF A;  3BDU A;  1Y7X A;  1SEM A;  4E7J A;  1Q82 R;  1E6H A;  4M4Z A;  1BBZ A;  2MK5 A;  2XG8 D;  3A8G B;  2ZPF B;  2CUB A;  2FG0 A;  1UEC A;  4JRI A;  2FHD A;  1XTD A;  3QDR B;  3NFC A;  1YHQ Q;  2L3R A;  2GF7 A;  5IHN A;  4BI8 B;  1K8A U;  2ZPG B;  1QKX A;  2DTO A;  2E41 A;  1UJ0 A;  3TEE A;  1T0J A;  1PG5 B;  5KCH A;  4OMM A;  3X28 B;  4HCC A;  1KQS P;  4C8Q A;  3CMA Q;  4FSS A;  1NYF A;  2DD4 A;  3RMQ A;  1PSF A;  2L3P A;  3MHX A;  4M7D A;  2K5I A;  2YLC A;  3C12 A;  9ATC B;  4N0A A;  3SFM A;  3C95 A;  2LC4 A;  1I07 A;  2KRS A;  2J6K A;  1M3B A;  2HDA A;  1VQ5 T;  1I4K 1;  1I5L A;  2Y4X A;  1XQH A;  2VYT A;  1G3T A;  4BE1 A;  2YLB A;  3V7R A;  1VYU A;  4LDW A;  5IHK A;  3KBG A;  1VQM Q;  4Y91 A;  1YJN A;  1TG0 A;  4R56 A;  1UGQ B;  4J83 A;  2KE9 A;  2DNU A;  2RJE A;  2CDT A;  4FU6 A;  2K6D A;  2MIO A;  3CCU A;  1ZSG A;  2FZG B;  1QLY A;  2BUD A;  2PVG B;  3M58 A;  3OYB A;  1YJ9 A;  4J9G A;  2E10 A;  2DYB A;  2LQ8 A;  1RAB B;  2EQI A;  4PFO A;  2VAS A;  3D7S B;  3CD6 T;  2X9H A;  4E7Z A;  4C0G A;  5KYY B;  1M1K C;  1VQP A;  2XDB A;  4ZGJ B;  4M77 D;  4MMK A;  3G6E A;  2AKL A;  4IUQ A;  5C6S A;  4OMP A;  4A53 A;  3TRE A;  4KGV B;  1B07 A;  3I5R A;  2YRV A;  2Z0W A;  3X26 B;  5GAO n;  4HVV A;  2DO3 A;  3MEW A;  2HD0 A;  3EH2 A;  4M75 A;  2ZGW A;  1N6A A;  4C92 G;  3J81 E;  2I0N A;  3LWH A;  1K73 R;  2AT1 B;  3L2W A;  1W6X A;  5CO7 A;  1GFC A;  2DTH A;  4ZTJ A;  1QVP A;  2KDS A;  2E1H A;  2ENM A;  3SWN A;  4AFZ C;  3ZBD A;  4FL6 A;  1TUD A;  1M2V A;  1YJW T;  4KBM B;  5L23 A;  4F7U A;  3CXC S;  5GAO q;  2CH4 A;  3H6Z A;  2VGN A;  4DQ2 A;  1BI2 A;  2WSC E;  4XTZ A;  2LT1 A;  1QVG S;  5FW9 A;  2DLP A;  3MCA B;  5CKE A;  4C92 F;  3ZL7 C;  1W2B S;  2GTO A;  3C94 A;  2G3R A;  3CPW P;  3PMT A;  3PVQ A;  3QZ5 B;  1NYG A;  1KC8 C;  1E6G A;  1YHQ T;  1OU8 A;  1M90 R;  2DJQ A;  4Z89 A;  5GAM e;  1QWE A;  2EYZ A;  1GXI E;  2CT3 A;  4UC4 A;  3CXC A;  4M7A B;  4RG2 A;  2H3J A;  3CMA T;  1FYN A;  2K3Y A;  1VQL Q;  3OYE A;  3E19 A;  5LJ3 j;  4JJN K;  1SPK A;  1YHQ A;  5DY9 A;  4XTW A;  3M4Y A;  1QVG A;  1VQ4 Q;  2HKQ B;  4F7U E;  1XNI A;  3EG3 A;  2E3I A;  1W2B A;  1R8O B;  5KYU A;  2KT1 A;  2KBT A;  3PE0 