1Y0MA

Crystal structure of of the sh3 domain of phospholipase c gamma-1
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
61
structure length
61
Chain Sequence
TFKSAVKALFDYKAQREDELTFTKSAIIQNVEKQDGGWWRGDYGGKKQLWFPSNYVEEMIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase ga
publication title Crystal structure of of the SH3 domain of phospholipase C Gamma-1
rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 13
structure length 61
sequence length 61
ec nomenclature ec 3.1.4.11: Phosphoinositide phospholipase C.
pdb deposition date 2004-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1y0mA00
4Z8AA 2KRMA 2EGCA 3TVTA 3FJ5A 3VRYA 2JMCA 1UECA 2EGEA 4IIMA 4J9GA 4JJCA 1J3TA 3TSWA 1HSQA 2M51A 1JXMA 2BZYA 1U06A 2VWFA 3PVLA 4ZNXA 1PHTA 2CUBA 4JJDA 1B07A 2J6KA 4EIKA 2LQWA 1AOJA 1MV3A 2I0NA 5IHIA 2OI3A 2D1XA 1X69A 1TUCA 2RQWA 1QCFA 2GTOA 1BK2A 3VS1A 2X3XD 1UTIA 1ZBJA 1QKWA 1QWEA 2LMJA 2K2MA 4GBQA 1X6BA 1E6GA 2HBWA 4HCKA 2K7AA 1FMKA 3EHQA 1G83A 2LJ1A 2EYZA 2ENMA 2G6FX 1AEYA 3M0TA 2ROTA 2F2XA 1NYGA 4OMPA 1NLOC 5FWCA 2RF0A 3SEMA 2DNUA 2FPEA 1UFFA 3EGUA 2RQRA 1ZUUA 3M0SA 2CDTA 2BZ8A 4AFZC 1OEBA 1GCQC 2J6FA 2V1RA 2J05A 4Y92A 1ARKA 1WXUA 5IXBA 2AKLA 1M3AA 1ZUYA 2DMOA 1VA7A 2KE9A 1LCKA 1E7OA 3GBQA 2K3BA 2L0AA 2BTTA 2M0YA 4RTUA 2DL5A 2H8HA 4A63B 2JMAA 4J9EA 2C0TA 1JU5C 3TSZA 1SSHA 4LNPA 4F14A 2FPFA 4RTWA 2LZ6B 1BB9A 3QWYA 4Z89A 2CT3A 2RNAA 3C0CA 1GFDA 4RTYA 2YUOA 2AZSA 4JPBW 2L3PA 1TUDA 1W70A 3I35A 3LH5A 1RLQC 4FSSA 1WFWA 1S1NA 3VS2A 2QDLA 4OMMA 4JJBA 1QKXA 1JEGA 2L3SA 1KIKA 1Y0MA 1WLPB 1WIEA 1XOVA 2DRKA 2KYBA 2YUQA 2EYWA 3UA6A 3NMZC 2EVRA 2JS2A 1H3HA 1HJDA 5HCKA 3VS7A 1EFNA 4F16A 2FPDA 1ZX6A 3PVQA 1NG2A 4DEYA 2DL7A 2MIOA 2LJ3A 4X1VA 3R6NA 4J9IA 4ESRA 4RUGA 2J7IA 2O2OA 1KJWA 2ED1A 1PKSA 1E6HA 1X2KA 4CC4B 2A36A 3SHWA 1ZSGA 2JM8A 4HXJA 2FRYA 1VYTA 2DJQA 1I1JA 2LX7A 1UG1A 1M27C 2O9SA 2VVKA 2K79A 1T3SA 1UE9A 2L2PA 3EG1A 2W10A 1X43A 1SRMA 2C0OA 2EGAA 2KNBB 1UJYA 2K9GA 4LUEA 1V1CA 3RNJA 5IHKA 1M3BA 1OPLA 4IIOA 2DILA 1PRMC 1AZEA 3NPFA 1X27A 1ABQA 2MOXA 1YWOA 4J9BA 4DEXA 4OMQA 1GCPA 1NEBA 1YP5A 2KT8A 1SPKA 1GBQA 2DBKA 2LQNA 2K6DA 1AWXA 1ABOA 4J9FA 2CH4W 2E5KA 1RI9A 4RTXA 3ULRB 4D8DA 4E6RA 3EG0A 2ECZA 3H0FA 2CH4A 3M0RA 1W1FA 1NYFA 2YDLA 1JXOA 1M3CA 3PE0A 2CT4A 2ROLA 2ED0A 3RBBB 2LJ0A 1PWTA 1T0HA 2EYYA 2FRWA 3H0IA 2DA9A 2DF6A 3JV3A 4D8KA 2CSIA 2CUDA 2AK5A 2D8HA 4LE9A 2F2VA 2O31A 2FEIA 2DBMA 4AG1C 3VS3A 3UA7A 1FYNA 2JM9A 3UF4A 2JT4A 2DVJA 5EC7A 1ZUKA 1CKAA 1IO6A 1AVZC 1KFZA 2DL4A 1A0NB 2LP5A 2P4RA 2DLPA 2LNHB 2JS0A 2KRNA 2EBPA 1GRIA 1I07A 2DYBA 5IH2A 1SHFA 2KEAA 3A98A 4AFUC 1T0JA 1WXBA 3THKA 2KXDA 2J6OA 2KR3A 1WDXA 3CQTA 2BZXA 1OOTA 2VKNA 1KSWA 1WYXA 3VRZA 2MCNA 4AG2C 3REBB 3U23A 1SRLA 4QT7A 2A08A 3VS0A 2DL3A 2YT6A 3ZL7C 1GCQA 1UHFA 2SRCA 1HD3A 1BU1A 3H0HA 1CSKA 1YCSB 4LN2A 5GJWB 1JO8A 4KRTA 2KYMA 1AWWA 5IHNA 1OPKA 2KRSA 5GJVB 2DL8A 2FG0A 1H8KA 1N5ZA 2RN8A 2HCKA 3O5ZA 1UDLA 1AZGB 1X2QA 2KXCA 1K0XA 1SEMA 1PNJA 4ORZA 2YSQA 2RQTA 4M4ZA 2PTKA 3EHRA 1QLYA 2RQUA 1OV3A 3EG2A 1BBZA 4J9CA 2D0NA 2RPNA 4HVUA 1K4US 2KROA 3M0PA 3EG3A 1UHCA 1YN8A 4HVWA 2DM1A 2DRMA 3H41A 4F17A 3VS6A 4Z88A 2HDAA 1M8MA 2HEQA 1M30A 2KGTA 4OMLA 1K76A 5ECAA 2O9VA 2EW3A 2RQVA 2GBQA 3M0UA 2O88A 1K9AA 1NLPC 2B86A 2XMFA 1T3LA 1RLPC 4LUDA 2EKHA 1WI7A 4J9HA 4R0KA 2KBTA 4RTZA 3QWXX 5FW9A 4RTVA 2PZ1A 1QWFA 1UUEA 2JW4A 2D8JA 5IXFA 4J9DA 1G2BA 5FWBA 2GTJA 2EPDA 1WX6A 3NHNA 1GFCA 2L3QA 2J06A 5L23A 2JTEA 2YUPA 1W6XA 4OMOA 2HSPA 2PNIA 5I11A 3REAB 5I22A 2DX1A 1GBRA 1NM7A 1H92A 1CKBA 1VYUA 1YWPA 4K11A 3UATA 1TG0A 1U3OA 1YNZA 4WCIA 1WA7A 1AWOA 2F2WA 1PKTA 2ABLA 2DE0X 2EYXA 4JZ4A 4CC3A 2NWMA 1MUZA 2ESWA 3VS5A 2GGRA 1Z9ZA 1UJ0A 1MV0B 1PRLC 2AZVA 2KT1A 1K1ZA 4HVVA 1JQQA 1U5SA 2OAWA 4CC7A 1SHGA 2A37A 4OMNA 2FO0A 4AFSC 2OJ2A 2IIMA 3IQLA 2W0ZA 4GLMA 2X3WD 2GQIA 2SEMA 1UGVA 2AKKA 1I0CA 2JXBA 2CREA 2GNCA 3VS4A 2A28A 1Z9QA 3I5RA 4AFQC 1X6GA 1NEGA 3NGPA 3I9QA 2CSQA 1Y57A 3KFVA 2LCSA 2NUZA 1K0SA 1WXTA 1RUWA 1AD5A 2V1QA 1B3QA 2EQIA 4RTTA 3I5SA 2C0IA 1VYVA 1ZLMA 2YUNA 3M0QA 1GL5A 4JZ3A 2RMOA 4CC2A 1AWJA
chains in the Genus database with same CATH superfamily
1W4SA 3LLRA 1VQ7Q 1VQ6A 1Y96A 4FL6A 1D1CA 3M4YA 3CCST 1K73C 3BY7A 1MMNA 2CZ6B 2H3EB 1V76A 2I2LA 2WSFE 4QQ6A 1G5VA 3JCMW 3I56Q 4PJNA 1SKUB 1QVPA 1G8XA 4ZNXA 1RACB 1ACMB 4P5NA 2J6KA 4BB7A 3GF5A 2I0NA 5IHIA 1IGQA 4RCCA 2K2VA 2DPPB 4KBMB 4XTWA 5DM7R 1QCFA 4KH1B 3UWNA 1UGPB 2RK2A 2F69A 2X51A 5GAN4 3ASKA 1OQKA 2CP6A 2MI6A 1E6GA 2HBWA 4HCKA 1C6VX 2K7AA 3D7SB 2V26A 4PJOG 2E6ZA 1VQ9T 4NOYA 2DTOA 4FYYB 2COWA 3CMET 2QQAA 1NLOC 2ZPFB 3SEMA 2DNUA 1VQ6Q 2WACA 4HCZA 1UB4A 2NYSA 1XQHA 2P84A 1PSEA 1GCQC 1QMCA 3META 2V1RA 2J05A 3G4SQ 4LD9K 1WZOA 1ARKA 5IXBA 2GCXA 2AKLA 3SWNC 2DMOA 2X9HA 2HKQB 2ZPEB 4PJMA 2L0AA 2COYA 1HK9A 1QVFA 2ZPIB 2QYZA 3UT1A 3PMIA 2ZPHB 5GANf 1OULA 4FT2A 4ZGDB 1YITQ 1BB9A 2CT3A 4M75D 2RNAA 1YJ9A 4RTYA 2AZSA 4FSSA 1WFWA 2Y90A 1TS9A 3VS2A 4JJBA 4DBRA 3CC4Q 1QKXA 4C8QA 1XOVA 4M78E 4GY5A 3UA6A 1H3HA 4PL6A 3M55A 3KXTA 5HCKA 3VS7A 3V8JA 1M1FA 2FPDA 3C12A 4DBHA 1WJSA 2RI5A 5DY9A 4BUGA 4J5YA 1KD1R 2QGGA 3R6NA 4J9IA 4IKFA 5GAMh 2J7IA 2XD0A 2R5AA 1KJWA 3QSUA 2M02A 3SHWA 3SDZA 4HXJA 1IZ6A 2LX7A 3LGLA 3LYIA 5CVIA 2NUTA 3CMAT 2K79A 1Q81R 3MCAB 2HQEA 3CCQQ 1LPLA 1SRMA 3LW5E 2C0OA 4FIBA 2EGAA 2K9GA 4KULA 1RAIB 1V1CA 3T9NA 2CP5A 4BI4A 1YJ9Q 4X9CA 1M3BA 1RAGB 1NE8A 2DILA 1PRMC 1VQNA 1ABQA 3QZ5B 4J9BA 1VQ5T 1VQ4A 2DD5A 1ZSZA 2K6DA 4O6JA 1AT1B 2E5KA 4JRQA 4ANJA 4PNOA 2EKOA 2QGFB 4FYVB 3H0FA 2CH4A 5FLXE 4E7ZA 3QJYA 2RI3A 3TQ7P 1M3CA 3TEEA 3CCLQ 2CT4A 1M1KR 2ROLA 4M7AD 2BIVA 2EYYA 4OB3B 1C1AA 2DYIA 2K57A 2JTMA 4II1A 1WHHA 1D0XA 3EG9A 1I5OB 1DJ7B 2D8HA 3P8BB 2EIFA 3JB9J 1VQKT 3MKDA 3E1SA 4Z02A 1MHNA 2O31A 4F7UE 1NJIC 3VS3A 3UA7A 1Q7YU 1FYNA 1PM3A 4E7JA 1X75C 3NFCA 2JM9A 3OBWA 6AT1B 1IXDA 1CKAA 2VXFA 2YRDA 1PCXA 4LDWA 2DL4A 2DKGA 1FMWA 3JCMd 3OYIA 2GF7A 1SHFA 3X28B 2KEAA 2KXDA 3E2UA 2KR3A 1WDXA 3BDUA 3H8ZA 2LT4A 5KYUA 3CQTA 3OYAA 1WYXA 3G71T 4TVRA 3U23A 4QT7A 2A08A 1NBEB 5IN1A 2BUDA 3VS0A 1GCQA 4LDVA 5GJWB 3URGA 1M4ZA 1JO8A 5HK3A 4EMKB 3M56A 4C92D 2DL8A 3OYNA 4KT0E 