1Y0OA

Crystal structure of reduced atfkbp13
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
125
structure length
125
Chain Sequence
CEFSVSPSGLAFCDKVVGYGPEAVKGQLIKAHYVGKLENGKVFDSSYNRGKPLTFRIGVGEVIKGWDQGILGSDGIPPMLTGGKRTLRIPPELAYGDRGAGCKGGSCLIPPASVLLFDIEYIGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FKBP-type peptidyl-prolyl cis-trans isomerase 3
publication title Crystal structure of reduced AtFKBP13
rcsb
source organism Arabidopsis thaliana
molecule tags Isomerase
total genus 26
structure length 125
sequence length 125
chains with identical sequence B, C, D, E
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2004-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1y0oA00
3IK8A 3NI6A 3UI5A 1FJDA 2PPOA 4DRMA 4DH0A 1L1PA 4FAPA 4BF8A 2XPAA 3KCEA 4O2TA 4JFKA 1TCOC 3TDBA 4ODOA 2PV1A 3WH0A 3IKGA 1F40A 1FKIA 3KABA 2ZQVA 2XP8A 4DRHA 1YW5A 4IQCA 1J6YA 2RURA 2L2SA 3TCZA 1HXVA 4G50A 3RFWA 4ODKA 2LJ4A 3O5FA 4MGVA 4ODLA 4ODMA 3FAPA 4W9QA 1Q6HA 1U79A 3OOBA 1M5YA 3O5EA 2M1IA 1D7HA 1YATA 1D7JA 2KE0A 2XP4A 4JFMA 2ZQSA 2LGOA 2KO7A 5D75A 2MF9A 2ZR6A 2OFNA 2F2DA 2FKEA 5DIUA 3UI4A 5HW6A 1QZ2A 1PINA 3KZ7A 5B8IC 3ODKA 4U86A 5HT1A 1QPFA 2PPNA 4ITZA 5HTGA 1T11A 1ZK6A 2F21A 1NMVA 4DZ3A 2PV3A 4J4OA 2PBCA 2ITKA 5J6EA 1EQ3A 3B7XA 2DG3A 4DT4A 2UZ5A 1J4RA 2RSEA 4ODNA 3IKDA 1EYMA 3KAGA 2XP9A 3PA7A 3UQBA 1KT0A 2M08A 2XP3A 2AWGA 3LUOA 4TW8A 4DRNA 1FKRA 1D6OA 2XP6A 3I6CA 4JFIA 4TNSA 3O5MA 2ZR5A 2MLXA 5HW7A 3CGMA 4LAVA 3KAFA 2KI3A 2MPHA 4DROA 4JYSA 4JFJA 2RQSA 4DRQA 2ZQUA 1FKGA 3VAWA 1JVWA 2M2AA 2XP7A 4DRKA 2PPPA 3RGCA 3UI6A 2JZVA 2MNTA 3O5RA 4N19A 3O5LA 5GPGA 3O5QA 1FKLA 5HUAA 1FKSA 1JNTA 3KACA 4U85A 3UF8A 4ODQA 4W9PA 1NMWA 3EY6A 1F8AB 4IPXA 4DZ2A 2RUCA 1J4HA 4LAYA 4IQ2A 5DIVA 4QT2A 2MLZA 2LPVA 4NNRA 4W9OA 1J4IA 2FAPA 1Y0OA 2RUQA 3O5PA 2DG9A 4J4NA 2XPBA 4DIPA 4FN2A 4DRIA 1A7XA 1PBKA 1R9HA 2Q5AA 2D9FA 3KAHA 2MLYA 1FKJA 4LAWA 4DRJA 1C9HA 1FKKA 2DG4A 4LAXA 1W26A 3GPKA 3PRBA 4TYOA 1Q1CA 5HWBA 5HKGA 4GIVA 1P5QA 1QPLA 3JYMA 2XP5A 2F4EA 4U84A 1NSGA 1FAPA 5DITA 4ODPA 3O5GA 3TC5A 5HW8A 2IF4A 1N1AA 2KFWA 4MSPA 2KR7A 3UQAA 4TW6A 1ROUA 2ZR4A 2PV2A 2KGJA 1BL4A 2ZQTA 1FKDA 4TX0A 1D7IA 3KADA 2VN1A 3PRDA 1FKTA 3O5OA 3O5KA 1JNSA 1Q6IA 4G2PA 3UQIA 3JYJA 2Y78A 1ZCNA 1B6CA 1FKFA 3O5JA 4ODRA 3O5IA 4QT3A 4JFLA 3NTPA 4GGQA 2LKNA 2N87A 1KT1A 3NRKA 4QIBA 3O5DA 5I98A 4TW7A 4DRPA 3MDYB 2K8IA 2RUDA 3JXVA 1FD9A 3H9RB 4C02B 3KAIA 1ROTA 1Q6UA 2VCDA 3CGNA 1FKHA 3IHZA 4R0XA 5BXJA 1BKFA 5HWCA 1FKBA
chains in the Genus database with same CATH superfamily