A;  4BI3 A;  6AT1 B;  2DE0 X;  3BDL A;  4IIM A;  2HQE A;  3X25 B;  2FPE A;  4AFU C;  3SDZ A;  4HT8 A;  4JRQ A;  2VXE A;  4R0K A;  3UF4 A;  1VQM T;  1RAH B;  2P0P A;  1QP2 A;  4KT0 E;  2DZC A;  4E7I A;  1N8R C;  2V1Q A;  5M9O A;  4D8D A;  2A0F B;  4IUT A;  1JJ2 P;  3I56 A;  2O2O A;  2PZ1 A;  4WF2 A;  1PRM C;  2DK3 A;  4XU2 A;  1Y71 A;  3FJ5 A;  5IN1 A;  4FW2 A;  2MWO A;  3L2Z A;  3CBO A;  3G71 Q;  5GAN 3;  2HZY A;  5EG2 A;  3JB9 F;  2JM9 A;  1K9M C;  1D1B A;  2Y90 A;  4MML A;  2AZV A;  1Q86 R;  2QGG A;  3LLR A;  5HCK A;  4CC4 B;  1I0C A;  2LCS A;  4PJO B;  2GFU A;  3OS0 A;  1QQJ A;  3JCM f;  3RES A;  2GTJ A;  3GNF B;  4LNP A;  3A98 A;  2KEA A;  5FU6 B;  3RDV A;  2SRC A;  4LXC A;  5GMK j;  1M9S A;  2M9U A;  1YCS B;  2E6Z A;  2KRO A;  2QA4 Q;  3H0H A;  2DER A;  1WXB A;  2DVJ A;  4ME7 A;  4BY6 C;  4JDS A;  2KRN A;  1N9S A;  1HYO A;  1WPY A;  3QUI A;  2KQW A;  3CPF A;  1GL5 A;  3JCM g;  4M77 B;  3GOX A;  2LDM A;  4J5Y A;  4RKU E;  1MHN A;  1ZLM A;  2EAY A;  2HQH A;  1G2B A;  4HCZ A;  2EWN A;  3EG9 A;  3H0I A;  3JCM e;  3GP8 A;  1NZ9 A;  3T9N A;  4C0D C;  3EGD A;  5CIU A;  1ZSZ B;  2IIM A;  1K0X A;  3OY9 A;  1RLQ C;  5GAN d;  1BCM A;  2JS0 A;  3CQT A;  2RHU A;  2KI7 A;  3HSB A;  4V2S A;  5A0D A;  3UT1 A;  3G1J A;  4M78 G;  2ECZ A;  2COY A;  2EPD A;  3NPF A;  3HL8 A;  4M75 B;  4XAX B;  4DOW A;  1P92 A;  2XHC A;  3FRN A;  2KYM A;  1KQ1 A;  1Q82 C;  2AHJ B;  2RK1 A;  3FIF A;  3OS5 A;  1VQ4 T;  4C92 D;  1JU5 C;  2DBM A;  2RF0 A;  4N0A C;  4NL2 A;  5GMK m;  1OPK A;  4CC3 A;  3OSS C;  3HP9 A;  3NTI A;  4KH0 B;  3X24 B;  3OYJ A;  1VQL A;  1KJW A;  4LDV A;  3QII A;  4M78 F;  4HCK A;  3R6O A;  4F14 A;  3REB B;  4OMQ A;  2CP3 A;  4C92 E;  2P4R A;  3V7S A;  1OU9 A;  1CKB A;  4M7A F;  2XIC A;  2H8H A;  2JS2 A;  2C0T A;  3H9N A;  2L3Q A;  4RUG A;  3RNJ A;  1MGQ A;  2RK2 A;  4XU1 A;  2RJF A;  1VQN Q;  4JPB W;  3CC7 A;  1U3O A;  4KUI A;  4ELY C;  2OAU A;  2DD5 A;  5LJ5 e;  1HK9 A;  2QTX A;  1PHT A;  1NJI U;  2X4Y A;  2OTJ Q;  2CZ7 B;  3E9G A;  1YIJ A;  3OYA A;  1LCK A;  3JV3 A;  1XJW B;  4C8Q G;  2KYB A;  1H8K A;  1RI0 A;  3EGU A;  2KSS A;  1JXO A;  1HD3 A;  3EH1 A;  4M7D G;  2HL5 C;  1D1C A;  1H3Z A;  1R0C B;  