1H8KA 4ZGEB 2MPXC 1N5ZA 2H3JA 2RN8A 2E1HA 2KMTA 1X2QA 1YJNA 1VQ7T 1N9RA 3CCVA 5DLOA 4C8QB 2EFIA 5GMKh 3CCEQ 2CP3A 1B34A 3M0PA 3EG3A 4ATOA 3L2WA 3P8HA 1D09B 3VS6A 2HL5C 4XTZA 1M8MA 4PJOE 5CKEA 5I2SA 4BACA 4ZTJA 5FRNA 4C8QD 1KK7A 1SF9A 3G6EA 2HAXA 2HNIA 2NUTB 1WI7A 4A54A 5FW9A 2PZ1A 2KI7A 3M58A 2Y4XA 1G2BA 2E3HA 3J7AF 5KYXB 3NHNA 2L3QA 2J06A 5L23A 2OTJA 5KYWA 3MP6A 1S72A 1SG5A 1VQOA 3ZBDA 5I22A 1ZSZB 4XAXB 1VQLA 3MEAA 3G4ST 1FWZA 2A3LA 1JRIA 1U3OA 1FMVA 4XQ3A 2M9UA 1QW1A 1WA7A 2XDBA 2DE0X 1KG1A 4QVDA 4ELYC 2ESWA 2GGRA 1Z9ZA 4N4IA 1K1ZA 1KQ1A 1VIEA 4CC7A 1YITT 1SHGA 3E19A 1Q82U 4WF2A 1Q95G 4E7HA 2OJ2A 3EG9B 4GLMA 3G6EQ 3BFMA 2ZCFB 3HPWA 2YWWA 1UGVA 5KYYA 2JXBA 4HCBA 3CCMA 3CC4T 1ZBXA 4C8QG 5GAOn 3C4SA 3JCMc 3I9QA 1N9SA 4FW2A 2CSQA 2OTJQ 1VOMA 3CC2Q 1S72Q 3KFVA 2LCSA 1RUWA 3JCMe 3CXCS 2V1QA 3MJXA 2RJDA 3I5SA 3OYEA 1VQLQ 4C5GA 3M0QA 4CC2A 1D1AA 2FZKB 2ZPBB 2KRMA 2NUPA 2DZCA 1I5LA 3TVTA 3LX7A 4J83A 3FJ5A 3VRYA 2JMCA 2HBPA 4FSXA 5KYUB 1J3TA 2QEXT 1Y71A 4ZN3A 4M75E 1JXMA 3EAEA 3CCQT 1Q81C 2VWFA 2QAZA 5LJ3h 5GMKl 3OYBA 1PHTA 5GMKm 2E12A 2CUBA 2LQWA 1AOJA 9ATCB 4KGZB 1VQ8A 2D1XA 1X69A 4MZTA 5CQXA 2FL7A 4XTXA 1BK2A 3PFSA 3VS1A 2X3XD 1UTIA 1QKWA 2LMJA 4JRKA 1X6BA 1FMKA 3EHQA 1G83A 2QA4A 4OB2B 2EYZA 2ENMA 1BI2A 4UC4A 1AEYA 2QXFA 2ROTA 1NYGA 3OSSC 2LC4A 4M78F 1B34B 1KC8C 3GLXA 3CCLT 4XU1A 2RF0A 3HHTB 1KHCA 3M53A 1JJ2S 1XJWB 3EFRA 2CDTA 5GAOp 4LDUA 2LDMA 2YXYA 5LL6S 1OEBA 2OTLQ 4Y92A 2RHIA 1WXUA 3OMGA 1R8OB 4B9XA 1M3AA 2V8IA 4JS4A 2GFAA 1K8AU 3CXCP 4M78C 3CC7A 1E7OA 4RKUE 4C0ZA 1RAFB 2ATCB 2BTTA 4RTUA 3HKSA 4MDWA 1YJWA 1VQ8Q 2PUOB 3TSZA 5D6WA 4LNPA 4F14A 2XU8A 4RTWA 2XDDA 1BYMA 3QWYA 5KCHA 3TCJA 5C6SA 5KYWB 4DOVA 5M9OA 3O8VA 1UGRB 1M2OA 8ATCB 1S1NA 2QA4Q 4ZN1A 4JS5A 4M7AE 2YUQA 3PIOA 2EVRA 4ELZC 2PU9B 1QP2A 3N5BB 3OYFA 1HJDA 3OS2A 5KE3A 4F16A 1IRXA 3L2ZA 2M1HA 3FRNA 3DLMA 3OW2A 2MIOA 4CI0C 4X1VA 2PVOB 3LH0A 2O2OA 1RAHB 1M2VA 4C0DB 1YBYA 5GANd 2ED1A 1PKSA 1X2KA 3HTRA 1Q7YR 1WHKA 2XK0A 1IREB 2EJGA 3L2UA 4RG2A 1M27C 5KYYB 5GMKi 1BI0A 1T3SA 2L2PA 4YTLA 2W10A 2D0QB 2HQXA 1K8AC 4F7UF 4Y28E 3CCET 5GANj 2KNBB 4LUEA 1TH7A 5CKBA 3CBPA 3INZA 1OZ2A 3J81E 4MZPA 3QIIA 3M5AA 3NPFA 1X27A 3OQ5A 5DLQE 1YI2A 2MOXA 4OMQA 4BI8B 3QDFA 1GCPA 1NEBA 4NL2A 5GAOq 1X6OA 5CO7A 3CCUT 1Q86U 1D0ZA 1KQSP 2MMPA 3CD6A 1RABB 4N4GA 2NUPB 1WPYA 1NYFA 3ZFJA 5GAMg 3JCMh 4KH0B 4C92E 3MEVA 5AYFA 2LJ0A 2B8AA 2EJ9A 3OW2P 1Y07A 2DA9A 3BW1A 4D8KA 4GLKA 1B7TA 4LE9A 3RKXA 2FEIA 2EAYA 1QVFS 3G1JA 1MGQA 4A4FA 1ZUKA 1IHVA 5I21A 3MEUA 1IO6A 1O9SA 1M90U 4V2SA 2KY9A 4KUDK 1MNEA 2LP5A 4XTYA 2P4RA 4NS5A 2KRNA 2EBPA 3CD6Q 7AT1B 3OYDA 3OS1A 2Z0WA 4BE1A 4AFUC 4XTVA 1WXBA 2J6OA 1V29B 2WSEE 4BE0A 1OOTA 2VKNA 2RK1A 3I55T 3VRZA 2MCNA 3SFMA 4AG2C 2LNVA 1SRLA 3ER0A 5FU6C 2CYZB 2OTJT 3CC2T 3ME9A 3ZL7C 1S72T 1UHFA 4QW2A 2SRCA 4L6V5 1HD3A 5CKFA 1K9MU 1YCSB 3CBMA 4B9WA 4KRTA 2KYMA 4J6WA 1ZA2B 4IURA 5LJ5g 4M78A 1PG5B 5IHNA 1OPKA 5GAN8 2DERA 3GNFB 2DETA 1QCOA 2VV5A 4A4HA 3OA6A 4FYXB 2HCKA 3O5ZA 1AZGB 2X35A 2KDSA 2P4TA 3OYYA 3CCRA 1K0XA 4OGEA 3DKMA 1SEMA 1PNJA 4ORZA 1R0CB 3UPUA 1UGSB 5KE2A 2PQWA 1HXDA 3EHRA 1QLYA 4PFOA 2RQUA 4A4GA 3OYCA 5GANe 2MK5A 1OV3A 2CS7A 2RPNA 1YN8A 2X4YA 1R77A 2DXCA 3H41A 4F17A 3JB9I 3SD4A 2HEQA 1YHQT 1M30A 3M9QA 1TOVA 2QK0A 1Y96B 3FB9A 1K76A 5ECAA 1M2VB 5GAOm 4C0DC 4J6YA 3S3MA 2AIRB 1KC8R 3JCMX 2V8JA 2XMFA 1RLPC 4LUDA 3QWXX 2EWNA 1UUEA 2AHJB 1WJRA 4AMCA 2LQ8A 2GTJA 1HYOA 1GFCA 3QYGB 2JTEA 2YUPA 4OMOA 2HSPA 5CR2A 2E65A 2GFUA 5I11A 4BI3A 3JCMV 3CCRQ 4OB1B 2JZ2A 1LNXA 2OTLT 4OB0B 4K11A 5KH6A 1VQNQ 1YNZA 4M7DE 1VQ4Q 1AWOA 2LCCA 4JZ4A 3V7SA 2NWMA 3EFSA 4LXCA 3CCSA 2K4YA 2EQJA 2HMAA 1UJ0A 8AT1B 4F7UA 3UDCA 4DA4A 1FX7A 2DEQA 3HL8A 2KVQG 3PMTA 3V7CA 4M77E 2IIMA 3CPWS 5KCOA 2W0ZA 4X34A 2SEMA 2RHUA 1FXXA 4M7DA 2CREA 2GNCA 1PD0A 2PUKB 1TTHB 2BE9B 4M75C 4E2FB 3EGDA 1W2BS 1KQ2A 1WQWA 2C0IA 4BE2A 1ZLMA 1VQ9A 2YUNA 1QP3A 4JZ3A 2RMOA 3CPFA 4NL3A 5GAN7 1AWJA 3CMEA 1K8AR 2K5IA 1MMAA 3HSBA 4J7IA 3FDRA 2ZPGB 2EGCA 2XG8D 1N8RU 1UECA 1VQPA 1Q7YC 4IIMA 1TWBA 2K3XA 1C0MA 3CCJA 3I56T 4RCBA 2BZYA 1U06A 1YCYA 2JVVA 2RM4A 1QVGS 4EIKA 4MDXA 5HY6A 2IPOB 2MWPA 4KGVB 4M78B 1TUCA 2RQWA 2VC8A 2GTOA 3A8GB 3CEYA 1U1SA 2K2MA 1TU0B 1MMDA 1LOJA 5J26A 4C0GA 2LJ1A 4XU3A 4CRIA 4XK8E 3M0TA 4F04B 4PJOA 4QQDA 1VQ9Q 1YFNA 2OAUA 1I8FA 2EQMA 1M8VA 3J80E 5GAMd 1YJNQ 5FWCA 3CMEQ 4R56A 1VQ6T 1NPPA 3CCVQ 3AHUA 2FPEA 2X4JA 4M78D 3EGUA 2RQRA 3M0SA 1RAAB 3V8LA 1VQPQ 5CCAA 4AFZC 4QKUA 3HRTA 2J6FA 1W2BP 1TXQA 3CCJQ 1KD1U 5LJ3g 5GAMj 4HCCA 3JSCA 3GP8A 2ZGWA 2K3BA 5GANh 1N8RC 4A63B 2JMAA 1JB0E 4J6XA 2C0TA 3CMAA 1JU5C 5EG2A 1OYXA 4EMGA 1Q86R 2EQKA 3JCMP 3GNGA 1WHJA 2COZA 2RH2A 2YUOA 3A5ZB 1W70A 4HT9A 3LH5A 2QDLA 4OMMA 1VQ5A 2L3SA 1KIKA 1Y0MA 3HFNA 2DRKA 2KYBA 4PFZA 2EYWA 1VQOQ 3NMZC 4HA8A 1QVGP 2EQUA 2KSSA 2QQSA 3EH1A 3PVQA 3M57A 2CZ0B 4DEYA 1Y7XA 2O4XA 4F7UB 3EH2A 3OBYA 3NTHA 4R55A 4M78G 1BCMA 2QQRA 3CXCA 1E6HA 2A36A 3OSVA 1M1KU 5LJ5d 5L8RE 1ZSGA 3RMSA 3NTIA 1VYTA 2DJQA 5GAMf 1UG1A 2VGMA 2O9SA 3S3OA 2DIQA 1UE9A 1GXIE 3CMAQ 4KUIA 4BY6C 1VQKA 1X43A 4HT8A 1M90R 4OGCA 1UJYA 2DXTA 1YJ9T 2LQKA 3EGDB 2XI9A 3OB9A 5LJ5j 2QTXA 5FROA 3CCMQ 5CAIA 1U1TA 3OS5A 2FB7A 2MF2A 2ZZDA 4DEXA 1Q82C 1SPKA 3QJ6A 1BIBA 2X4WA 4N0AA 1AWXA 2CH4W 4M75A 4RTXA 2DFUA 3ULRB 1M1GA 4D8DA 4E6RA 3H6ZA 3H9NA 3EG0A 2ECZA 1KHIA 3DLLA 1RL2A 4E7LA 4RMOA 2FVUA 2RB6A 5A2QE 5A0DA 1PC0A 3L2VA 1JXOA 2DJZA 5FU7C 5HK0A 2ED0A 4WTOB 1PWTA 1T0HA 2CZ1B 3G71A 2FRWA 1OI1A 4C5IA 3RUXA 2P0PA 3EGXA 4IUVA 2CSIA 3VKIA 2CUDA 1RAEB 4ME7A 3MP1A 2F2VA 2DBMA 4FW1A 5GAMe 1K73U 5FU6B 4AG1C 1WQ7A 4PLIA 1XNIA 2VXEA 1VQNT 2NLUA 2JJ9A 1VQ4T 2WSCE 3L1AA 2FYKA 5EC7A 5LJ5f 1VQ7A 2IG0A 4D6WA 4A53A 5GMKj 3PTAA 1KFZA 5AT1B 2DAQA 1A0NB 2DXBA 2LNHB 4F7UG 1KQSA 2JS0A 1I07A 2DYBA 4QVCA 3JCMg 3HP9A 2LX9A 3A98A 4Y91A 3A1PA 4JUVA 4Q5WA 3VYHB 1G3TA 3QXEB 2RJEA 2HKNA 3LWIA 4OF1A 1UEBA 1G3WA 1D0YA 4X9DA 5GAN5 3G71Q 3V7RA 1BU1A 3H0HA 5J3BA 1CSKA 2ZAEA 3CC7Q 3LGFA 4M7AA 1AWWA 2E4HA 1VQMA 2KRSA 5GJVB 3HRUA 3JB9F 2FG0A 3MEWA 4XU2A 1UDLA 1YJWQ 2KXCA 2CKKA 1OU9A 1JJ2P 2QI2A 2RQTA 2CP0A 2PTKA 4C5EA 3MHXA 2JOYA 1BBZA 3EG2A 3G4SA 