4Z2HA 3W4RA 1LL4A 3AS1A 3ALGA 4FAPA 3TDBA 2PV1A 2PN0A 1K9TA 1IX5A 1FKIA 2ESCA 1HKMA 1H0IA 4QZVB 4IQCA 2L2SA 4DWSB 4ODMA 3FAPA 3OOBA 4WKHA 2KE0A 1W9VA 4JFMA 2ZQSA 1WNOA 2KO7A 2LGOA 5D75A 2MF9A 2ZR6A 2OFNA 3ARTA 1QPFA 2PPNA 5HTGA 1T11A 2F21A 1VF8A 1XHGA 2PBCA 1EQ3A 1OGBA 2P4VA 3IKDA 4P8UA 3UQBA 3PA7A 3WD2A 1KT0A 1NWRA 4TW8A 2WLYA 4JFIA 4KR0B 1HJVA 4MNKA 3O5MA 5GPRA 2ZR5A 3FY1A 1W9PA 3RM9A 3RMEA 2OLHA 1FKGA 3WKZA 2M2AA 3UI6A 2JZVA 1E6RA 4N19A 3WD0A 1ZBCA 2YBTA 1NMWA 1O6IA 1W1VA 2DPEA 4IQ2A 4NSBA 2DSWA 3CH9A 2RUQA 4J4NA 4DIPA 4DRIA 2G41A 1PBKA 2D9FA 1GRJA 1FKKA 2DG4A 1W26A 3B8SA 1W1YA 1Q1CA 5HWBA 1D2KA 2F4EA 1NSGA 4WKAA 3O5GA 3TC5A 2IF4A 4MSPA 1WAWA 2KR7A 3UQAA 1ROUA 2PV2A 2KGJA 2ZQTA 1NH6A 1D7IA 3KADA 1JNSA 1HKKA 3CHCA 4G2PA 2DSUA 1B6CA 3AQUA 1LQ0A 4WK9A 4TW7A 4ZS6A 3AS3A 1FD9A 3AS2A 4DWSD 3IHZA 3KAHA 3ARSA 4ZPWR 3OA5A 1FFQA 4UDMA 2DSZA 1L1PA 4P8XA 5DF0A 1TCOC 4ODOA 3WL0A 4MNMA 4MPKA 3G6LA 4DRHA 1YW5A 2RURA 3ARUA 3TCZA 3RFWA 4ODKA 1KFWA 3G6MA 3ALFA 1Q6HA 3FXYA 1M5YA 3O5EA 4MTVA 1D7HA 1D7JA 1YATA 1ZBWA 2G8ZA 5DIUA 3UI4A 1E9LA 4P8VA 1QZ2A 1PINA 1W1PA 2AOSA 4U86A 4ITZA 2A3EA 2ITKA 1ZBVA 1J4RA 2XP9A 1FKRA 2B5UB 3GU0A 3ARQA 1X6NA 1NWUA 3ARYA 1ITXA 2A3AA 4LAVA 3KAFA 4MNJA 3PRAA 2WM0A 3VAWA 3EIPA 2MNTA 3O5RA 3CHFA 3O5LA 3O5QA 1GOIA 3B9EA 3CZ8A 1FKSA 1JNTA 3KACA 1WB0A 4L3NA 2RUCA 4LAYA 4QT2A 2MLZA 2XPBA 4FN2A 1E15A 4IT4A 2WLZA 1A7XA 2Q5AA 1JNDA 2O9OA 3WIJA 5HBFA 3PRBA 3JYMA 5DITA 4Z2KA 5HW8A 4MNLA 1N1AA 1ZL1A 4TX0A 3PRDA 3ARVA 3O5KA 3UQIA 4Z2JA 1LG1A 2WK2A 4QT3A 3NTPA 4PTMA 2LKNA 4AY1A 2N87A 1KT1A 3O5DA 4Z2LA 3MDYB 4WJXA 1W9UA 1HJXA 2DSVA 3H9RB 3JXVA 4C02B 5DO2A 1ROTA 1FKHA 4R0XA 3NI6A 3UI5A 1FJDA 4DRMA 1TFVA 4DH0A 5GQBA 4BF8A 2XPAA 3QOKA 4HBOA 3IKGA 3KABA 2ZQVA 4L72B 1HXVA 1NWSA 1E6ZA 5JH8A 2LJ4A 4MGVA 2F23A 3RM8A 2M1IA 1ZBKA 2FKEA 5HW6A 3KZ7A 5B8IC 1NWTA 3ODKA 4WIWA 1E6PA 1ZK6A 4P8WA 4DZ3A 2B31A 4J4OA 5J6EA 3B7XA 2DG3A 4DT4A 3BMBA 2RSEA 4HBEA 4HARA 1EYMA 3CHDA 3LUOA 2DT0A 2M08A 4DRNA 1D6OA 3I6CA 4TNSA 2MLXA 5HW7A 3CGMA 4NZCA 2KI3A 2MPHA 4DROA 1HKJA 1H0GA 4JYSA 4JFJA 2RQSA 4DRQA 2ZQUA 2O92A 1EHNA 2XP7A 2YBUA 3ARZA 4DRKA 3B9AA 1ZU8A 3RM4A 5GPGA 2PI6A 5HUAA 4U85A 4XAKA 3UF8A 1UR9A 3B9DA 2A3BA 1F8AB 1HKIA 4DZ2A 2LPVA 4WKFA 1UR8A 2IUZA 1J4IA 2FAPA 1Y0OA 2DG9A 4MAVA 4IT6A 1X6LA 4LAWA 2MLYA 1FKJA 2DT3A 4DRJA 1C9HA 1JNEA 4LAXA 4GIVA 4U84A 2XP5A 1JCHB 1FAPA 4W5UA 3GTYX 2KFWA 1E6NA 3ARWA 2ZR4A 1BL4A 4R5EA 3AS0A 1FKTA 1Q6IA 3JYJA 1ZCNA 3O5JA 1RD6A 2DT1A 4KQZA 2QF8A 4DRPA 2VCDA 4ML4A 3IK8A 3PR9A 1BKFA 5HWCA 2EULA 1FKBA 2PPOA 1LJYA 3KCEA 4O2TA 4JFKA 3WQWA 3WH0A 1F40A 1XRVA 3BXWA 4LGXA 1CTNA 2XP8A 4ZPTR 1J6YA 4DWSC 4G50A 2FDMA 3WD1A 3O5FA 4ODLA 4W9QA 1U79A 3WD4A 4Z2GA 4Z2IA 1W1TA 4Q22A 2XP4A 2F2DA 5HT1A 1GPFA 1NMVA 4S3JA 2PV3A 2UZ5A 4ODNA 3ARRA 4DWSA 3KAGA 2XP3A 2AWGA 