2VWF A;  4C0F A;  3G71 A;  3CCV A;  1G5V A;  3UDC A;  1T3S A;  4J6Y A;  1OV3 A;  3KFV A;  2X3W D;  2OJ2 A;  5IT9 E;  1VOM A;  1TWB A;  2E5Q A;  1VQ9 A;  1UGP B;  2HBW A;  4J9C A;  4JUV A;  4MDW A;  4C8Q F;  2J6O A;  1WX6 A;  2EJ9 A;  2WAC A;  2DL5 A;  1PKS A;  4M7D F;  1NM7 A;  2OI3 A;  5FWB A;  1YJN Q;  2L89 A;  4N4G A;  2QA4 A;  2O88 A;  4ATO A;  1CKA A;  1RAA B;  2D6F A;  4AG1 C;  3CCS Q;  3CCJ A;  3CCU Q;  1T0H A;  2RJD A;  1F1B B;  1WXU A;  4ORZ A;  1YJ9 Q;  2F1L A;  5CKB A;  3H41 A;  1K73 C;  4E7K A;  4J8O A;  4KUL A;  1FX7 A;  2F2X A;  4PK4 A;  2JUF A;  3RKW A;  2QQB A;  1VQP Q;  2YHT A;  4DBR A;  3G6E Q;  4PJN A;  2E65 A;  2QXF A;  1W4S A;  4E6R A;  1VQ8 A;  1VQK T;  2XD0 A;  1X6B A;  2YWW A;  1EX4 A;  5D6X A;  2DIQ A;  2V26 A;  3EHQ A;  2DA9 A;  1KQ2 A;  3SB2 A;  1X01 A;  3ZEH A;  4XK8 E;  1S72 Q;  4CC7 A;  5GAN 7;  1XOV A;  2LJ0 A;  4D6W A;  3EGX B;  1M1K U;  4NL3 A;  4A4G A;  4PNO A;  2BE9 B;  3MKD A;  1BI1 A;  4ZN3 A;  1DJ7 B;  2DAQ A;  4F7U G;  4PKC C;  1X6O A;  2WSE E;  5FRM A;  1M90 C;  1Q81 U;  2FYK A;  2IG0 A;  3SD4 A;  4Z8A A;  1VQ7 A;  2JMA A;  2LP5 A;  4X1V A;  5GAO m;  5KE3 A;  4M75 F;  1ZUK A;  2EGA A;  4B9W A;  3CCS T;  3BY7 A;  5GAN j;  5I21 A;  2F2W A;  2PNI A;  2ED0 A;  1FMK A;  2BZY A;  1PCX A;  2ZPH B;  1IZ6 A;  2CP2 A;  3ER0 A;  3PT9 A;  2XID A;  1PWT A;  1WHK A;  2EW3 A;  3CC4 Q;  3L2R A;  4XU0 A;  2LMJ A;  2QDY B;  3QWX X;  1O9S A;  1M30 A;  1VQN A;  1E7O A;  2HSE B;  3M53 A;  2E12 A;  3CCR Q;  2RQV A;  2ROT A;  2D8H A;  3G4S A;  2OTJ A;  3H0F A;  4M78 E;  3CCE A;  4JZ3 A;  1BB9 A;  2AKK A;  1MMG A;  1M27 C;  3RKX A;  1K4U S;  2J06 A;  4PLI A;  2RNA A;  2RQW A;  2VGM A;  1KC8 U;  4M7A E;  1M1G A;  2E64 A;  5GAN h;  2E3H A;  2DZ9 A;  1D0Y A;  2FVU A;  3JCM d;  3EHR A;  1LJO A;  5KYX B;  2RHX A;  1Q86 C;  1BYM A;  1WFW A;  1O75 A;  3VS7 A;  2EVR A;  1YJN T;  4PJO A;  2NUP A;  1QVF P;  4EPC A;  5CKH A;  1NBE B;  4O5V A;  2CP0 A;  1MV3 A;  4LD9 K;  4LUD A;  3CCU T;  3EG2 A;  3I56 Q;  4C92 C;  1OX9 A;  1YJ9 T;  3MP8 A;  3CXC P;  2D0N A;  2MCN A;  3PGG A;  1U5S A;  4C8Q D;  4OB1 B;  1HXD A;  1VQP T;  3CC2 A;  1ZHI A;  1RAE B;  4JLI A;  1Q7Y R;  3G6E T;  4WCI A;  