5LJ5e 2QASA 2KROA 4M7DF 1G3SA 2VASA 4HVWA 2DM1A 1H641 2O4XB 2HDAA 2MAMA 5CQYA 2YLCA 5GAN2 2RHYA 2EW3A 3L2RA 2RQVA 2GBQA 1K9AA 1YITA 3M59A 3DB4A 4M77F 2B86A 4IUUA 4FT4A 4FYWB 2EKHA 4M7DC 3HRSA 2E3IA 2KBTA 4RTZA 2QG9B 3X26B 4RTVA 1QWFA 2D8JA 5IXFA 4JRIA 1NZ9A 4JJNK 4PJJA 1VQMQ 3CC4A 3ZEHA 3VV0A 2RHXA 2HL3A 2LCLA 1YJNT 2PNIA 1H3ZA 2CP7A 4M77C 3CCVT 2Y4YA 1GBRA 1NM7A 1N8RR 4PK4A 4BDZA 1H92A 1CKBA 1VYUA 1TSFA 4C92A 4M75B 1VQPT 2RHZA 3RERA 1YWPA 3CBOA 2XHCA 3UATA 1TG0A 3CCJT 1BKBA 1YI2Q 2E41A 4ZTFA 1PKTA 5LJ3d 3A8HB 1VIFA 4BD3A 4C8QE 5GMKe 1PRLC 2QEXA 2AZVA 5D6XA 1U5SA 3VJPA 2X4XA 4OMNA 3CCQA 3G7ZA 3G6ET 3EGXB 4EMKA 4IUPA 2G3RA 2F5KA 5CIUA 5LJ3j 2X3WD 3C94A 2R5MA 1Q86C 2GQIA 4PJOF 3KUFA 1Z9QA 3I5RA 4AFQC 1X6GA 1BI1A 1NEGA 3OYKA 3NGPA 2MYSA 1EZZB 3OY9A 1VQOT 1Y57A 2LTOA 2PVDB 1K0SA 1WXTA 2HD0A 1AD5A 1B3QA 2EQIA 4RTTA 1ZQ1A 2CP2A 4PJOC 1VQLT 4ZGJB 4LDYA 2FZGB 4IUTA 3OYGA 2RJCA 1D1BA 1JBMA 1GL5A 2CGHA 3L2QA 2HZYA 1OZ3A 3OYJA 3CCLA 3FIFA 2E64A 4Z8AA 5GAOr 1OU8A 2KQWA 5A0GA 3QO3A 1NJIU 3X25B 2DIGA 1WJQA 2EGEA 4J9GA 4JJCA 3TSWA 1HSQA 2M51A 2YLBA 2QEXQ 1Q82R 4EPCA 3PVLA 5CKHA 2EYQA 1M90C 1QVFP 5KYXA 4JJDA 1B07A 5GAOl 1MV3A 1NPRA 1UGQB 3CCMT 2OI3A 2VYTA 5LJ3f 4M7AB 3WVEB 2R57A 1ZBJA 1QWEA 3SB2A 2QTVA 2VGNA 4GBQA 4M75G 4HKEA 5GAN3 4DBQA 3PIPA 2L8DA 1ZHIA 3R6OA 2G6FX 3RKWA 2F2XA 1YIJA 3PNWC 2XICA 4OMPA 3QUIA 4XTUA 4OP0A 1K9MC 5D6YA 3GIBA 2QQ9A 1UFFA 1ZUUA 1MNDA 2A0FB 2BZ8A 2XKOC 4XU0A 5C0MA 1QCNA 1ZUYA 1VA7A 2KE9A 1LCKA 3GBQA 2BKDN 2L89A 2M0YA 1WHMA 2DL5A 5LJ5h 3HFOA 2H8HA 1VQ8T 2VB6A 4J9EA 4M75F 2D9TA 3OYHA 3BDLA 1SSHA 3TREA 2FPFA 4J7FA 2LZ6B 4PLLA 2D6FA 4Z89A 2F1LA 3CCEA 2DTIA 2E6NA 2JTFA 3C0CA 1GFDA 1D3BA 5LJ3e 4JPBW 2QA4T 2L3PA 1TUDA 3I35A 3MPUB 1RLQC 4MZMA 4BY6B 4EDUA 5GAN6 2K3YA 4JLGA 1JEGA 1ZA1B 4C92B 4N0AC 1WLPB 1WIEA 1YIJQ 5D7UA 3CPWA 2JS2A 3CCUA 4A4KA 2MWOA 4E7KA 4E7IA 3QZ9B 5CK9A 3RMQA 4M77A 1EFNA 1AHJB 2DK3A 1ZX6A 1NG2A 2DL7A 2LJ3A 4ESRA 4RUGA 4QVZA 1W2BA 3CC7T 5GANg 4M7AG 3KBGA 5KYNA 1K73R 3SWNA 4CC4B 3CCSQ 1WGSA 2DD4A 3VYGA 2JM8A 2FRYA 1I1JA 5FU7B 4N4HA 1YJWT 2VVKA 3EG1A 4J8OA 1PSFA 4FU6A 1I4K1 3JCMJ 3RNJA 5IHKA 1OPLA 1RI0A 4IIOA 2DTHA 1AZEA 3TU4K 1YWOA 4VUBA 2RD1A 1YP5A 2KT8A 2QDYB 1GBQA 2DBKA 2LQNA 1ABOA 4J9FA 2VUBA 3EFOA 1IHWA 1RI9A 3RR6A 3CCUQ 1QVGA 2QQBA 2DEUA 2RA2A 2CZ7B 4PFPA 2DZ9A 3JAME 1OX9A 3FJPA 3M0RA 4AT1B 3OYLA 3CPWP 3E9GA 4M7AF 1W1FA 2KAFA 3LWHA 1WHGA 3JRZA 2K5LA 2YDLA 3PE0A 3M54A 3S6WA 3RBBB 4EMHA 3QKJA 3I55A 3JCMf 1VQMT 3OS0A 3VUBA 3H0IA 5A0LA 2YHTA 2DF6A 3JV3A 5IAYA 3CC2A 4C5HA 2AK5A 4LDXA 4M7AC 2LRQA 1O75A 4L5GA 2XIDA 1TUGB 4O5VA 4C92G 2YRCA 3JCMQ 2HQHA 4E7SA 3FEOA 3GPLA 3UF4A 1YI2T 2JT4A 2DVJA 2DO3A 1Q81U 2PVGB 1U8RA 1I81A 4KGXB 1AVZC 3OYMA 4E47A 2DLPA 1N27A 3CD6T 5HKCA 2HSEB 1GRIA 4L59A 1BI3A 5IH2A 3C95A 2DVEA 3VUZA 2F5TX 1T0JA 3THKA 2V8KA 1YHQA 3A8OB 2BZXA 1KSWA 3MO8A 2E70A 3QG1A 1R0BG 4DBFA 3I55Q 3REBB 2DL3A 2YT6A 3QBYA 1KC8U 4C92F 4BDYA 4LN2A 2JUFA 2O01E 2GQVA 3FLGA 5I2MA 1D3BB 4M7DB 5CKDA 1BIAA 1KD1C 3JB9D 2EJFA 4C92C 4OMFB 2YSQA 4M4ZA 4DQ2A 5IT9E 4FCYA 2JNGA 2OTLA 1F1BB 4J9CA 4M77B 2D0NA 4HVUA 1K4US 3QHSA 4FM4B 1UHCA 2E5QA 1VQ5Q 1SSFA 3S3NA 4RG8A 2DRMA 3X24B 3L42A 4Z88A 4C0FA 3P8DA 4JRPA 1LJOA 4M7DD 2KGTA 4C8QF 4OMLA 1YHQQ 5FRMA 2C06A 2O9VA 1IB8A 3SWNB 1BCOA 3M0UA 2FHDA 4EMKC 2O88A 3MP8A 3E9FA 2KK4A 3M4GA 1NLPC 2IVWA 1K9MR 1T3LA 2XDPA 4JDSA 4R0KA 4J9HA 4PJLA 4B6MA 1EX4A 3RKYA 2JW4A 3JB9H 3DB3A 4M77D 1OX8A 4J9DA 2A7YA 1M9SA 5FWBA 3OMCA 2EPDA 1WX6A 4C8QC 3A8MB 1PD1A 1W6XA 3V8KA 3PGGA 1VQKQ 3PT9A 4IUQA 3CCRT 3REAB 2DX1A 1NJIR 2OX7A 1JJ2A 1M1KC 2LVMA 3WXMB 4QQGA 3EFOB 1IGUA 2FZCB 3JCMb 4A4EA 3NTKA 3JB9G 4MMLA 4WCIA 3WVDB 2F2WA 2ABLA 2EYXA 4PJOB 1LVKA 1QQJA 1RADB 3QPHA 2AT1B 4CC3A 1X01A 3RIRA 4JLIA 1MUZA 3VS5A 3F70A 2R58A 1KQSS 1MV0B 2KT1A 2LT1A 2M0OA 1G3YA 4OVAA 1JQQA 2P0KA 4HVVA 3RESA 2OAWA 3I56A 2A37A 4AFSC 2FO0A 3QYHB 1M5Q1 3IQLA 3X20B 4MMKA 2L3RA 3VU3C 2K5FA 4M7DG 2AKKA 1I0CA 3BE3A 3QDRB 3VS4A 2A28A 1XTDA 4DOWA 3Q1JA 1P92A 4PJOD 3AT1B 1ZSZC 3OW2S 1YIJT 1WNLA 2DXUA 1MMGA 1N6AA 2BE7D 4LD6A 5J39A 2NUZA 3GOXA 1EIFA 4M77G 2RJFA 4PKCC 2RO0A 2L5QA 1WHLA 2YRVA 1VYVA 3A8LB 2RI2A 1VUBA 3FC3A 3RDVA 2M16A 2JN0A 2E10A 2P0QA
chains in the Genus database with same CATH topology
4Z8AA 2KRMA 2EGCA 3TVTA 3FJ5A 3VRYA 2JMCA 1UECA 2EGEA 4IIMA 4J9GA 4JJCA 1J3TA 3TSWA 1HSQA 2M51A 1JXMA 2BZYA 1U06A 2VWFA 3PVLA 4ZNXA 1PHTA 2CUBA 4JJDA 1B07A 2J6KA 4EIKA 2LQWA 1AOJA 1MV3A 2I0NA 5IHIA 2OI3A 2D1XA 1X69A 1TUCA 2RQWA 1QCFA 2GTOA 1BK2A 3VS1A 2X3XD 1UTIA 1ZBJA 1QKWA 1QWEA 2LMJA 2K2MA 4GBQA 1X6BA 1E6GA 2HBWA 4HCKA 2K7AA 1FMKA 3EHQA 1G83A 2LJ1A 2EYZA 2ENMA 2G6FX 1AEYA 3M0TA 2ROTA 2F2XA 1NYGA 4OMPA 1NLOC 5FWCA 2RF0A 3SEMA 2DNUA 2FPEA 1UFFA 3EGUA 2RQRA 1ZUUA 3M0SA 2CDTA 2BZ8A 4AFZC 1OEBA 1GCQC 2J6FA 2V1RA 2J05A 4Y92A 1ARKA 1WXUA 5IXBA 2AKLA 1M3AA 1ZUYA 2DMOA 1VA7A 2KE9A 1LCKA 1E7OA 3GBQA 2K3BA 2L0AA 2BTTA 2M0YA 4RTUA 2DL5A 2H8HA 4A63B 2JMAA 4J9EA 2C0TA 1JU5C 3TSZA 1SSHA 4LNPA 4F14A 2FPFA 4RTWA 2LZ6B 1BB9A 3QWYA 4Z89A 2CT3A 2RNAA 3C0CA 1GFDA 4RTYA 2YUOA 2AZSA 4JPBW 2L3PA 1TUDA 1W70A 3I35A 3LH5A 1RLQC 4FSSA 1WFWA 1S1NA 3VS2A 2QDLA 4OMMA 4JJBA 1QKXA 1JEGA 2L3SA 1KIKA 1Y0MA 1WLPB 1WIEA 1XOVA 2DRKA 2KYBA 2YUQA 2EYWA 3UA6A 3NMZC 2EVRA 2JS2A 1H3HA 1HJDA 5HCKA 3VS7A 1EFNA 4F16A 2FPDA 1ZX6A 3PVQA 1NG2A 4DEYA 2DL7A 2MIOA 2LJ3A 4X1VA 3R6NA 4J9IA 4ESRA 4RUGA 2J7IA 2O2OA 1KJWA 2ED1A 1PKSA 1E6HA 1X2KA 4CC4B 2A36A 3SHWA 1ZSGA 2JM8A 4HXJA 2FRYA 1VYTA 2DJQA 1I1JA 2LX7A 1UG1A 1M27C 2O9SA 2VVKA 2K79A 1T3SA 1UE9A 2L2PA 3EG1A 2W10A 1X43A 1SRMA 2C0OA 2EGAA 2KNBB 1UJYA 2K9GA 4LUEA 1V1CA 3RNJA 5IHKA 1M3BA 1OPLA 4IIOA 2DILA 1PRMC 1AZEA 3NPFA 1X27A 1ABQA 2MOXA 1YWOA 4J9BA 4DEXA 4OMQA 1GCPA 1NEBA 1YP5A 2KT8A 1SPKA 1GBQA 2DBKA 2LQNA 2K6DA 1AWXA 1ABOA 4J9FA 2CH4W 2E5KA 1RI9A 4RTXA 3ULRB 4D8DA 4E6RA 3EG0A 2ECZA 3H0FA 2CH4A 3M0RA 1W1FA 1NYFA 2YDLA 1JXOA 1M3CA 3PE0A 2CT4A 2ROLA 2ED0A 3RBBB 2LJ0A 1PWTA 1T0HA 2EYYA 2FRWA 3H0IA 2DA9A 2DF6A 3JV3A 4D8KA 2CSIA 2CUDA 2AK5A 2D8HA 4LE9A 2F2VA 2O31A 2FEIA 2DBMA 4AG1C 3VS3A 3UA7A 1FYNA 2JM9A 3UF4A 2JT4A 2DVJA 5EC7A 1ZUKA 