1LL6A 1ZB5A 2XP6A 3ARXA 4S3KA 4ZPVR 1LG2A 3WL1A 1EIBA 1SYTA 1JVWA 2PPPA 3RGCA 3AROA 4URIA 1FKLA 1E44A 4ODQA 4W9PA 1LL7A 3EY6A 4IPXA 1J4HA 5DIVA 3ARPA 3WQVA 4NNRA 4W9OA 3O5PA 3CHEA 1R9HA 2A3CA 2ETNA 5DEZA 1HJWA 3GPKA 1GUVA 4TYOA 5HKGA 1P5QA 1QPLA 3WD3A 2DT2A 4ODPA 4TW6A 1FKDA 1SR0A 2VN1A 3O5OA 1EDQA 2Y78A 1FKFA 4ODRA 3O5IA 4JFLA 4GGQA 3NRKA 4QIBA 5I98A 4Q7NA 1FFRA 2K8IA 2RUDA 3KAIA 1OGGA 1Q6UA 5BXJA 3CGNA 1OWQA
chains in the Genus database with same CATH topology
4Z2HA 3W4RA 1LL4A 3AS1A 3ALGA 4FAPA 3TDBA 2PV1A 1K9TA 1IX5A 1FKIA 2ESCA 1HKMA 1H0IA 4QZVB 4IQCA 2L2SA 4DWSB 4ODMA 3FAPA 3OOBA 4WKHA 2KE0A 1W9VA 4JFMA 2ZQSA 1WNOA 2KO7A 2LGOA 5D75A 2MF9A 2ZR6A 2OFNA 3ARTA 1QPFA 2PPNA 5HTGA 1T11A 2F21A 1VF8A 1XHGA 2PBCA 1EQ3A 1OGBA 3IKDA 4P8UA 3UQBA 3PA7A 3WD2A 1KT0A 1NWRA 4TW8A 2WLYA 4JFIA 4KR0B 1HJVA 4MNKA 3O5MA 5GPRA 2ZR5A 3FY1A 1W9PA 3RM9A 3RMEA 2OLHA 1FKGA 3WKZA 2M2AA 3UI6A 2JZVA 1E6RA 4N19A 3WD0A 1ZBCA 2YBTA 1NMWA 1O6IA 1W1VA 2DPEA 4IQ2A 4NSBA 2DSWA 3CH9A 2RUQA 4J4NA 4DIPA 4DRIA 2G41A 1PBKA 2D9FA 1FKKA 2DG4A 1W26A 3B8SA 1W1YA 1Q1CA 5HWBA 1D2KA 2F4EA 1NSGA 4WKAA 3O5GA 3TC5A 2IF4A 4MSPA 1WAWA 2KR7A 3UQAA 1ROUA 2PV2A 2KGJA 2ZQTA 1NH6A 1D7IA 3KADA 1JNSA 1HKKA 3CHCA 4G2PA 2DSUA 1B6CA 3AQUA 1LQ0A 4WK9A 4TW7A 4ZS6A 3AS3A 1FD9A 3AS2A 4DWSD 3IHZA 3KAHA 3ARSA 4ZPWR 3OA5A 1FFQA 2DSZA 1L1PA 4P8XA 5DF0A 1TCOC 4ODOA 3WL0A 4MNMA 4MPKA 3G6LA 4DRHA 1YW5A 2RURA 3ARUA 3TCZA 3RFWA 4ODKA 1KFWA 3G6MA 3ALFA 1Q6HA 3FXYA 1M5YA 3O5EA 4MTVA 1D7HA 1D7JA 1YATA 1ZBWA 2G8ZA 5DIUA 3UI4A 1E9LA 4P8VA 1QZ2A 1PINA 1W1PA 2AOSA 4U86A 4ITZA 2A3EA 2ITKA 1ZBVA 1J4RA 2XP9A 1FKRA 3ARQA 1X6NA 1NWUA 3ARYA 1ITXA 2A3AA 4LAVA 3KAFA 4MNJA 3PRAA 2WM0A 3VAWA 2MNTA 3O5RA 3CHFA 3O5LA 3O5QA 1GOIA 3B9EA 3CZ8A 1FKSA 1JNTA 3KACA 1WB0A 4L3NA 2RUCA 4LAYA 4QT2A 2MLZA 2XPBA 4FN2A 1E15A 4IT4A 2WLZA 1A7XA 2Q5AA 1JNDA 2O9OA 3WIJA 5HBFA 3PRBA 3JYMA 5DITA 4Z2KA 5HW8A 4MNLA 1N1AA 1ZL1A 4TX0A 3PRDA 3ARVA 3O5KA 3UQIA 4Z2JA 1LG1A 2WK2A 4QT3A 3NTPA 4PTMA 2LKNA 4AY1A 2N87A 1KT1A 3O5DA 4Z2LA 3MDYB 4WJXA 1W9UA 1HJXA 2DSVA 3H9RB 3JXVA 4C02B 5DO2A 1ROTA 1FKHA 4R0XA 3NI6A 3UI5A 1FJDA 4DRMA 1TFVA 4DH0A 5GQBA 4BF8A 2XPAA 3QOKA 4HBOA 3IKGA 3KABA 2ZQVA 4L72B 1HXVA 1NWSA 1E6ZA 5JH8A 2LJ4A 4MGVA 3RM8A 2M1IA 1ZBKA 2FKEA 5HW6A 3KZ7A 5B8IC 1NWTA 3ODKA 4WIWA 1E6PA 1ZK6A 4P8WA 4DZ3A 2B31A 4J4OA 5J6EA 3B7XA 2DG3A 4DT4A 2RSEA 4HBEA 4HARA 1EYMA 3CHDA 3LUOA 2DT0A 2M08A 4DRNA 1D6OA 3I6CA 4TNSA 2MLXA 5HW7A 3CGMA 4NZCA 2KI3A 2MPHA 4DROA 1HKJA 1H0GA 4JYSA 4JFJA 2RQSA 4DRQA 2ZQUA 2O92A 1EHNA 2XP7A 2YBUA 3ARZA 4DRKA 3B9AA 1ZU8A 3RM4A 5GPGA 2PI6A 5HUAA 4U85A 4XAKA 3UF8A 1UR9A 3B9DA 2A3BA 1F8AB 1HKIA 4DZ2A 2LPVA 4WKFA 1UR8A 2IUZA 