2K7A A;  1SSF A;  3CCS A;  1SG5 A;  1G3Y A;  5KE2 A;  5KH6 A;  1N8R U;  4BDZ A;  1G8X A;  4M77 A;  2YUQ A;  1LNX A;  1SRL A;  2I2L A;  4DBF A;  4C8Q E;  1AEY A;  2KXD A;  1KD1 U;  3EFR A;  1UE9 A;  1WHH A;  4ZGD B;  2A28 A;  4M7D E;  4EDU A;  3SEM A;  1ZSZ A;  1K9M U;  1B3Q A;  4A4F A;  3M4G A;  1WYX A;  1BK2 A;  3TVT A;  2V1R A;  1S72 A;  2NYS A;  1SRM A;  2BZ8 A;  4PFZ A;  1FWZ A;  1WHM A;  1WNL A;  2RB6 A;  1PM3 A;  4HA8 A;  3A1P A;  3UAT A;  4OMO A;  2KK4 A;  1IRE B;  1U8R A;  1SSH A;  4MZP A;  2EGE A;  4OP0 A;  3LGL A;  1QP3 A;  1WI7 A;  1B34 B;  1AOJ A;  3JCM V;  3OYG A;  4DA4 A;  1EFN A;  4HXJ A;  1MMD A;  1BCO A;  5D6W A;  3GPL A;  1KQS S;  5GAM f;  1UEB A;  4XQ3 A;  4JZ4 A;  1TSF A;  4F16 A;  2CP7 A;  2PUK B;  4C5H A;  2BIV A;  2E6N A;  4FT4 A;  3R6N A;  2K79 A;  1YI2 A;  4TVR A;  2F5T X;  3WVD B;  3EAE A;  3OYI A;  3QYG B;  1Y96 B;  3DKM A;  4QVZ A;  1AD5 A;  1GCQ A;  5GAM g;  4LDX A;  5DLQ E;  2BKD N;  4OB0 B;  4C5G A;  2LX7 A;  4BD3 A;  1YWO A;  1NE8 A;  3CC4 A;  4JRK A;  5FRN A;  1TTH B;  1R77 A;  4M75 E;  4DBQ A;  1KQS A;  4LDY A;  5D7U A;  3THK A;  3CCR A;  2CGH A;  2DXU A;  4OVA A;  1FMV A;  5KYN A;  1BI3 A;  1X6G A;  4JS4 A;  1YNZ A;  1ARK A;  1K0S A;  2YUO A;  3HHT B;  5J26 A;  2FO0 A;  1VUB A;  1GFD A;  1Q82 U;  2EYX A;  1RAC B;  1BU1 A;  1UUE A;  2QDL A;  1GBQ A;  3TSW A;  4J9B A;  2C0O A;  2R58 A;  2JM8 A;  1I8F A;  2M0O A;  2DVE A;  4ZTF A;  5DLO A;  1ACM B;  2MF2 A;  4X9D A;  3JB9 G;  2IPO B;  1YFN A;  4II1 A;  3NMZ C;  2DMO A;  4LUE A;  3I56 T;  3C0C A;  3HPW A;  3CC7 Q;  4RTT A;  1NG2 A;  3I55 Q;  1ZQ1 A;  4BY6 B;  2CT4 A;  1UGS B;  3CBM A;  3PIO A;  4NOY A;  4ELZ C;  1WGS A;  2LTO A;  4LN2 A;  1GBR A;  1WZO A;  1YIJ Q;  1SF9 A;  3I9Q A;  3CME A;  3OS2 A;  3OMG A;  3QDF A;  2DEU A;  3U23 A;  2MWP A;  1Z9Z A;  4AG2 C;  2J6F A;  1G3S A;  2JVV A;  5LJ3 f;  1TUC A;  3P8H A;  4C5I A;  3AT1 B;  4XTV A;  4C0D B;  1K9A A;  3CCV Q;  1WHJ A;  4OMN A;  1CSK A;  2D9T A;  2DFU A;  2QYZ A;  1Y07 A;  2IVW A;  3NTK A;  3J7A F;  2VV5 A;  4Q5W A;  5IXB A;  1VQ9 Q;  4JLG A;  1OEB A;  2O9V A;  2NUP B;  5I2M A;  5LJ3 g;  2K3X A;  3A8H B;  1ZA1 B;  4M78 C;  2AK5 A;  1BIA A;  3OW2 P;  3RBB