1CKAA 1IO6A 1AVZC 1KFZA 2DL4A 1A0NB 2LP5A 2P4RA 2DLPA 2LNHB 2JS0A 2KRNA 2EBPA 1GRIA 1I07A 2DYBA 5IH2A 1SHFA 2KEAA 3A98A 4AFUC 1T0JA 1WXBA 3THKA 2KXDA 2J6OA 2KR3A 1WDXA 3CQTA 2BZXA 1OOTA 2VKNA 1KSWA 1WYXA 3VRZA 2MCNA 4AG2C 3REBB 3U23A 1SRLA 4QT7A 2A08A 3VS0A 2DL3A 2YT6A 3ZL7C 1GCQA 1UHFA 2SRCA 1HD3A 1BU1A 3H0HA 1CSKA 1YCSB 4LN2A 5GJWB 1JO8A 4KRTA 2KYMA 1AWWA 5IHNA 1OPKA 2KRSA 5GJVB 2DL8A 2FG0A 1H8KA 1N5ZA 2RN8A 2HCKA 3O5ZA 1UDLA 1AZGB 1X2QA 2KXCA 1K0XA 1SEMA 1PNJA 4ORZA 2YSQA 2RQTA 4M4ZA 2PTKA 3EHRA 1QLYA 2RQUA 1OV3A 3EG2A 1BBZA 4J9CA 2D0NA 2RPNA 4HVUA 1K4US 2KROA 3M0PA 3EG3A 1UHCA 1YN8A 4HVWA 2DM1A 2DRMA 3H41A 4F17A 3VS6A 4Z88A 2HDAA 1M8MA 2HEQA 1M30A 2KGTA 4OMLA 1K76A 5ECAA 2O9VA 2EW3A 2RQVA 2GBQA 3M0UA 2O88A 1K9AA 1NLPC 2B86A 2XMFA 1T3LA 1RLPC 4LUDA 2EKHA 1WI7A 4J9HA 4R0KA 2KBTA 4RTZA 3QWXX 5FW9A 4RTVA 2PZ1A 1QWFA 1UUEA 2JW4A 2D8JA 5IXFA 4J9DA 1G2BA 5FWBA 2GTJA 2EPDA 1WX6A 3NHNA 1GFCA 2L3QA 2J06A 5L23A 2JTEA 2YUPA 1W6XA 4OMOA 2HSPA 2PNIA 5I11A 3REAB 5I22A 2DX1A 1GBRA 1NM7A 1H92A 1CKBA 1VYUA 1YWPA 4K11A 3UATA 1TG0A 1U3OA 1YNZA 4WCIA 1WA7A 1AWOA 2F2WA 1PKTA 2ABLA 2DE0X 2EYXA 4JZ4A 4CC3A 2NWMA 1MUZA 2ESWA 3VS5A 2GGRA 1Z9ZA 1UJ0A 1MV0B 1PRLC 2AZVA 2KT1A 1K1ZA 4HVVA 1JQQA 1U5SA 2OAWA 4CC7A 1SHGA 2A37A 4OMNA 2FO0A 4AFSC 2OJ2A 2IIMA 3IQLA 2W0ZA 4GLMA 2X3WD 2GQIA 2SEMA 1UGVA 2AKKA 1I0CA 2JXBA 2CREA 2GNCA 3VS4A 2A28A 1Z9QA 3I5RA 4AFQC 1X6GA 1NEGA 3NGPA 3I9QA 2CSQA 1Y57A 3KFVA 2LCSA 2NUZA 1K0SA 1WXTA 1RUWA 1AD5A 2V1QA 1B3QA 2EQIA 4RTTA 3I5SA 2C0IA 1VYVA 1ZLMA 2YUNA 3M0QA 1GL5A 4JZ3A 2RMOA 4CC2A 1AWJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z8A A;  2KRM A;  2EGC A;  3TVT A;  3FJ5 A;  3VRY A;  2JMC A;  1UEC A;  2EGE A;  4IIM A;  4J9G A;  4JJC A;  1J3T A;  3TSW A;  1HSQ A;  2M51 A;  1JXM A;  2BZY A;  1U06 A;  2VWF A;  3PVL A;  4ZNX A;  1PHT A;  2CUB A;  4JJD A;  1B07 A;  2J6K A;  4EIK A;  2LQW A;  1AOJ A;  1MV3 A;  2I0N A;  5IHI A;  2OI3 A;  2D1X A;  1X69 A;  1TUC A;  2RQW A;  1QCF A;  2GTO A;  1BK2 A;  3VS1 A;  2X3X D;  1UTI A;  1ZBJ A;  1QKW A;  1QWE A;  2LMJ A;  2K2M A;  4GBQ A;  1X6B A;  1E6G A;  2HBW A;  4HCK A;  2K7A A;  1FMK A;  3EHQ A;  1G83 A;  2LJ1 A;  2EYZ A;  2ENM A;  2G6F X;  1AEY A;  3M0T A;  2ROT A;  2F2X A;  1NYG A;  4OMP A;  1NLO C;  5FWC A;  2RF0 A;  3SEM A;  2DNU A;  2FPE A;  1UFF A;  3EGU A;  2RQR A;  1ZUU A;  3M0S A;  2CDT A;  2BZ8 A;  4AFZ C;  1OEB A;  1GCQ C;  2J6F A;  2V1R A;  2J05 A;  4Y92 A;  1ARK A;  1WXU A;  5IXB A;  2AKL A;  1M3A A;  1ZUY A;  2DMO A;  1VA7 A;  2KE9 A;  1LCK A;  1E7O A;  3GBQ A;  2K3B A;  2L0A A;  2BTT A;  2M0Y A;  4RTU A;  2DL5 A;  2H8H A;  4A63 B;  2JMA A;  4J9E A;  2C0T A;  1JU5 C;  3TSZ A;  1SSH A;  4LNP A;  4F14 A;  2FPF A;  4RTW A;  2LZ6 B;  1BB9 A;  3QWY A;  4Z89 A;  2CT3 A;  2RNA A;  3C0C A;  1GFD A;  4RTY A;  2YUO A;  2AZS A;  4JPB W;  2L3P A;  1TUD A;  1W70 A;  3I35 A;  3LH5 A;  1RLQ C;  4FSS A;  1WFW A;  1S1N A;  3VS2 A;  2QDL A;  4OMM A;  4JJB A;  1QKX A;  1JEG A;  2L3S A;  1KIK A;  1Y0M A;  1WLP B;  1WIE A;  1XOV A;  2DRK A;  2KYB A;  2YUQ A;  2EYW A;  3UA6 A;  3NMZ C;  2EVR A;  2JS2 A;  1H3H A;  1HJD A;  5HCK A;  3VS7 A;  1EFN A;  4F16 A;  2FPD A;  1ZX6 A;  3PVQ A;  1NG2 A;  4DEY A;  2DL7 A;  2MIO A;  2LJ3 A;  4X1V A;  3R6N A;  4J9I A;  4ESR A;  4RUG A;  2J7I A;  2O2O A;  1KJW A;  2ED1 A;  1PKS A;  1E6H A;  1X2K A;  4CC4 B;  2A36 A;  3SHW A;  1ZSG A;  2JM8 A;  4HXJ A;  2FRY A;  1VYT A;  2DJQ A;  1I1J A;  2LX7 A;  1UG1 A;  1M27 C;  2O9S A;  2VVK A;  2K79 A;  1T3S A;  1UE9 A;  2L2P A;  3EG1 A;  2W10 A;  1X43 A;  1SRM A;  2C0O A;  2EGA A;  2KNB B;  1UJY A;  2K9G A;  4LUE A;  1V1C A;  3RNJ A;  5IHK A;  1M3B A;  1OPL A;  4IIO A;  2DIL A;  1PRM C;  1AZE A;  3NPF A;  1X27 A;  1ABQ A;  2MOX A;  1YWO A;  4J9B A;  4DEX A;  4OMQ A;  1GCP A;  1NEB A;  1YP5 A;  2KT8 A;  1SPK A;  1GBQ A;  2DBK A;  2LQN A;  2K6D A;  1AWX A;  1ABO A;  4J9F A;  2CH4 W;  2E5K A;  1RI9 A;  4RTX A;  3ULR B;  4D8D A;  4E6R A;  3EG0 A;  2ECZ A;  3H0F A;  2CH4 A;  3M0R A;  1W1F A;  1NYF A;  2YDL A;  1JXO A;  1M3C A;  3PE0 A;  2CT4 A;  2ROL A;  2ED0 A;  3RBB B;  2LJ0 A;  1PWT A;  1T0H A;  2EYY A;  2FRW A;  3H0I A;  2DA9 A;  2DF6 A;  3JV3 A;  4D8K A;  2CSI A;  2CUD A;  2AK5 A;  2D8H A;  4LE9 A;  2F2V A;  2O31 A;  2FEI A;  2DBM A;  4AG1 C;  3VS3 A;  3UA7 A;  1FYN A;  2JM9 A;  3UF4 A;  2JT4 A;  2DVJ A;  5EC7 A;  1ZUK A;  1CKA A;  1IO6 A;  1AVZ C;  1KFZ A;  2DL4 A;  1A0N B;  2LP5 A;  2P4R A;  2DLP A;  2LNH B;  2JS0 A;  2KRN A;  2EBP A;  1GRI A;  1I07 A;  2DYB A;  5IH2 A;  1SHF A;  2KEA A;  3A98 A;  4AFU C;  1T0J A;  1WXB A;  3THK A;  2KXD A;  2J6O A;  2KR3 A;  1WDX A;  3CQT A;  2BZX A;  1OOT A;  2VKN A;  1KSW A;  1WYX A;  3VRZ A;  2MCN A;  4AG2 C;  3REB B;  3U23 A;  1SRL A;  4QT7 A;  2A08 A;  3VS0 A;  2DL3 A;  2YT6 A;  3ZL7 C;  1GCQ A;  1UHF A;  2SRC A;  1HD3 A;  1BU1 A;  3H0H A;  1CSK A;  1YCS B;  4LN2 A;  5GJW B;  1JO8 A;  4KRT A;  2KYM A;  1AWW A;  5IHN A;  1OPK A;  2KRS A;  5GJV B;  2DL8 A;  2FG0 A;  1H8K A;  1N5Z A;  2RN8 A;  2HCK A;  3O5Z A;  1UDL A;  1AZG B;  1X2Q A;  2KXC A;  1K0X A;  1SEM A;  1PNJ A;  4ORZ A;  2YSQ A;  2RQT A;  4M4Z A;  2PTK A;  3EHR A;  1QLY A;  2RQU A;  1OV3 A;  3EG2 A;  1BBZ A;  4J9C A;  2D0N A;  2RPN A;  4HVU A;  1K4U S;  2KRO A;  3M0P A;  3EG3 A;  1UHC A;  1YN8 A;  4HVW A;  2DM1 A;  2DRM A;  3H41 A;  4F17 A;  3VS6 A;  4Z88 A;  2HDA A;  1M8M A;  2HEQ A;  1M30 A;  2KGT A;  4OML A;  1K76 A;  5ECA A;  2O9V A;  2EW3 A;  2RQV A;  2GBQ A;  3M0U A;  2O88 A;  1K9A A;  1NLP C;  2B86 A;  2XMF A;  1T3L A;  1RLP C;  4LUD A;  2EKH A;  1WI7 A;  4J9H A;  4R0K A;  2KBT A;  4RTZ A;  3QWX X;  5FW9 A;  4RTV A;  2PZ1 A;  1QWF A;  1UUE A;  2JW4 A;  2D8J A;  5IXF A;  4J9D A;  1G2B A;  5FWB A;  2GTJ A;  2EPD A;  1WX6 A;  3NHN A;  1GFC A;  2L3Q A;  2J06 A;  5L23 A;  2JTE A;  2YUP A;  1W6X A;  4OMO A;  2HSP A;  2PNI A;  5I11 A;  3REA B;  5I22 A;  2DX1 A;  1GBR A;  1NM7 A;  1H92 A;  1CKB A;  1VYU A;  1YWP A;  4K11 A;  3UAT A;  1TG0 A;  1U3O A;  1YNZ A;  4WCI A;  1WA7 A;  1AWO A;  2F2W A;  1PKT A;  2ABL A;  2DE0 X;  2EYX A;  4JZ4 A;  4CC3 A;  2NWM A;  1MUZ A;  2ESW A;  3VS5 A;  2GGR A;  1Z9Z A;  1UJ0 A;  1MV0 B;  1PRL C;  2AZV A;  2KT1 A;  1K1Z A;  4HVV A;  1JQQ A;  1U5S A;  2OAW A;  4CC7 A;  1SHG A;  2A37 A;  4OMN A;  2FO0 A;  4AFS C;  2OJ2 A;  2IIM A;  3IQL A;  2W0Z A;  4GLM A;  2X3W D;  2GQI A;  2SEM A;  1UGV A;  2AKK A;  1I0C A;  2JXB A;  2CRE A;  2GNC A;  3VS4 A;  2A28 A;  1Z9Q A;  3I5R A;  4AFQ C;  1X6G A;  1NEG A;  3NGP A;  3I9Q A;  2CSQ A;  1Y57 A;  3KFV A;  2LCS A;  2NUZ A;  1K0S A;  1WXT A;  1RUW A;  1AD5 A;  2V1Q A;  1B3Q A;  2EQI A;  4RTT A;  3I5S A;  2C0I A;  1VYV A;  1ZLM A;  2YUN A;  3M0Q A;  1GL5 A;  4JZ3 A;  2RMO A;  4CC2 A;  1AWJ A; 