1J4IA 2FAPA 1Y0OA 2DG9A 4MAVA 4IT6A 1X6LA 4LAWA 2MLYA 1FKJA 2DT3A 4DRJA 1C9HA 1JNEA 4LAXA 4GIVA 4U84A 2XP5A 1FAPA 4W5UA 2KFWA 1E6NA 3ARWA 2ZR4A 1BL4A 4R5EA 3AS0A 1FKTA 1Q6IA 3JYJA 1ZCNA 3O5JA 1RD6A 2DT1A 4KQZA 2QF8A 4DRPA 2VCDA 4ML4A 3IK8A 3PR9A 1BKFA 5HWCA 1FKBA 2PPOA 1LJYA 3KCEA 4O2TA 4JFKA 3WQWA 3WH0A 1F40A 1XRVA 3BXWA 4LGXA 1CTNA 2XP8A 4ZPTR 1J6YA 4DWSC 4G50A 2FDMA 3WD1A 3O5FA 4ODLA 4W9QA 1U79A 3WD4A 4Z2GA 4Z2IA 1W1TA 4Q22A 2XP4A 2F2DA 5HT1A 1GPFA 1NMVA 4S3JA 2PV3A 2UZ5A 4ODNA 3ARRA 4DWSA 3KAGA 2XP3A 2AWGA 1LL6A 1ZB5A 2XP6A 3ARXA 4S3KA 4ZPVR 1LG2A 3WL1A 1EIBA 1SYTA 1JVWA 2PPPA 3RGCA 3AROA 4URIA 1FKLA 4ODQA 4W9PA 1LL7A 3EY6A 4IPXA 1J4HA 5DIVA 3ARPA 3WQVA 4NNRA 4W9OA 3O5PA 3CHEA 1R9HA 2A3CA 5DEZA 1HJWA 3GPKA 1GUVA 4TYOA 5HKGA 1P5QA 1QPLA 3WD3A 2DT2A 4ODPA 4TW6A 1FKDA 1SR0A 2VN1A 3O5OA 1EDQA 2Y78A 1FKFA 4ODRA 3O5IA 4JFLA 4GGQA 3NRKA 4QIBA 5I98A 4Q7NA 1FFRA 2K8IA 2RUDA 3KAIA 1OGGA 1Q6UA 5BXJA 3CGNA 1OWQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IK8 A;  3NI6 A;  3UI5 A;  1FJD A;  2PPO A;  4DRM A;  4DH0 A;  1L1P A;  4FAP A;  4BF8 A;  2XPA A;  3KCE A;  4O2T A;  4JFK A;  1TCO C;  3TDB A;  4ODO A;  2PV1 A;  3WH0 A;  3IKG A;  1F40 A;  1FKI A;  3KAB A;  2ZQV A;  2XP8 A;  4DRH A;  1YW5 A;  4IQC A;  1J6Y A;  2RUR A;  2L2S A;  3TCZ A;  1HXV A;  4G50 A;  3RFW A;  4ODK A;  2LJ4 A;  3O5F A;  4MGV A;  4ODL A;  4ODM A;  3FAP A;  4W9Q A;  1Q6H A;  1U79 A;  3OOB A;  1M5Y A;  3O5E A;  2M1I A;  1D7H A;  1YAT A;  1D7J A;  2KE0 A;  2XP4 A;  4JFM A;  2ZQS A;  2LGO A;  2KO7 A;  5D75 A;  2MF9 A;  2ZR6 A;  2OFN A;  2F2D A;  2FKE A;  5DIU A;  3UI4 A;  5HW6 A;  1QZ2 A;  1PIN A;  3KZ7 A;  5B8I C;  3ODK A;  4U86 A;  5HT1 A;  1QPF A;  2PPN A;  4ITZ A;  5HTG A;  1T11 A;  1ZK6 A;  2F21 A;  1NMV A;  4DZ3 A;  2PV3 A;  4J4O A;  2PBC A;  2ITK A;  5J6E A;  1EQ3 A;  3B7X A;  2DG3 A;  4DT4 A;  2UZ5 A;  1J4R A;  2RSE A;  4ODN A;  3IKD A;  1EYM A;  3KAG A;  2XP9 A;  3PA7 A;  3UQB A;  1KT0 A;  2M08 A;  2XP3 A;  2AWG A;  3LUO A;  4TW8 A;  4DRN A;  1FKR A;  1D6O A;  2XP6 A;  3I6C A;  4JFI A;  4TNS A;  3O5M A;  2ZR5 A;  2MLX A;  5HW7 A;  3CGM A;  4LAV A;  3KAF A;  2KI3 A;  2MPH A;  4DRO A;  4JYS A;  4JFJ A;  2RQS A;  4DRQ A;  2ZQU A;  1FKG A;  3VAW A;  1JVW A;  2M2A A;  2XP7 A;  4DRK A;  2PPP A;  3RGC A;  3UI6 A;  2JZV A;  2MNT A;  3O5R A;  4N19 A;  3O5L A;  5GPG A;  3O5Q A;  1FKL A;  5HUA A;  1FKS A;  1JNT A;  3KAC A;  4U85 A;  3UF8 A;  4ODQ A;  4W9P A;  1NMW A;  3EY6 A;  1F8A B;  4IPX A;  4DZ2 A;  2RUC A;  1J4H A;  4LAY A;  4IQ2 A;  5DIV A;  4QT2 A;  2MLZ A;  2LPV A;  4NNR A;  4W9O A;  1J4I A;  2FAP A;  1Y0O A;  2RUQ A;  3O5P A;  2DG9 A;  4J4N A;  2XPB A;  4DIP