B;  2L8D A;  4J9D A;  3TU4 K;  4L6V 5;  5J3B A;  1QCN A;  5CQX A;  3TQ7 P;  2JTE A;  1LOJ A;  2XU8 A;  1JRI A;  4M7A C;  1WHG A;  3SHW A;  5LJ3 e;  2PUO B;  2QAZ A;  3CPW S;  4AFQ C;  3OYH A;  1IO6 A;  3MP1 A;  1MMA A;  5HKC A;  1G3W A;  3X20 B;  2HL3 A;  2X35 A;  2M0Y A;  1Z9Q A;  3CCJ Q;  1W70 A;  2ZPI B;  5C0M A;  3EGX A;  2EJF A;  5L8R E;  2YRC A;  1RAD B;  4GBQ A;  2M1H A;  3JCM h;  1TS9 A;  3RKY A;  1UB4 A;  2QGF B;  4AFS C;  2A3L A;  3A8L B;  1WHL A;  2EQJ A;  4GLM A;  1VQ8 Q;  3M9Q A;  3OYY A;  2OTL Q;  4IKF A;  2K2V A;  3CPW A;  1KIK A;  2RHI A;  2XDP A;  1UJY A;  1VQ6 A;  2GBQ A;  3E2U A;  4KGX B;  1K73 U;  1PRL C;  2HCK A;  2DYI A;  2XDD A;  3OYC A;  3QG1 A;  1YCY A;  4BE2 A;  1IGQ A;  4EMH A;  1ZBX A;  2CZ0 B;  2LQW A;  5GAN 5;  4DOV A;  4K11 A;  5D6Y A;  3VS6 A;  1UHC A;  4C8Q C;  1JJ2 S;  1BI0 A;  4QVC A;  4M7A G;  1VQL T;  3JCM J;  1TOV A;  1AHJ B;  3BE3 A;  1W1F A;  4M7D C;  2D0Q B;  1MMN A;  4EMK B;  3LYI A;  4FYV B;  1VQ7 Q;  4A63 B;  3GLX A;  3J80 E;  5LJ5 f;  3CCL A;  4OF1 A;  5GAN 4;  5FU7 B;  5GMK e;  3UPU A;  2XMF A;  5FU6 C;  2MPX C;  1D1A A;  4OB2 B;  1M5Q 1;  4BB7 A;  1D0Z A;  3CC7 T;  3BFM A;  3OYN A;  1M90 U;  1H64 1;  1MV0 B;  3CCM A;  2YSQ A;  3WXM B;  1JJ2 A;  3JSC A;  2XK0 A;  1YIJ T;  2KRM A;  5LJ5 g;  1RAG B;  5KYX A;  3MJX A;  2GQI A;  1OX8 A;  4HCB A;  4F04 B;  3CCQ A;  1YWP A;  4J9H A;  1C0M A;  5IXF A;  2MYS A;  3AHU A;  3I55 A;  4RCC A;  3V7C A;  2F5K A;  4AMC A;  2K3B A;  3V8L A;  3G4S Q;  1AWX A;  4RMO A;  3G71 T;  3CCE Q;  3CCV T;  3E1S A;  3OBW A;  2YDL A;  1YBY A;  3RER A;  1NLP C;  3LW5 E;  4IUR A;  3JCM P;  2G6F X;  5KCO A;  4Y92 A;  3UA7 A;  1VQ9 T;  1ABO A;  1K8A R;  1Q7Y C;  1RAF B;  3VS1 A;  1VQO A;  4PJO G;  1WJR A;  2QEX A;  1AWJ A;  2HMA A;  4KH1 B;  2EFI A;  2DRM A;  4DEX A;  4M75 C;  4QW2 A;  3QKJ A;  4R55 A;  4JJC A;  5I11 A;  2QA4 T;  3MO8 A;  3JB9 D;  4MDX A;  5HY6 A;  4BDY A;  3VRZ A;  3CCJ T;  3SWN C;  2RQT A;  3QZ9 B;  1K1Z A;  2E70 A;  5CVI A;  1Q86 U;  3VS3 A;  2DPP B;  3G7Z A;  3FC3 A;  4PJJ A;  3OYM A;  3EFO B;  2P4T A;  3MEV A;  4PJO F;  4M77 G;  4CC2 A;  3VV0 A;  3CC2 Q;  4QQG A;  4PFP A;  2X4X A;  1VQ8 T;  4ESR A;  5GAM d;  