#chains in the Genus database with same CATH topology
 1W4S A;  3LLR A;  1VQ7 Q;  1VQ6 A;  1Y96 A;  4FL6 A;  1D1C A;  3M4Y A;  3CCS T;  1K73 C;  3BY7 A;  1MMN A;  2CZ6 B;  2H3E B;  1V76 A;  2I2L A;  2WSF E;  4QQ6 A;  1G5V A;  3JCM W;  3I56 Q;  4PJN A;  1SKU B;  1QVP A;  1G8X A;  4ZNX A;  1RAC B;  1ACM B;  4P5N A;  2J6K A;  4BB7 A;  3GF5 A;  2I0N A;  5IHI A;  1IGQ A;  4RCC A;  2K2V A;  2DPP B;  4KBM B;  4XTW A;  5DM7 R;  1QCF A;  4KH1 B;  3UWN A;  1UGP B;  2RK2 A;  2F69 A;  2X51 A;  5GAN 4;  3ASK A;  1OQK A;  2CP6 A;  2MI6 A;  1E6G A;  2HBW A;  4HCK A;  1C6V X;  2K7A A;  3D7S B;  2V26 A;  4PJO G;  2E6Z A;  1VQ9 T;  4NOY A;  2DTO A;  4FYY B;  2COW A;  3CME T;  2QQA A;  1NLO C;  2ZPF B;  3SEM A;  2DNU A;  1VQ6 Q;  2WAC A;  4HCZ A;  1UB4 A;  2NYS A;  1XQH A;  2P84 A;  1PSE A;  1GCQ C;  1QMC A;  3MET A;  2V1R A;  2J05 A;  3G4S Q;  4LD9 K;  1WZO A;  1ARK A;  5IXB A;  2GCX A;  2AKL A;  3SWN C;  2DMO A;  2X9H A;  2HKQ B;  2ZPE B;  4PJM A;  2L0A A;  2COY A;  1HK9 A;  1QVF A;  2ZPI B;  2QYZ A;  3UT1 A;  3PMI A;  2ZPH B;  5GAN f;  1OUL A;  4FT2 A;  4ZGD B;  1YIT Q;  1BB9 A;  2CT3 A;  4M75 D;  2RNA A;  1YJ9 A;  4RTY A;  2AZS A;  4FSS A;  1WFW A;  2Y90 A;  1TS9 A;  3VS2 A;  4JJB A;  4DBR A;  3CC4 Q;  1QKX A;  4C8Q A;  1XOV A;  4M78 E;  4GY5 A;  3UA6 A;  1H3H A;  4PL6 A;  3M55 A;  3KXT A;  5HCK A;  3VS7 A;  3V8J A;  1M1F A;  2FPD A;  3C12 A;  4DBH A;  1WJS A;  2RI5 A;  5DY9 A;  4BUG A;  4J5Y A;  1KD1 R;  2QGG A;  3R6N A;  4J9I A;  4IKF A;  5GAM h;  2J7I A;  2XD0 A;  2R5A A;  1KJW A;  3QSU A;  2M02 A;  3SHW A;  3SDZ A;  4HXJ A;  1IZ6 A;  2LX7 A;  3LGL A;  3LYI A;  5CVI A;  2NUT A;  3CMA T;  2K79 A;  1Q81 R;  3MCA B;  2HQE A;  3CCQ Q;  1LPL A;  1SRM A;  3LW5 E;  2C0O A;  4FIB A;  2EGA A;  2K9G A;  4KUL A;  1RAI B;  1V1C A;  3T9N A;  2CP5 A;  4BI4 A;  1YJ9 Q;  4X9C A;  1M3B A;  1RAG B;  1NE8 A;  2DIL A;  1PRM C;  1VQN A;  1ABQ A;  3QZ5 B;  4J9B A;  1VQ5 T;  1VQ4 A;  2DD5 A;  1ZSZ A;  2K6D A;  4O6J A;  1AT1 B;  2E5K A;  4JRQ A;  4ANJ A;  4PNO A;  2EKO A;  2QGF B;  4FYV B;  3H0F A;  2CH4 A;  5FLX E;  4E7Z A;  3QJY A;  2RI3 A;  3TQ7 P;  1M3C A;  3TEE A;  3CCL Q;  2CT4 A;  1M1K R;  2ROL A;  4M7A D;  2BIV A;  2EYY A;  4OB3 B;  1C1A A;  2DYI A;  2K57 A;  2JTM A;  4II1 A;  1WHH A;  1D0X A;  3EG9 A;  1I5O B;  1DJ7 B;  2D8H A;  3P8B B;  2EIF A;  3JB9 J;  1VQK T;  3MKD A;  3E1S A;  4Z02 A;  1MHN A;  2O31 A;  4F7U E;  1NJI C;  3VS3 A;  3UA7 A;  1Q7Y U;  1FYN A;  1PM3 A;  4E7J A;  1X75 C;  3NFC A;  2JM9 A;  3OBW A;  6AT1 B;  1IXD A;  1CKA A;  2VXF A;  2YRD A;  1PCX A;  4LDW A;  2DL4 A;  2DKG A;  1FMW A;  3JCM d;  3OYI A;  2GF7 A;  1SHF A;  3X28 B;  2KEA A;  2KXD A;  3E2U A;  2KR3 A;  1WDX A;  3BDU A;  3H8Z A;  2LT4 A;  5KYU A;  3CQT A;  3OYA A;  1WYX A;  3G71 T;  4TVR A;  3U23 A;  4QT7 A;  2A08 A;  1NBE B;  5IN1 A;  2BUD A;  3VS0 A;  1GCQ A;  4LDV A;  5GJW B;  3URG A;  1M4Z A;  1JO8 A;  5HK3 A;  4EMK B;  3M56 A;  4C92 D;  2DL8 A;  3OYN A;  4KT0 E;  1H8K A;  4ZGE B;  2MPX C;  1N5Z A;  2H3J A;  2RN8 A;  2E1H A;  2KMT A;  1X2Q A;  1YJN A;  1VQ7 T;  1N9R A;  3CCV A;  5DLO A;  4C8Q B;  2EFI A;  5GMK h;  3CCE Q;  2CP3 A;  1B34 A;  3M0P A;  3EG3 A;  4ATO A;  3L2W A;  3P8H A;  1D09 B;  3VS6 A;  2HL5 C;  4XTZ A;  1M8M A;  4PJO E;  5CKE A;  5I2S A;  4BAC A;  4ZTJ A;  5FRN A;  4C8Q D;  1KK7 A;  1SF9 A;  3G6E A;  2HAX A;  2HNI A;  2NUT B;  1WI7 A;  4A54 A;  5FW9 A;  2PZ1 A;  2KI7 A;  3M58 A;  2Y4X A;  1G2B A;  2E3H A;  3J7A F;  5KYX B;  3NHN A;  2L3Q A;  2J06 A;  5L23 A;  2OTJ A;  5KYW A;  3MP6 A;  1S72 A;  1SG5 A;  1VQO A;  3ZBD A;  5I22 A;  1ZSZ B;  4XAX B;  1VQL A;  3MEA A;  3G4S T;  1FWZ A;  2A3L A;  1JRI A;  1U3O A;  1FMV A;  4XQ3 A;  2M9U A;  1QW1 A;  1WA7 A;  2XDB A;  2DE0 X;  1KG1 A;  4QVD A;  4ELY C;  2ESW A;  2GGR A;  1Z9Z A;  4N4I A;  1K1Z A;  1KQ1 A;  1VIE A;  4CC7 A;  1YIT T;  1SHG A;  3E19 A;  1Q82 U;  4WF2 A;  1Q95 G;  4E7H A;  2OJ2 A;  3EG9 B;  4GLM A;  3G6E Q;  3BFM A;  2ZCF B;  3HPW A;  2YWW A;  1UGV A;  5KYY A;  2JXB A;  4HCB A;  3CCM A;  3CC4 T;  1ZBX A;  4C8Q G;  5GAO n;  3C4S A;  3JCM c;  3I9Q A;  1N9S A;  4FW2 A;  2CSQ A;  2OTJ Q;  1VOM A;  3CC2 Q;  1S72 Q;  3KFV A;  2LCS A;  1RUW A;  3JCM e;  3CXC S;  2V1Q A;  3MJX A;  2RJD A;  3I5S A;  3OYE A;  1VQL Q;  4C5G A;  3M0Q A;  4CC2 A;  1D1A A;  2FZK B;  2ZPB B;  2KRM A;  2NUP A;  2DZC A;  1I5L A;  3TVT A;  3LX7 A;  4J83 A;  3FJ5 A;  3VRY A;  2JMC A;  2HBP A;  4FSX A;  5KYU B;  1J3T A;  2QEX T;  1Y71 A;  4ZN3 A;  4M75 E;  1JXM A;  3EAE A;  3CCQ T;  1Q81 C;  2VWF A;  2QAZ A;  5LJ3 h;  5GMK l;  3OYB A;  1PHT A;  5GMK m;  2E12 A;  2CUB A;  2LQW A;  1AOJ A;  9ATC B;  4KGZ B;  1VQ8 A;  2D1X A;  1X69 A;  4MZT A;  5CQX A;  2FL7 A;  4XTX A;  1BK2 A;  3PFS A;  3VS1 A;  2X3X D;  1UTI A;  1QKW A;  2LMJ A;  4JRK A;  1X6B A;  1FMK A;  3EHQ A;  1G83 A;  2QA4 A;  4OB2 B;  2EYZ A;  2ENM A;  1BI2 A;  4UC4 A;  1AEY A;  2QXF A;  2ROT A;  1NYG A;  3OSS C;  2LC4 A;  4M78 F;  1B34 B;  1KC8 C;  3GLX A;  3CCL T;  4XU1 A;  2RF0 A;  3HHT B;  1KHC A;  3M53 A;  1JJ2 S;  1XJW B;  3EFR A;  2CDT A;  5GAO p;  4LDU A;  2LDM A;  2YXY A;  5LL6 S;  1OEB A;  2OTL Q;  4Y92 A;  2RHI A;  1WXU A;  3OMG A;  1R8O B;  4B9X A;  1M3A A;  2V8I A;  4JS4 A;  2GFA A;  1K8A U;  3CXC P;  4M78 C;  3CC7 A;  1E7O A;  4RKU E;  4C0Z A;  1RAF B;  2ATC B;  2BTT A;  4RTU A;  3HKS A;  4MDW A;  1YJW A;  