A;  4FN2 A;  4DRI A;  1A7X A;  1PBK A;  1R9H A;  2Q5A A;  2D9F A;  3KAH A;  2MLY A;  1FKJ A;  4LAW A;  4DRJ A;  1C9H A;  1FKK A;  2DG4 A;  4LAX A;  1W26 A;  3GPK A;  3PRB A;  4TYO A;  1Q1C A;  5HWB A;  5HKG A;  4GIV A;  1P5Q A;  1QPL A;  3JYM A;  2XP5 A;  2F4E A;  4U84 A;  1NSG A;  1FAP A;  5DIT A;  4ODP A;  3O5G A;  3TC5 A;  5HW8 A;  2IF4 A;  1N1A A;  2KFW A;  4MSP A;  2KR7 A;  3UQA A;  4TW6 A;  1ROU A;  2ZR4 A;  2PV2 A;  2KGJ A;  1BL4 A;  2ZQT A;  1FKD A;  4TX0 A;  1D7I A;  3KAD A;  2VN1 A;  3PRD A;  1FKT A;  3O5O A;  3O5K A;  1JNS A;  1Q6I A;  4G2P A;  3UQI A;  3JYJ A;  2Y78 A;  1ZCN A;  1B6C A;  1FKF A;  3O5J A;  4ODR A;  3O5I A;  4QT3 A;  4JFL A;  3NTP A;  4GGQ A;  2LKN A;  2N87 A;  1KT1 A;  3NRK A;  4QIB A;  3O5D A;  5I98 A;  4TW7 A;  4DRP A;  3MDY B;  2K8I A;  2RUD A;  3JXV A;  1FD9 A;  3H9R B;  4C02 B;  3KAI A;  1ROT A;  1Q6U A;  2VCD A;  3CGN A;  1FKH A;  3IHZ A;  4R0X A;  5BXJ A;  1BKF A;  5HWC A;  1FKB A; 
#chains in the Genus database with same CATH topology
 4Z2H A;  3W4R A;  1LL4 A;  3AS1 A;  3ALG A;  4FAP A;  3TDB A;  2PV1 A;  2PN0 A;  1K9T A;  1IX5 A;  1FKI A;  2ESC A;  1HKM A;  1H0I A;  4QZV B;  4IQC A;  2L2S A;  4DWS B;  4ODM A;  3FAP A;  3OOB A;  4WKH A;  2KE0 A;  1W9V A;  4JFM A;  2ZQS A;  1WNO A;  2KO7 A;  2LGO A;  5D75 A;  2MF9 A;  2ZR6 A;  2OFN A;  3ART A;  1QPF A;  2PPN A;  5HTG A;  1T11 A;  2F21 A;  1VF8 A;  1XHG A;  2PBC A;  1EQ3 A;  1OGB A;  2P4V A;  3IKD A;  4P8U A;  3UQB A;  3PA7 A;  3WD2 A;  1KT0 A;  1NWR A;  4TW8 A;  2WLY A;  4JFI A;  4KR0 B;  1HJV A;  4MNK A;  3O5M A;  5GPR A;  2ZR5 A;  3FY1 A;  1W9P A;  3RM9 A;  3RME A;  2OLH A;  1FKG A;  3WKZ A;  2M2A A;  3UI6 A;  2JZV A;  1E6R A;  4N19 A;  3WD0 A;  1ZBC A;  2YBT A;  1NMW A;  1O6I A;  1W1V A;  2DPE A;  4IQ2 A;  4NSB A;  2DSW A;  3CH9 A;  2RUQ A;  4J4N A;  4DIP A;  4DRI A;  2G41 A;  1PBK A;  2D9F A;  1GRJ A;  1FKK A;  2DG4 A;  1W26 A;  3B8S A;  1W1Y A;  1Q1C A;  5HWB A;  1D2K A;  2F4E A;  1NSG A;  4WKA A;  3O5G A;  3TC5 A;  2IF4 A;  4MSP A;  1WAW A;  2KR7 A;  3UQA A;  1ROU A;  2PV2 A;  2KGJ A;  2ZQT A;  1NH6 A;  1D7I A;  3KAD A;  1JNS A;  1HKK A;  3CHC A;  4G2P A;  2DSU A;  1B6C A;  3AQU A;  1LQ0 A;  4WK9 A;  4TW7 A;  4ZS6 A;  3AS3 A;  1FD9 A;  3AS2 A;  4DWS D;  3IHZ A;  3KAH A;  3ARS A;  4ZPW R;  3OA5 A;  1FFQ A;  4UDM A;  2DSZ A;  1L1P A;  4P8X A;  5DF0 A;  1TCO C;  4ODO A;  3WL0 A;  4MNM A;  4MPK A;  3G6L A;  4DRH A;  1YW5 A;  2RUR A;  3ARU A;  3TCZ A;  3RFW A;  4ODK A;  1KFW A;  3G6M A;  3ALF A;  1Q6H A;  3FXY A;  1M5Y A;  3O5E A;  4MTV A;  1D7H A;  1D7J A;  1YAT A;  1ZBW A;  2G8Z A;  5DIU A;  3UI4 A;  1E9L A;  4P8V A;  1QZ2 A;  1PIN A;  