4D8K A;  1GCQ C;  2NUT B;  3OYF A;  1V1C A;  3HRT A;  4QVD A;  1B34 A;  2RQR A;  4J9F A;  2DIL A;  1KG1 A;  3QJ6 A;  3LX7 A;  5FLX E;  1X2K A;  2K57 A;  2RI5 A;  2OTL A;  3RR6 A;  1ZX6 A;  4M77 F;  4M75 G;  4OGE A;  1PSE A;  1UG1 A;  3V8J A;  1QKW A;  4J6W A;  4FSX A;  4HKE A;  2EKO A;  4J9E A;  2VXF A;  1VQ7 T;  1LVK A;  2KVQ G;  2HQX A;  1Y96 A;  4PJL A;  4GLK A;  1NEG A;  3UA6 A;  1Q95 G;  2RHY A;  1ZA2 B;  2FPD A;  1WJS A;  3VJP A;  3UWN A;  4QQ6 A;  4E2F B;  2DXT A;  1AVZ C;  1C1A A;  1D0X A;  1B7T A;  2X4W A;  3TSZ A;  2A08 A;  2EBP A;  1YIT A;  2M16 A;  1MNE A;  3JCM W;  1YI2 Q;  1D3B B;  3M0R A;  3I35 A;  4JRP A;  3NTH A;  1PD1 A;  2NLU A;  1VQN T;  2FRY A;  4RTW A;  2PU9 B;  4FT2 A;  2A36 A;  2BTT A;  3DLM A;  2LCC A;  3P8D A;  4N4I A;  4J7I A;  2DET A;  4PJM A;  3G4S T;  2OTJ T;  4C92 B;  2YUP A;  3CCE T;  4M78 D;  3EG0 A;  5FWC A;  5GAN 8;  5LJ3 d;  5I2S A;  2MI6 A;  3VKI A;  1WXT A;  4M7A D;  3OA6 A;  1OQK A;  2VB6 A;  4Z88 A;  1X2Q A;  5HK3 A;  2NUZ A;  1AT1 B;  3JAM E;  3OS1 A;  1GCP A;  2YXY A;  3QO3 A;  3MEA A;  4L59 A;  1KK7 A;  2BE7 D;  2VKN A;  1D09 B;  2QQA A;  2QAS A;  1Y0M A;  3LGF A;  3L2V A;  1MUZ A;  2ZZD A;  4C5E A;  2RH2 A;  1TUG B;  3QWY A;  3M54 A;  2DTI A;  3VS2 A;  2CSQ A;  5GAN g;  3QBY A;  2R57 A;  4QQD A;  3S3O A;  4RTX A;  3CC2 T;  2FPF A;  4KGZ B;  2EQU A;  3CME Q;  3ULR B;  3NHN A;  1N27 A; 
#chains in the Genus database with same CATH homology
 1K0S A;  2YUO A;  2FO0 A;  4HVW A;  2DX1 A;  1GFD A;  2EYX A;  1UDL A;  1BU1 A;  1UUE A;  2ECZ A;  2QDL A;  2EPD A;  3NPF A;  1GBQ A;  3TSW A;  4J9B A;  2C0O A;  2JM8 A;  2KYM A;  4RTZ A;  3IQL A;  1AZE A;  1M8M A;  4RTV A;  1JO8 A;  1VYT A;  3NMZ C;  2DMO A;  4LUE A;  1N5Z A;  3C0C A;  4RTT A;  1NG2 A;  2O9S A;  1NLO C;  1JU5 C;  2DBM A;  2RF0 A;  3M0Q A;  2CT4 A;  1VA7 A;  4F17 A;  1OPK A;  4CC3 A;  4LN2 A;  1GBR A;  2L0A A;  3I9Q A;  2RMO A;  1KJW A;  3U23 A;  1Z9Z A;  4AG2 C;  3VS4 A;  4HCK A;  2DL8 A;  2J6F A;  1J3T A;  4F14 A;  3REB B;  4OMQ A;  1TUC A;  4KRT A;  2E5K A;  2P4R A;  2SEM A;  1K9A A;  1CKB A;  3LH5 A;  2H8H A;  2JS2 A;  2C0T A;  2L3Q A;  4RUG A;  3RNJ A;  4OMN A;  1CSK A;  2A37 A;  4JPB W;  