1VQ8 Q;  2PUO B;  3TSZ A;  5D6W A;  4LNP A;  4F14 A;  2XU8 A;  4RTW A;  2XDD A;  1BYM A;  3QWY A;  5KCH A;  3TCJ A;  5C6S A;  5KYW B;  4DOV A;  5M9O A;  3O8V A;  1UGR B;  1M2O A;  8ATC B;  1S1N A;  2QA4 Q;  4ZN1 A;  4JS5 A;  4M7A E;  2YUQ A;  3PIO A;  2EVR A;  4ELZ C;  2PU9 B;  1QP2 A;  3N5B B;  3OYF A;  1HJD A;  3OS2 A;  5KE3 A;  4F16 A;  1IRX A;  3L2Z A;  2M1H A;  3FRN A;  3DLM A;  3OW2 A;  2MIO A;  4CI0 C;  4X1V A;  2PVO B;  3LH0 A;  2O2O A;  1RAH B;  1M2V A;  4C0D B;  1YBY A;  5GAN d;  2ED1 A;  1PKS A;  1X2K A;  3HTR A;  1Q7Y R;  1WHK A;  2XK0 A;  1IRE B;  2EJG A;  3L2U A;  4RG2 A;  1M27 C;  5KYY B;  5GMK i;  1BI0 A;  1T3S A;  2L2P A;  4YTL A;  2W10 A;  2D0Q B;  2HQX A;  1K8A C;  4F7U F;  4Y28 E;  3CCE T;  5GAN j;  2KNB B;  4LUE A;  1TH7 A;  5CKB A;  3CBP A;  3INZ A;  1OZ2 A;  3J81 E;  4MZP A;  3QII A;  3M5A A;  3NPF A;  1X27 A;  3OQ5 A;  5DLQ E;  1YI2 A;  2MOX A;  4OMQ A;  4BI8 B;  3QDF A;  1GCP A;  1NEB A;  4NL2 A;  5GAO q;  1X6O A;  5CO7 A;  3CCU T;  1Q86 U;  1D0Z A;  1KQS P;  2MMP A;  3CD6 A;  1RAB B;  4N4G A;  2NUP B;  1WPY A;  1NYF A;  3ZFJ A;  5GAM g;  3JCM h;  4KH0 B;  4C92 E;  3MEV A;  5AYF A;  2LJ0 A;  2B8A A;  2EJ9 A;  3OW2 P;  1Y07 A;  2DA9 A;  3BW1 A;  4D8K A;  4GLK A;  1B7T A;  4LE9 A;  3RKX A;  2FEI A;  2EAY A;  1QVF S;  3G1J A;  1MGQ A;  4A4F A;  1ZUK A;  1IHV A;  5I21 A;  3MEU A;  1IO6 A;  1O9S A;  1M90 U;  4V2S A;  2KY9 A;  4KUD K;  1MNE A;  2LP5 A;  4XTY A;  2P4R A;  4NS5 A;  2KRN A;  2EBP A;  3CD6 Q;  7AT1 B;  3OYD A;  3OS1 A;  2Z0W A;  4BE1 A;  4AFU C;  4XTV A;  1WXB A;  2J6O A;  1V29 B;  2WSE E;  4BE0 A;  1OOT A;  2VKN A;  2RK1 A;  3I55 T;  3VRZ A;  2MCN A;  3SFM A;  4AG2 C;  2LNV A;  1SRL A;  3ER0 A;  5FU6 C;  2CYZ B;  2OTJ T;  3CC2 T;  3ME9 A;  3ZL7 C;  1S72 T;  1UHF A;  4QW2 A;  2SRC A;  4L6V 5;  1HD3 A;  5CKF A;  1K9M U;  1YCS B;  3CBM A;  4B9W A;  4KRT A;  2KYM A;  4J6W A;  1ZA2 B;  4IUR A;  5LJ5 g;  4M78 A;  1PG5 B;  5IHN A;  1OPK A;  5GAN 8;  2DER A;  3GNF B;  2DET A;  1QCO A;  2VV5 A;  4A4H A;  3OA6 A;  4FYX B;  2HCK A;  3O5Z A;  1AZG B;  2X35 A;  2KDS A;  2P4T A;  3OYY A;  3CCR A;  1K0X A;  4OGE A;  3DKM A;  1SEM A;  1PNJ A;  4ORZ A;  1R0C B;  3UPU A;  1UGS B;  5KE2 A;  2PQW A;  1HXD A;  3EHR A;  1QLY A;  4PFO A;  2RQU A;  4A4G A;  3OYC A;  5GAN e;  2MK5 A;  1OV3 A;  2CS7 A;  2RPN A;  1YN8 A;  2X4Y A;  1R77 A;  2DXC A;  3H41 A;  4F17 A;  3JB9 I;  3SD4 A;  2HEQ A;  1YHQ T;  1M30 A;  3M9Q A;  1TOV A;  2QK0 A;  1Y96 B;  3FB9 A;  1K76 A;  5ECA A;  1M2V B;  5GAO m;  4C0D C;  4J6Y A;  3S3M A;  2AIR B;  1KC8 R;  3JCM X;  2V8J A;  2XMF A;  1RLP C;  4LUD A;  3QWX X;  2EWN A;  1UUE A;  2AHJ B;  1WJR A;  4AMC A;  2LQ8 A;  2GTJ A;  1HYO A;  1GFC A;  3QYG B;  2JTE A;  2YUP A;  4OMO A;  2HSP A;  5CR2 A;  2E65 A;  2GFU A;  5I11 A;  4BI3 A;  3JCM V;  3CCR Q;  4OB1 B;  2JZ2 A;  1LNX A;  2OTL T;  4OB0 B;  4K11 A;  5KH6 A;  1VQN Q;  1YNZ A;  4M7D E;  1VQ4 Q;  1AWO A;  2LCC A;  4JZ4 A;  3V7S A;  2NWM A;  3EFS A;  4LXC A;  3CCS A;  2K4Y A;  2EQJ A;  2HMA A;  1UJ0 A;  8AT1 B;  4F7U A;  3UDC A;  4DA4 A;  1FX7 A;  2DEQ A;  3HL8 A;  2KVQ G;  3PMT A;  3V7C A;  4M77 E;  2IIM A;  3CPW S;  5KCO A;  2W0Z A;  4X34 A;  2SEM A;  2RHU A;  1FXX A;  4M7D A;  2CRE A;  2GNC A;  1PD0 A;  2PUK B;  1TTH B;  2BE9 B;  4M75 C;  4E2F B;  3EGD A;  1W2B S;  1KQ2 A;  1WQW A;  2C0I A;  4BE2 A;  1ZLM A;  1VQ9 A;  2YUN A;  1QP3 A;  4JZ3 A;  2RMO A;  3CPF A;  4NL3 A;  5GAN 7;  1AWJ A;  3CME A;  1K8A R;  2K5I A;  1MMA A;  3HSB A;  4J7I A;  3FDR A;  2ZPG B;  2EGC A;  2XG8 D;  1N8R U;  1UEC A;  1VQP A;  1Q7Y C;  4IIM A;  1TWB A;  2K3X A;  1C0M A;  3CCJ A;  3I56 T;  4RCB A;  2BZY A;  1U06 A;  1YCY A;  2JVV A;  2RM4 A;  1QVG S;  4EIK A;  4MDX A;  5HY6 A;  2IPO B;  2MWP A;  4KGV B;  4M78 B;  1TUC A;  2RQW A;  2VC8 A;  2GTO A;  3A8G B;  3CEY A;  1U1S A;  2K2M A;  1TU0 B;  1MMD A;  1LOJ A;  5J26 A;  4C0G A;  2LJ1 A;  4XU3 A;  4CRI A;  4XK8 E;  3M0T A;  4F04 B;  4PJO A;  4QQD A;  1VQ9 Q;  1YFN A;  2OAU A;  1I8F A;  2EQM A;  1M8V A;  3J80 E;  5GAM d;  1YJN Q;  5FWC A;  3CME Q;  4R56 A;  1VQ6 T;  1NPP A;  3CCV Q;  3AHU A;  2FPE A;  2X4J A;  4M78 D;  3EGU A;  2RQR A;  3M0S A;  1RAA B;  3V8L A;  1VQP Q;  5CCA A;  4AFZ C;  4QKU A;  3HRT A;  2J6F A;  1W2B P;  1TXQ A;  3CCJ Q;  1KD1 U;  5LJ3 g;  5GAM j;  4HCC A;  3JSC A;  3GP8 A;  2ZGW A;  2K3B A;  5GAN h;  1N8R C;  4A63 B;  2JMA A;  1JB0 E;  4J6X A;  2C0T A;  3CMA A;  1JU5 C;  5EG2 A;  1OYX A;  4EMG A;  1Q86 R;  2EQK A;  3JCM P;  3GNG A;  1WHJ A;  2COZ A;  2RH2 A;  2YUO A;  3A5Z B;  1W70 A;  4HT9 A;  3LH5 A;  2QDL A;  4OMM A;  1VQ5 A;  2L3S A;  1KIK A;  1Y0M A;  3HFN A;  2DRK A;  2KYB A;  4PFZ A;  2EYW A;  1VQO Q;  3NMZ C;  4HA8 A;  1QVG P;  2EQU A;  2KSS A;  2QQS A;  3EH1 A;  3PVQ A;  3M57 A;  2CZ0 B;  4DEY A;  1Y7X A;  2O4X A;  4F7U B;  3EH2 A;  3OBY A;  3NTH A;  4R55 A;  4M78 G;  1BCM A;  2QQR A;  3CXC A;  1E6H A;  2A36 A;  3OSV A;  1M1K U;  5LJ5 d;  5L8R E;  1ZSG A;  3RMS A;  3NTI A;  1VYT A;  2DJQ A;  5GAM f;  1UG1 A;  2VGM A;  2O9S A;  3S3O A;  2DIQ A;  1UE9 A;  1GXI E;  3CMA Q;  4KUI A;  4BY6 C;  1VQK A;  1X43 A;  4HT8 A;  1M90 R;  4OGC A;  1UJY A;  2DXT A;  1YJ9 T;  2LQK A;  3EGD B;  2XI9 A;  3OB9 A;  5LJ5 j;  2QTX A;  5FRO A;  3CCM Q;  5CAI A;  1U1T A;  3OS5 A;  2FB7 A;  2MF2 A;  2ZZD A;  4DEX A;  1Q82 C;  1SPK A;  3QJ6 A;  1BIB A;  2X4W A;  4N0A A;  1AWX A;  2CH4 W;  4M75 A;  4RTX A;  2DFU A;  3ULR B;  1M1G A;  4D8D A;  4E6R A;  3H6Z A;  3H9N A;  3EG0 A;  2ECZ A;  1KHI A;  3DLL A;  1RL2 A;  4E7L A;  4RMO A;  2FVU A;  2RB6 A;  5A2Q E;  5A0D A;  1PC0 A;  3L2V A;  1JXO A;  2DJZ A;  5FU7 C;  5HK0 A;  2ED0 A;  4WTO B;  1PWT A;  1T0H A;  2CZ1 B;  3G71 A;  2FRW A;  1OI1 A;  4C5I A;  3RUX A;  2P0P A;  3EGX A;  4IUV A;  2CSI A;  3VKI A;  2CUD A;  1RAE B;  4ME7 A;  3MP1 A;  2F2V A;  2DBM A;  4FW1 A;  5GAM e;  1K73 U;  5FU6 B;  4AG1 C;  1WQ7 A;  4PLI A;  1XNI A;  2VXE A;  1VQN T;  2NLU A;  2JJ9 A;  1VQ4 T;  2WSC E;  3L1A A;  2FYK A;  5EC7 A;  5LJ5 f;  1VQ7 A;  2IG0 A;  4D6W A;  4A53 A;  5GMK j;  3PTA