1W1P A;  2AOS A;  4U86 A;  4ITZ A;  2A3E A;  2ITK A;  1ZBV A;  1J4R A;  2XP9 A;  1FKR A;  2B5U B;  3GU0 A;  3ARQ A;  1X6N A;  1NWU A;  3ARY A;  1ITX A;  2A3A A;  4LAV A;  3KAF A;  4MNJ A;  3PRA A;  2WM0 A;  3VAW A;  3EIP A;  2MNT A;  3O5R A;  3CHF A;  3O5L A;  3O5Q A;  1GOI A;  3B9E A;  3CZ8 A;  1FKS A;  1JNT A;  3KAC A;  1WB0 A;  4L3N A;  2RUC A;  4LAY A;  4QT2 A;  2MLZ A;  2XPB A;  4FN2 A;  1E15 A;  4IT4 A;  2WLZ A;  1A7X A;  2Q5A A;  1JND A;  2O9O A;  3WIJ A;  5HBF A;  3PRB A;  3JYM A;  5DIT A;  4Z2K A;  5HW8 A;  4MNL A;  1N1A A;  1ZL1 A;  4TX0 A;  3PRD A;  3ARV A;  3O5K A;  3UQI A;  4Z2J A;  1LG1 A;  2WK2 A;  4QT3 A;  3NTP A;  4PTM A;  2LKN A;  4AY1 A;  2N87 A;  1KT1 A;  3O5D A;  4Z2L A;  3MDY B;  4WJX A;  1W9U A;  1HJX A;  2DSV A;  3H9R B;  3JXV A;  4C02 B;  5DO2 A;  1ROT A;  1FKH A;  4R0X A;  3NI6 A;  3UI5 A;  1FJD A;  4DRM A;  1TFV A;  4DH0 A;  5GQB A;  4BF8 A;  2XPA A;  3QOK A;  4HBO A;  3IKG A;  3KAB A;  2ZQV A;  4L72 B;  1HXV A;  1NWS A;  1E6Z A;  5JH8 A;  2LJ4 A;  4MGV A;  2F23 A;  3RM8 A;  2M1I A;  1ZBK A;  2FKE A;  5HW6 A;  3KZ7 A;  5B8I C;  1NWT A;  3ODK A;  4WIW A;  1E6P A;  1ZK6 A;  4P8W A;  4DZ3 A;  2B31 A;  4J4O A;  5J6E A;  3B7X A;  2DG3 A;  4DT4 A;  3BMB A;  2RSE A;  4HBE A;  4HAR A;  1EYM A;  3CHD A;  3LUO A;  2DT0 A;  2M08 A;  4DRN A;  1D6O A;  3I6C A;  4TNS A;  2MLX A;  5HW7 A;  3CGM A;  4NZC A;  2KI3 A;  2MPH A;  4DRO A;  1HKJ A;  1H0G A;  4JYS A;  4JFJ A;  2RQS A;  4DRQ A;  2ZQU A;  2O92 A;  1EHN A;  2XP7 A;  2YBU A;  3ARZ A;  4DRK A;  3B9A A;  1ZU8 A;  3RM4 A;  5GPG A;  2PI6 A;  5HUA A;  4U85 A;  4XAK A;  3UF8 A;  1UR9 A;  3B9D A;  2A3B A;  1F8A B;  1HKI A;  4DZ2 A;  2LPV A;  4WKF A;  1UR8 A;  2IUZ A;  1J4I A;  2FAP A;  1Y0O A;  2DG9 A;  4MAV A;  4IT6 A;  1X6L A;  4LAW A;  2MLY A;  1FKJ A;  2DT3 A;  4DRJ A;  1C9H A;  1JNE A;  4LAX A;  4GIV A;  4U84 A;  2XP5 A;  1JCH B;  1FAP A;  4W5U A;  3GTY X;  2KFW A;  1E6N A;  3ARW A;  2ZR4 A;  1BL4 A;  4R5E A;  3AS0 A;  1FKT A;  1Q6I A;  3JYJ A;  1ZCN A;  3O5J A;  1RD6 A;  2DT1 A;  4KQZ A;  2QF8 A;  4DRP A;  2VCD A;  4ML4 A;  3IK8 A;  3PR9 A;  1BKF A;  5HWC A;  2EUL A;  1FKB A;  2PPO A;  1LJY A;  3KCE A;  4O2T A;  4JFK A;  3WQW A;  3WH0 A;  1F40 A;  1XRV A;  3BXW A;  4LGX A;  1CTN A;  2XP8 A;  4ZPT R;  1J6Y A;  4DWS C;  4G50 A;  2FDM A;  3WD1 A;  3O5F A;  4ODL A;  4W9Q A;  1U79 A;  3WD4 A;  4Z2G A;  4Z2I A;  1W1T A;  4Q22 A;  2XP4 A;  2F2D A;  5HT1 A;  1GPF A;  1NMV A;  4S3J A;  2PV3 A;  2UZ5 A;  4ODN A;  3ARR A;  4DWS A;  3KAG A;  2XP3 A;  2AWG A;  1LL6 A;  1ZB5 A;  2XP6 A;  3ARX A;  4S3K A;  4ZPV R;  1LG2 A;  3WL1 A;  1EIB A;  1SYT A;  1JVW A;  2PPP A;  3RGC A;  3ARO A;  4URI A;  1FKL A;  1E44 A;  4ODQ A;  4W9P A;  1LL7 A;  3EY6 A;  4IPX A;  1J4H A;  5DIV A;  3ARP A;  3WQV A;  4NNR A;  4W9O A;  3O5P A;  3CHE A;  1R9H A;  2A3C A;  2ETN A;  5DEZ A;  1HJW A;  3GPK A;  1GUV A;  4TYO A;  5HKG A;  1P5Q A;  1QPL A;  3WD3 A;  2DT2 A;  4ODP A;  4TW6 A;  1FKD A;  1SR0 A;  2VN1 A;  3O5O A;  1EDQ A;  2Y78 A;  1FKF A;  4ODR A;  3O5I A;  4JFL A;  4GGQ A;  3NRK A;  4QIB A;  5I98 A;  4Q7N A;  1FFR A;  2K8I A;  2RUD A;  3KAI A;  1OGG A;  1Q6U A;  5BXJ A;  3CGN A;  1OWQ A; 
#chains in the Genus database with same CATH homology
 4Z2H A;  3W4R A;  1LL4 A;  3AS1 A;  3ALG A;  4FAP A;  3TDB A;  2PV1 A;  1K9T A;  1IX5 A;  1FKI A;  2ESC A;  1HKM A;  1H0I A;  4QZV B;  4IQC A;  2L2S A;  4DWS B;  4ODM A;  3FAP A;  3OOB A;  4WKH A;  2KE0 A;  1W9V A;  4JFM A;  2ZQS A;  1WNO A;  2KO7 A;  2LGO A;  5D75 A;  2MF9 A;  2ZR6 A;  2OFN A;  3ART A;  1QPF A;  2PPN A;  5HTG A;  1T11 A;  2F21 A;  1VF8 A;  1XHG A;  2PBC A;  1EQ3 A;  1OGB A;  3IKD A;  4P8U A;  3UQB A;  3PA7 A;  3WD2 A;  1KT0 A;  1NWR A;  4TW8 A;  2WLY A;  4JFI A;  4KR0 B;  1HJV A;  4MNK A;  3O5M A;  5GPR A;  2ZR5 A;  3FY1 A;  1W9P A;  3RM9 A;  3RME A;  2OLH A;  1FKG A;  3WKZ A;  2M2A A;  3UI6 A;  2JZV A;  1E6R A;  4N19 A;  3WD0 A;  1ZBC A;  2YBT A;  1NMW A;  1O6I A;  1W1V A;  2DPE A;  4IQ2 A;  4NSB A;  2DSW A;  3CH9 A;  2RUQ A;  4J4N A;  4DIP A;  4DRI A;  2G41 A;  1PBK A;  2D9F A;  1FKK A;  2DG4 A;  1W26 A;  3B8S A;  1W1Y A;  1Q1C A;  5HWB A;  1D2K A;  2F4E A;  1NSG A;  4WKA A;  3O5G A;  3TC5 A;  2IF4 A;  4MSP A;  1WAW A;  2KR7 A;  3UQA A;  1ROU A;  2PV2 A;  2KGJ A;  2ZQT A;  1NH6 A;  1D7I A;  3KAD A;  1JNS A;  1HKK A;  3CHC A;  4G2P A;  2DSU A;  1B6C A;  3AQU A;  1LQ0 A;  4WK9 A;  4TW7 A;  4ZS6 A;  3AS3 A;  1FD9 A;  3AS2 A;  4DWS D;  3IHZ A;  3KAH A;  3ARS A;  4ZPW R;  3OA5 A;  1FFQ A;  2DSZ A;  1L1P A;  4P8X A;  5DF0 A;  1TCO C;  4ODO A;  3WL0 A;  4MNM A;  4MPK A;  3G6L A;  4DRH A;  1YW5 A;  2RUR A;  3ARU A;  3TCZ A;  3RFW A;  4ODK A;  1KFW A;  3G6M A;  3ALF A;  1Q6H A;  3FXY A;  1M5Y A;  3O5E A;  4MTV A;  1D7H A;  1D7J A;  1YAT A;  1ZBW A;  2G8Z A;  5DIU A;  3UI4 A;  1E9L A;  4P8V A;  1QZ2 A;  1PIN A;  1W1P A;  2AOS A;  4U86 A;  4ITZ A;  2A3E A;  2ITK A;  1ZBV A;  1J4R A;  2XP9 A;  1FKR A;  3ARQ A;  1X6N A;  1NWU A;  3ARY A;  1ITX A;  2A3A A;  4LAV A;  3KAF A;  4MNJ A;  3PRA A;  2WM0 A;  3VAW A;  2MNT A;  3O5R A;  3CHF A;  3O5L A;  3O5Q A;  1GOI A;  3B9E A;  3CZ8 A;  1FKS A;  1JNT A;  3KAC A;  1WB0 A;  4L3N A;  2RUC A;  4LAY A;  4QT2 A;  2MLZ A;  2XPB A;  4FN2 A;  1E15 A;  4IT4 A;  2WLZ A;  1A7X A;  2Q5A A;  1JND A;  2O9O A;  3WIJ A;  5HBF A;  3PRB A;  3JYM A;  