2EGC A;  1A0N B;  1YN8 A;  1U3O A;  5IXB A;  2L2P A;  2EYW A;  1G83 A;  3O5Z A;  1H92 A;  1OEB A;  1RLP C;  1PHT A;  2O9V A;  1SHG A;  2AK5 A;  2EKH A;  3RBB B;  4J9D A;  1UFF A;  5EC7 A;  1LCK A;  3JV3 A;  3M0P A;  4HVU A;  2KYB A;  1AZG B;  1H8K A;  2K9G A;  2KGT A;  3EGU A;  3I5S A;  2JTE A;  1JXO A;  2D8J A;  2B86 A;  4ZNX A;  3SHW A;  1HD3 A;  1ZUU A;  2LZ6 B;  5IH2 A;  2CRE A;  4AFQ C;  1K76 A;  1IO6 A;  1PNJ A;  2VWF A;  2L3S A;  2W10 A;  3VS0 A;  2EYY A;  3REA B;  2M0Y A;  1Z9Q A;  2DL4 A;  1W70 A;  1S1N A;  2ED1 A;  1SEM A;  1T3S A;  2CH4 W;  2DRK A;  2HEQ A;  1OV3 A;  3KFV A;  2X3W D;  2OJ2 A;  1E6H A;  4M4Z A;  1BBZ A;  4GBQ A;  2RPN A;  2CUB A;  2HBW A;  2FG0 A;  4AFS C;  1UEC A;  4J9C A;  2J6O A;  1SHF A;  1WX6 A;  4GLM A;  2DL5 A;  1PKS A;  1PKT A;  1KIK A;  2MOX A;  5IHN A;  1NM7 A;  1UJY A;  2OI3 A;  1QKX A;  5FWB A;  1UJ0 A;  2GBQ A;  2AZS A;  1T0J A;  4OMM A;  2O88 A;  1CKA A;  1PRL C;  2HCK A;  2FRW A;  3M0U A;  4FSS A;  3M0T A;  4AG1 C;  1NYF A;  1JEG A;  1T0H A;  1M3C A;  5GJW B;  1WXU A;  4ORZ A;  2L3P A;  2LQW A;  3H41 A;  4K11 A;  3VS6 A;  2F2X A;  1UHC A;  5ECA A;  1UHF A;  1I07 A;  1NEB A;  1W1F A;  2KNB B;  2KRS A;  2J6K A;  4OML A;  1M3B A;  2JT4 A;  5I22 A;  2M51 A;  2HDA A;  1KFZ A;  4A63 B;  2CUD A;  4E6R A;  1X6B A;  1VYU A;  5IHK A;  1QCF A;  3EHQ A;  1TG0 A;  4QT7 A;  2DA9 A;  2XMF A;  1T3L A;  2KE9 A;  4CC7 A;  2KR3 A;  1XOV A;  2DNU A;  1HJD A;  2CDT A;  2LJ0 A;  2KT8 A;  2K6D A;  2MIO A;  1ZSG A;  1X69 A;  1QLY A;  1MV0 B;  2YSQ A;  4J9G A;  1QWF A;  2DYB A;  2EQI A;  2HSP A;  2KRM A;  1RUW A;  2DL7 A;  2CSI A;  2GQI A;  1WDX A;  1OPL A;  2YT6 A;  1YWP A;  4Z8A A;  2AKL A;  4J9H A;  3VRY A;  5IXF A;  4OMP A;  2JMA A;  2LP5 A;  2W0Z A;  4X1V A;  2DM1 A;  4JJD A;  2RQU A;  4LE9 A;  4IIO A;  2D1X A;  2K3B A;  1UTI A;  1AWX A;  1ZUK A;  1B07 A;  2EGA A;  1HSQ A;  3I5R A;  2YDL A;  1NLP C;  4HVV A;  2G6F X;  4Y92 A;  2F2W A;  2JW4 A;  3UA7 A;  2PNI A;  2ED0 A;  1ABO A;  1FMK A;  2BZY A;  1WLP B;  2J7I A;  3VS1 A;  2I0N A;  1AWJ A;  1PWT A;  1W6X A;  2DRM A;  1GFC A;  2EW3 A;  4DEX A;  2LMJ A;  2ENM A;  3QWX X;  4AFZ C;  1M30 A;  1E7O A;  4JJC A;  1WIE A;  1ABQ A;  5I11 A;  1VYV A;  1TUD A;  2ROT A;  2RQV A;  2KXC A;  5L23 A;  1U06 A;  2ABL A;  1X43 A;  1YP5 A;  2D8H A;  3H0F A;  2CH4 A;  3VRZ A;  4JZ3 A;  1BB9 A;  2AKK A;  2RQT A;  1K1Z A;  1M27 C;  1K4U S;  2J06 A;  2RNA A;  2RQW A;  2GNC A;  3VS3 A;  2J05 A;  3GBQ A;  2PTK A;  1ZBJ A;  5FW9 A;  2DLP A;  4CC2 A;  3ZL7 C;  2GTO A;  3EG1 A;  3EHR A;  2DF6 A;  3PVQ A;  4ESR A;  1NYG A;  1E6G A;  2C0I A;  4D8K A;  1WFW A;  1JQQ A;  2DJQ A;  3VS7 A;  4Z89 A;  2LQN A;  4EIK A;  1GCQ C;  2EVR A;  1AWO A;  1V1C A;  1QWE A;  2EYZ A;  2CT3 A;  2RQR A;  4J9F A;  1FYN A;  1MV3 A;  2DIL A;  4LUD A;  3EG2 A;  1UGV A;  1X2K A;  1SPK A;  1I1J A;  1ZUY A;  1X27 A;  2BZX A;  1ZX6 A;  2D0N A;  2MCN A;  1U5S A;  2JXB A;  3EG3 A;  4DEY A;  2KT1 A;  1UG1 A;  2YUN A;  2KBT A;  1QKW A;  4J9E A;  3PE0 A;  1WA7 A;  2DE0 X;  4WCI A;  2K7A A;  2O31 A;  4IIM A;  2FPE A;  4AFU C;  1GRI A;  1NEG A;  2ESW A;  3UA6 A;  4R0K A;  3UF4 A;  2YUQ A;  4RTU A;  1SRL A;  2DBK A;  2FPD A;  3VS5 A;  2KXD A;  1AEY A;  1KSW A;  1UE9 A;  2FEI A;  2A28 A;  2LJ1 A;  1AVZ C;  2V1Q A;  4D8D A;  2RN8 A;  2O2O A;  3TSZ A;  3SEM A;  1M3A A;  2PZ1 A;  2A08 A;  1B3Q A;  2JMC A;  2EBP A;  1PRM C;  3FJ5 A;  1WYX A;  1BK2 A;  3TVT A;  2V1R A;  1SRM A;  2BZ8 A;  3I35 A;  3M0R A;  1OOT A;  2JM9 A;  2FRY A;  4RTW A;  3UAT A;  2A36 A;  2BTT A;  2K2M A;  4OMO A;  2AZV A;  1SSH A;  5HCK A;  2EGE A;  4CC4 B;  1I0C A;  2NWM A;  2LCS A;  1WI7 A;  2YUP A;  1AOJ A;  3EG0 A;  5FWC A;  2OAW A;  1EFN A;  3NGP A;  4HXJ A;  2GTJ A;  4LNP A;  2F2V A;  2X3X D;  3A98 A;  1WXT A;  2KEA A;  4RTY A;  2LJ3 A;  2SRC A;  4JZ4 A;  4F16 A;  1AWW A;  4Z88 A;  3PVL A;  1Y57 A;  1X2Q A;  1YCS B;  2KRO A;  3H0H A;  4J9I A;  3R6N A;  2NUZ A;  1WXB A;  2DVJ A;  2K79 A;  1GCP A;  5IHI A;  2KRN A;  2VKN A;  1JXM A;  1GL5 A;  1AD5 A;  1GCQ A;  1Y0M A;  1ZLM A;  2VVK A;  1MUZ A;  2DL3 A;  3M0S A;  1G2B A;  2GGR A;  2LX7 A;  1YWO A;  3H0I A;  3QWY A;  2LNH B;  3VS2 A;  2CSQ A;  4JJB A;  2IIM A;  3THK A;  1RI9 A;  1K0X A;  1RLQ C;  4RTX A;  2FPF A;  5GJV B;  1H3H A;  3ULR B;  2JS0 A;  3CQT A;  1X6G A;  3NHN A;  2ROL A;  1YNZ A;  1ARK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...