A;  1KFZ A;  5AT1 B;  2DAQ A;  1A0N B;  2DXB A;  2LNH B;  4F7U G;  1KQS A;  2JS0 A;  1I07 A;  2DYB A;  4QVC A;  3JCM g;  3HP9 A;  2LX9 A;  3A98 A;  4Y91 A;  3A1P A;  4JUV A;  4Q5W A;  3VYH B;  1G3T A;  3QXE B;  2RJE A;  2HKN A;  3LWI A;  4OF1 A;  1UEB A;  1G3W A;  1D0Y A;  4X9D A;  5GAN 5;  3G71 Q;  3V7R A;  1BU1 A;  3H0H A;  5J3B A;  1CSK A;  2ZAE A;  3CC7 Q;  3LGF A;  4M7A A;  1AWW A;  2E4H A;  1VQM A;  2KRS A;  5GJV B;  3HRU A;  3JB9 F;  2FG0 A;  3MEW A;  4XU2 A;  1UDL A;  1YJW Q;  2KXC A;  2CKK A;  1OU9 A;  1JJ2 P;  2QI2 A;  2RQT A;  2CP0 A;  2PTK A;  4C5E A;  3MHX A;  2JOY A;  1BBZ A;  3EG2 A;  3G4S A;  5LJ5 e;  2QAS A;  2KRO A;  4M7D F;  1G3S A;  2VAS A;  4HVW A;  2DM1 A;  1H64 1;  2O4X B;  2HDA A;  2MAM A;  5CQY A;  2YLC A;  5GAN 2;  2RHY A;  2EW3 A;  3L2R A;  2RQV A;  2GBQ A;  1K9A A;  1YIT A;  3M59 A;  3DB4 A;  4M77 F;  2B86 A;  4IUU A;  4FT4 A;  4FYW B;  2EKH A;  4M7D C;  3HRS A;  2E3I A;  2KBT A;  4RTZ A;  2QG9 B;  3X26 B;  4RTV A;  1QWF A;  2D8J A;  5IXF A;  4JRI A;  1NZ9 A;  4JJN K;  4PJJ A;  1VQM Q;  3CC4 A;  3ZEH A;  3VV0 A;  2RHX A;  2HL3 A;  2LCL A;  1YJN T;  2PNI A;  1H3Z A;  2CP7 A;  4M77 C;  3CCV T;  2Y4Y A;  1GBR A;  1NM7 A;  1N8R R;  4PK4 A;  4BDZ A;  1H92 A;  1CKB A;  1VYU A;  1TSF A;  4C92 A;  4M75 B;  1VQP T;  2RHZ A;  3RER A;  1YWP A;  3CBO A;  2XHC A;  3UAT A;  1TG0 A;  3CCJ T;  1BKB A;  1YI2 Q;  2E41 A;  4ZTF A;  1PKT A;  5LJ3 d;  3A8H B;  1VIF A;  4BD3 A;  4C8Q E;  5GMK e;  1PRL C;  2QEX A;  2AZV A;  5D6X A;  1U5S A;  3VJP A;  2X4X A;  4OMN A;  3CCQ A;  3G7Z A;  3G6E T;  3EGX B;  4EMK A;  4IUP A;  2G3R A;  2F5K A;  5CIU A;  5LJ3 j;  2X3W D;  3C94 A;  2R5M A;  1Q86 C;  2GQI A;  4PJO F;  3KUF A;  1Z9Q A;  3I5R A;  4AFQ C;  1X6G A;  1BI1 A;  1NEG A;  3OYK A;  3NGP A;  2MYS A;  1EZZ B;  3OY9 A;  1VQO T;  1Y57 A;  2LTO A;  2PVD B;  1K0S A;  1WXT A;  2HD0 A;  1AD5 A;  1B3Q A;  2EQI A;  4RTT A;  1ZQ1 A;  2CP2 A;  4PJO C;  1VQL T;  4ZGJ B;  4LDY A;  2FZG B;  4IUT A;  3OYG A;  2RJC A;  1D1B A;  1JBM A;  1GL5 A;  2CGH A;  3L2Q A;  2HZY A;  1OZ3 A;  3OYJ A;  3CCL A;  3FIF A;  2E64 A;  4Z8A A;  5GAO r;  1OU8 A;  2KQW A;  5A0G A;  3QO3 A;  1NJI U;  3X25 B;  2DIG A;  1WJQ A;  2EGE A;  4J9G A;  4JJC A;  3TSW A;  1HSQ A;  2M51 A;  2YLB A;  2QEX Q;  1Q82 R;  4EPC A;  3PVL A;  5CKH A;  2EYQ A;  1M90 C;  1QVF P;  5KYX A;  4JJD A;  1B07 A;  5GAO l;  1MV3 A;  1NPR A;  1UGQ B;  3CCM T;  2OI3 A;  2VYT A;  5LJ3 f;  4M7A B;  3WVE B;  2R57 A;  1ZBJ A;  1QWE A;  3SB2 A;  2QTV A;  2VGN A;  4GBQ A;  4M75 G;  4HKE A;  5GAN 3;  4DBQ A;  3PIP A;  2L8D A;  1ZHI A;  3R6O A;  2G6F X;  3RKW A;  2F2X A;  1YIJ A;  3PNW C;  2XIC A;  4OMP A;  3QUI A;  4XTU A;  4OP0 A;  1K9M C;  5D6Y A;  3GIB A;  2QQ9 A;  1UFF A;  1ZUU A;  1MND A;  2A0F B;  2BZ8 A;  2XKO C;  4XU0 A;  5C0M A;  1QCN A;  1ZUY A;  1VA7 A;  2KE9 A;  1LCK A;  3GBQ A;  2BKD N;  2L89 A;  2M0Y A;  1WHM A;  2DL5 A;  5LJ5 h;  3HFO A;  2H8H A;  1VQ8 T;  2VB6 A;  4J9E A;  4M75 F;  2D9T A;  3OYH A;  3BDL A;  1SSH A;  3TRE A;  2FPF A;  4J7F A;  2LZ6 B;  4PLL A;  2D6F A;  4Z89 A;  2F1L A;  3CCE A;  2DTI A;  2E6N A;  2JTF A;  3C0C A;  1GFD A;  1D3B A;  5LJ3 e;  4JPB W;  2QA4 T;  2L3P A;  1TUD A;  3I35 A;  3MPU B;  1RLQ C;  4MZM A;  4BY6 B;  4EDU A;  5GAN 6;  2K3Y A;  4JLG A;  1JEG A;  1ZA1 B;  4C92 B;  4N0A C;  1WLP B;  1WIE A;  1YIJ Q;  5D7U A;  3CPW A;  2JS2 A;  3CCU A;  4A4K A;  2MWO A;  4E7K A;  4E7I A;  3QZ9 B;  5CK9 A;  3RMQ A;  4M77 A;  1EFN A;  1AHJ B;  2DK3 A;  1ZX6 A;  1NG2 A;  2DL7 A;  2LJ3 A;  4ESR A;  4RUG A;  4QVZ A;  1W2B A;  3CC7 T;  5GAN g;  4M7A G;  3KBG A;  5KYN A;  1K73 R;  3SWN A;  4CC4 B;  3CCS Q;  1WGS A;  2DD4 A;  3VYG A;  2JM8 A;  2FRY A;  1I1J A;  5FU7 B;  4N4H A;  1YJW T;  2VVK A;  3EG1 A;  4J8O A;  1PSF A;  4FU6 A;  1I4K 1;  3JCM J;  3RNJ A;  5IHK A;  1OPL A;  1RI0 A;  4IIO A;  2DTH A;  1AZE A;  3TU4 K;  1YWO A;  4VUB A;  2RD1 A;  1YP5 A;  2KT8 A;  2QDY B;  1GBQ A;  2DBK A;  2LQN A;  1ABO A;  4J9F A;  2VUB A;  3EFO A;  1IHW A;  1RI9 A;  3RR6 A;  3CCU Q;  1QVG A;  2QQB A;  2DEU A;  2RA2 A;  2CZ7 B;  4PFP A;  2DZ9 A;  3JAM E;  1OX9 A;  3FJP A;  3M0R A;  4AT1 B;  3OYL A;  3CPW P;  3E9G A;  4M7A F;  1W1F A;  2KAF A;  3LWH A;  1WHG A;  3JRZ A;  2K5L A;  2YDL A;  3PE0 A;  3M54 A;  3S6W A;  3RBB B;  4EMH A;  3QKJ A;  3I55 A;  3JCM f;  1VQM T;  3OS0 A;  3VUB A;  3H0I A;  5A0L A;  2YHT A;  2DF6 A;  3JV3 A;  5IAY A;  3CC2 A;  4C5H A;  2AK5 A;  4LDX A;  4M7A C;  2LRQ A;  1O75 A;  4L5G A;  2XID A;  1TUG B;  4O5V A;  4C92 G;  2YRC A;  3JCM Q;  2HQH A;  4E7S A;  3FEO A;  3GPL A;  3UF4 A;  1YI2 T;  2JT4 A;  2DVJ A;  2DO3 A;  1Q81 U;  2PVG B;  1U8R A;  1I81 A;  4KGX B;  1AVZ C;  3OYM A;  4E47 A;  2DLP A;  1N27 A;  3CD6 T;  5HKC A;  2HSE B;  1GRI A;  4L59 A;  1BI3 A;  5IH2 A;  3C95 A;  2DVE A;  3VUZ A;  2F5T X;  1T0J A;  3THK A;  2V8K A;  1YHQ A;  3A8O B;  2BZX A;  1KSW A;  3MO8 A;  2E70 A;  3QG1 A;  1R0B G;  4DBF A;  3I55 Q;  3REB B;  2DL3 A;  2YT6 A;  3QBY A;  1KC8 U;  4C92 F;  4BDY A;  4LN2 A;  2JUF A;  2O01 E;  2GQV A;  3FLG A;  5I2M A;  1D3B B;  4M7D B;  5CKD A;  1BIA A;  1KD1 C;  3JB9 D;  2EJF A;  4C92 C;  4OMF B;  2YSQ A;  4M4Z A;  4DQ2 A;  5IT9 E;  4FCY A;  2JNG A;  2OTL A;  1F1B B;  4J9C A;  4M77 B;  2D0N A;  4HVU A;  1K4U S;  3QHS A;  4FM4 B;  1UHC A;  2E5Q A;  1VQ5 Q;  1SSF A;  3S3N A;  4RG8 A;  2DRM A;  3X24 B;  3L42 A;  4Z88 A;  4C0F A;  3P8D A;  4JRP A;  1LJO A;  4M7D D;  2KGT A;  4C8Q F;  4OML A;  1YHQ Q;  5FRM A;  2C06 A;  2O9V A;  1IB8 A;  3SWN B;  1BCO A;  3M0U A;  2FHD A;  4EMK C;  2O88 A;  3MP8 A;  3E9F A;  2KK4 A;  3M4G A;  1NLP C;  2IVW A;  1K9M R;  1T3L A;  2XDP A;  4JDS A;  4R0K A;  4J9H A;  4PJL A;  4B6M A;  1EX4 A;  3RKY A;  2JW4 A;  3JB9 H;  3DB3 A;  4M77 D;  1OX8 A;  4J9D A;  2A7Y A;  1M9S A;  5FWB A;  3OMC A;  2EPD A;  1WX6 A;  4C8Q C;  3A8M B;  1PD1 A;  1W6X A;  3V8K A;  3PGG A;  1VQK Q;  3PT9 A;  4IUQ A;  3CCR T;  3REA B;  2DX1 A;  1NJI R;  2OX7 A;  1JJ2 A;  1M1K C;  2LVM A;  3WXM B;  4QQG A;  3EFO B;  1IGU A;  2FZC B;  3JCM b;  4A4E A;  3NTK A;  3JB9 G;  4MML A;  4WCI A;  3WVD B;  2F2W A;  2ABL A;  2EYX A;  4PJO B;  1LVK A;  1QQJ A;  1RAD B;  3QPH A;  2AT1 B;  4CC3 A;  1X01 A;  3RIR A;  4JLI A;  1MUZ A;  3VS5 A;  3F70 A;  2R58 A;  1KQS S;  1MV0 B;  2KT1 A;  2LT1 A;  2M0O A;  1G3Y A;  4OVA A;  1JQQ A;  2P0K A;  4HVV A;  3RES A;  2OAW A;  3I56 A;  2A37 A;  4AFS C;  2FO0 A;  3QYH B;  1M5Q 1;  3IQL A;  3X20 B;  4MMK A;  2L3R A;  3VU3 C;  2K5F A;  4M7D G;  2AKK A;  1I0C A;  3BE3 A;  3QDR B;  3VS4 A;  2A28 A;  1XTD A;  4DOW A;  3Q1J A;  1P92 A;  4PJO D;  3AT1 B;  1ZSZ C;  3OW2 S;  1YIJ T;  1WNL A;  2DXU A;  1MMG A;  1N6A A;  2BE7 D;  4LD6 A;  5J39 A;  2NUZ A;  3GOX A;  1EIF A;  4M77 G;  2RJF A;  4PKC C;  2RO0 A;  2L5Q A;  1WHL A;  2YRV A;  1VYV A;  3A8L B;  2RI2 A;  1VUB A;  3FC3 A;  3RDV A;  2M16 A;  2JN0 A;  2E10 A;  2P0Q A; 