5DIT A;  4Z2K A;  5HW8 A;  4MNL A;  1N1A A;  1ZL1 A;  4TX0 A;  3PRD A;  3ARV A;  3O5K A;  3UQI A;  4Z2J A;  1LG1 A;  2WK2 A;  4QT3 A;  3NTP A;  4PTM A;  2LKN A;  4AY1 A;  2N87 A;  1KT1 A;  3O5D A;  4Z2L A;  3MDY B;  4WJX A;  1W9U A;  1HJX A;  2DSV A;  3H9R B;  3JXV A;  4C02 B;  5DO2 A;  1ROT A;  1FKH A;  4R0X A;  3NI6 A;  3UI5 A;  1FJD A;  4DRM A;  1TFV A;  4DH0 A;  5GQB A;  4BF8 A;  2XPA A;  3QOK A;  4HBO A;  3IKG A;  3KAB A;  2ZQV A;  4L72 B;  1HXV A;  1NWS A;  1E6Z A;  5JH8 A;  2LJ4 A;  4MGV A;  3RM8 A;  2M1I A;  1ZBK A;  2FKE A;  5HW6 A;  3KZ7 A;  5B8I C;  1NWT A;  3ODK A;  4WIW A;  1E6P A;  1ZK6 A;  4P8W A;  4DZ3 A;  2B31 A;  4J4O A;  5J6E A;  3B7X A;  2DG3 A;  4DT4 A;  2RSE A;  4HBE A;  4HAR A;  1EYM A;  3CHD A;  3LUO A;  2DT0 A;  2M08 A;  4DRN A;  1D6O A;  3I6C A;  4TNS A;  2MLX A;  5HW7 A;  3CGM A;  4NZC A;  2KI3 A;  2MPH A;  4DRO A;  1HKJ A;  1H0G A;  4JYS A;  4JFJ A;  2RQS A;  4DRQ A;  2ZQU A;  2O92 A;  1EHN A;  2XP7 A;  2YBU A;  3ARZ A;  4DRK A;  3B9A A;  1ZU8 A;  3RM4 A;  5GPG A;  2PI6 A;  5HUA A;  4U85 A;  4XAK A;  3UF8 A;  1UR9 A;  3B9D A;  2A3B A;  1F8A B;  1HKI A;  4DZ2 A;  2LPV A;  4WKF A;  1UR8 A;  2IUZ A;  1J4I A;  2FAP A;  1Y0O A;  2DG9 A;  4MAV A;  4IT6 A;  1X6L A;  4LAW A;  2MLY A;  1FKJ A;  2DT3 A;  4DRJ A;  1C9H A;  1JNE A;  4LAX A;  4GIV A;  4U84 A;  2XP5 A;  1FAP A;  4W5U A;  2KFW A;  1E6N A;  3ARW A;  2ZR4 A;  1BL4 A;  4R5E A;  3AS0 A;  1FKT A;  1Q6I A;  3JYJ A;  1ZCN A;  3O5J A;  1RD6 A;  2DT1 A;  4KQZ A;  2QF8 A;  4DRP A;  2VCD A;  4ML4 A;  3IK8 A;  3PR9 A;  1BKF A;  5HWC A;  1FKB A;  2PPO A;  1LJY A;  3KCE A;  4O2T A;  4JFK A;  3WQW A;  3WH0 A;  1F40 A;  1XRV A;  3BXW A;  4LGX A;  1CTN A;  2XP8 A;  4ZPT R;  1J6Y A;  4DWS C;  4G50 A;  2FDM A;  3WD1 A;  3O5F A;  4ODL A;  4W9Q A;  1U79 A;  3WD4 A;  4Z2G A;  4Z2I A;  1W1T A;  4Q22 A;  2XP4 A;  2F2D A;  5HT1 A;  1GPF A;  1NMV A;  4S3J A;  2PV3 A;  2UZ5 A;  4ODN A;  3ARR A;  4DWS A;  3KAG A;  2XP3 A;  2AWG A;  1LL6 A;  1ZB5 A;  2XP6 A;  3ARX A;  4S3K A;  4ZPV R;  1LG2 A;  3WL1 A;  1EIB A;  1SYT A;  1JVW A;  2PPP A;  3RGC A;  3ARO A;  4URI A;  1FKL A;  4ODQ A;  4W9P A;  1LL7 A;  3EY6 A;  4IPX A;  1J4H A;  5DIV A;  3ARP A;  3WQV A;  4NNR A;  4W9O A;  3O5P A;  3CHE A;  1R9H A;  2A3C A;  5DEZ A;  1HJW A;  3GPK A;  1GUV A;  4TYO A;  5HKG A;  1P5Q A;  1QPL A;  3WD3 A;  2DT2 A;  4ODP A;  4TW6 A;  1FKD A;  1SR0 A;  2VN1 A;  3O5O A;  1EDQ A;  2Y78 A;  1FKF A;  4ODR A;  3O5I A;  4JFL A;  4GGQ A;  3NRK A;  4QIB A;  5I98 A;  4Q7N A;  1FFR A;  2K8I A;  2RUD A;  3KAI A;  1OGG A;  1Q6U A;  5BXJ A;  3CGN A;  1OWQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...