#chains in the Genus database with same CATH homology
 4Z8A A;  2KRM A;  2EGC A;  3TVT A;  3FJ5 A;  3VRY A;  2JMC A;  1UEC A;  2EGE A;  4IIM A;  4J9G A;  4JJC A;  1J3T A;  3TSW A;  1HSQ A;  2M51 A;  1JXM A;  2BZY A;  1U06 A;  2VWF A;  3PVL A;  4ZNX A;  1PHT A;  2CUB A;  4JJD A;  1B07 A;  2J6K A;  4EIK A;  2LQW A;  1AOJ A;  1MV3 A;  2I0N A;  5IHI A;  2OI3 A;  2D1X A;  1X69 A;  1TUC A;  2RQW A;  1QCF A;  2GTO A;  1BK2 A;  3VS1 A;  2X3X D;  1UTI A;  1ZBJ A;  1QKW A;  1QWE A;  2LMJ A;  2K2M A;  4GBQ A;  1X6B A;  1E6G A;  2HBW A;  4HCK A;  2K7A A;  1FMK A;  3EHQ A;  1G83 A;  2LJ1 A;  2EYZ A;  2ENM A;  2G6F X;  1AEY A;  3M0T A;  2ROT A;  2F2X A;  1NYG A;  4OMP A;  1NLO C;  5FWC A;  2RF0 A;  3SEM A;  2DNU A;  2FPE A;  1UFF A;  3EGU A;  2RQR A;  1ZUU A;  3M0S A;  2CDT A;  2BZ8 A;  4AFZ C;  1OEB A;  1GCQ C;  2J6F A;  2V1R A;  2J05 A;  4Y92 A;  1ARK A;  1WXU A;  5IXB A;  2AKL A;  1M3A A;  1ZUY A;  2DMO A;  1VA7 A;  2KE9 A;  1LCK A;  1E7O A;  3GBQ A;  2K3B A;  2L0A A;  2BTT A;  2M0Y A;  4RTU A;  2DL5 A;  2H8H A;  4A63 B;  2JMA A;  4J9E A;  2C0T A;  1JU5 C;  3TSZ A;  1SSH A;  4LNP A;  4F14 A;  2FPF A;  4RTW A;  2LZ6 B;  1BB9 A;  3QWY A;  4Z89 A;  2CT3 A;  2RNA A;  3C0C A;  1GFD A;  4RTY A;  2YUO A;  2AZS A;  4JPB W;  2L3P A;  1TUD A;  1W70 A;  3I35 A;  3LH5 A;  1RLQ C;  4FSS A;  1WFW A;  1S1N A;  3VS2 A;  2QDL A;  4OMM A;  4JJB A;  1QKX A;  1JEG A;  2L3S A;  1KIK A;  1Y0M A;  1WLP B;  1WIE A;  1XOV A;  2DRK A;  2KYB A;  2YUQ A;  2EYW A;  3UA6 A;  3NMZ C;  2EVR A;  2JS2 A;  1H3H A;  1HJD A;  5HCK A;  3VS7 A;  1EFN A;  4F16 A;  2FPD A;  1ZX6 A;  3PVQ A;  1NG2 A;  4DEY A;  2DL7 A;  2MIO A;  2LJ3 A;  4X1V A;  3R6N A;  4J9I A;  4ESR A;  4RUG A;  2J7I A;  2O2O A;  1KJW A;  2ED1 A;  1PKS A;  1E6H A;  1X2K A;  4CC4 B;  2A36 A;  3SHW A;  1ZSG A;  2JM8 A;  4HXJ A;  2FRY A;  1VYT A;  2DJQ A;  1I1J A;  2LX7 A;  1UG1 A;  1M27 C;  2O9S A;  2VVK A;  2K79 A;  1T3S A;  1UE9 A;  2L2P A;  3EG1 A;  2W10 A;  1X43 A;  1SRM A;  2C0O A;  2EGA A;  2KNB B;  1UJY A;  2K9G A;  4LUE A;  1V1C A;  3RNJ A;  5IHK A;  1M3B A;  1OPL A;  4IIO A;  2DIL A;  1PRM C;  1AZE A;  3NPF A;  1X27 A;  1ABQ A;  2MOX A;  1YWO A;  4J9B A;  4DEX A;  4OMQ A;  1GCP A;  1NEB A;  1YP5 A;  2KT8 A;  1SPK A;  1GBQ A;  2DBK A;  2LQN A;  2K6D A;  1AWX A;  1ABO A;  4J9F A;  2CH4 W;  2E5K A;  1RI9 A;  4RTX A;  3ULR B;  4D8D A;  4E6R A;  3EG0 A;  2ECZ A;  3H0F A;  2CH4 A;  3M0R A;  1W1F A;  1NYF A;  2YDL A;  1JXO A;  1M3C A;  3PE0 A;  2CT4 A;  2ROL A;  2ED0 A;  3RBB B;  2LJ0 A;  1PWT A;  1T0H A;  2EYY A;  2FRW A;  3H0I A;  2DA9 A;  2DF6 A;  3JV3 A;  4D8K A;  2CSI A;  2CUD A;  2AK5 A;  2D8H A;  4LE9 A;  2F2V A;  2O31 A;  2FEI A;  2DBM A;  4AG1 C;  3VS3 A;  3UA7 A;  1FYN A;  2JM9 A;  3UF4 A;  2JT4 A;  2DVJ A;  5EC7 A;  1ZUK A;  1CKA A;  1IO6 A;  1AVZ C;  1KFZ A;  2DL4 A;  1A0N B;  2LP5 A;  2P4R A;  2DLP A;  2LNH B;  2JS0 A;  2KRN A;  2EBP A;  1GRI A;  1I07 A;  2DYB A;  5IH2 A;  1SHF A;  2KEA A;  3A98 A;  4AFU C;  1T0J A;  1WXB A;  3THK A;  2KXD A;  2J6O A;  2KR3 A;  1WDX A;  3CQT A;  2BZX A;  1OOT A;  2VKN A;  1KSW A;  1WYX A;  3VRZ A;  2MCN A;  4AG2 C;  3REB B;  3U23 A;  1SRL A;  4QT7 A;  2A08 A;  3VS0 A;  2DL3 A;  2YT6 A;  3ZL7 C;  1GCQ A;  1UHF A;  2SRC A;  1HD3 A;  1BU1 A;  3H0H A;  1CSK A;  1YCS B;  4LN2 A;  5GJW B;  1JO8 A;  4KRT A;  2KYM A;  1AWW A;  5IHN A;  1OPK A;  2KRS A;  5GJV B;  2DL8 A;  2FG0 A;  1H8K A;  1N5Z A;  2RN8 A;  2HCK A;  3O5Z A;  1UDL A;  1AZG B;  1X2Q A;  2KXC A;  1K0X A;  1SEM A;  1PNJ A;  4ORZ A;  2YSQ A;  2RQT A;  4M4Z A;  2PTK A;  3EHR A;  1QLY A;  2RQU A;  1OV3 A;  3EG2 A;  1BBZ A;  4J9C A;  2D0N A;  2RPN A;  4HVU A;  1K4U S;  2KRO A;  3M0P A;  3EG3 A;  1UHC A;  1YN8 A;  4HVW A;  2DM1 A;  2DRM A;  3H41 A;  4F17 A;  3VS6 A;  4Z88 A;  2HDA A;  1M8M A;  2HEQ A;  1M30 A;  2KGT A;  4OML A;  1K76 A;  5ECA A;  2O9V A;  2EW3 A;  2RQV A;  2GBQ A;  3M0U A;  2O88 A;  1K9A A;  1NLP C;  2B86 A;  2XMF A;  1T3L A;  1RLP C;  4LUD A;  2EKH A;  1WI7 A;  4J9H A;  4R0K A;  2KBT A;  4RTZ A;  3QWX X;  5FW9 A;  4RTV A;  2PZ1 A;  1QWF A;  1UUE A;  2JW4 A;  2D8J A;  5IXF A;  4J9D A;  1G2B A;  5FWB A;  2GTJ A;  2EPD A;  1WX6 A;  3NHN A;  1GFC A;  2L3Q A;  2J06 A;  5L23 A;  2JTE A;  2YUP A;  1W6X A;  4OMO A;  2HSP A;  2PNI A;  5I11 A;  3REA B;  5I22 A;  2DX1 A;  1GBR A;  1NM7 A;  1H92 A;  1CKB A;  1VYU A;  1YWP A;  4K11 A;  3UAT A;  1TG0 A;  1U3O A;  1YNZ A;  4WCI A;  1WA7 A;  1AWO A;  2F2W A;  1PKT A;  2ABL A;  2DE0 X;  2EYX A;  4JZ4 A;  4CC3 A;  2NWM A;  1MUZ A;  2ESW A;  3VS5 A;  2GGR A;  1Z9Z A;  1UJ0 A;  1MV0 B;  1PRL C;  2AZV A;  2KT1 A;  1K1Z A;  4HVV A;  1JQQ A;  1U5S A;  2OAW A;  4CC7 A;  1SHG A;  2A37 A;  4OMN A;  2FO0 A;  4AFS C;  2OJ2 A;  2IIM A;  3IQL A;  2W0Z A;  4GLM A;  2X3W D;  2GQI A;  2SEM A;  1UGV A;  2AKK A;  1I0C A;  2JXB A;  2CRE A;  2GNC A;  3VS4 A;  2A28 A;  1Z9Q A;  3I5R A;  4AFQ C;  1X6G A;  1NEG A;  3NGP A;  3I9Q A;  2CSQ A;  1Y57 A;  3KFV A;  2LCS A;  2NUZ A;  1K0S A;  1WXT A;  1RUW A;  1AD5 A;  2V1Q A;  1B3Q A;  2EQI A;  4RTT A;  3I5S A;  2C0I A;  1VYV A;  1ZLM A;  2YUN A;  3M0Q A;  1GL5 A;  4JZ3 A;  2RMO A;  4CC2 A;  1AWJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...