1Y0OA

Crystal structure of reduced atfkbp13
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
125
structure length
125
Chain Sequence
CEFSVSPSGLAFCDKVVGYGPEAVKGQLIKAHYVGKLENGKVFDSSYNRGKPLTFRIGVGEVIKGWDQGILGSDGIPPMLTGGKRTLRIPPELAYGDRGAGCKGGSCLIPPASVLLFDIEYIGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of reduced AtFKBP13
rcsb
source organism Arabidopsis thaliana
molecule tags Isomerase
molecule keywords FKBP-type peptidyl-prolyl cis-trans isomerase 3
total genus 26
structure length 125
sequence length 125
chains with identical sequence B, C, D, E
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2004-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1y0oA00
1JVWA 3OOBA 3IKGA 1PBKA 3FAPA 2RURA 2M1IA 3KADA 1P5QA 5DITA 3ODKA 4IQ2A 2LKNA 2DG3A 2RQSA 5DIUA 4QT2A 4JFMA 2PPNA 1Y0OA 4DRJA 2PBCA 2ITKA 3JYJA 1FKHA 4GIVA 3IHZA 4QT3A 4R0XA 3IKDA 2KO7A 2MF9A 2XP7A 3IK8A 3KZ7A 2XP9A 4LAVA 2F4EA 5J6EA 3O5DA 3UQAA 1PINA 1A7XA 1KT0A 3I6CA 1YATA 4W9QA 3PRDA 3UI5A 2DG9A 5BXJA 2XP8A 5HKGA 2RUQA 2PPPA 3UI4A 4DIPA 1QZ2A 3KAIA 4DRMA 3JXVA 3KAFA 2MLZA 2M08A 3JYMA 4N19A 5HW8A 2ZR5A 1ROUA 4W9OA 4DRHA 3TCZA 3O5QA 1FKTA 1BKFA 2PPOA 1N1AA 3VAWA 2ZQUA 2MNTA 1J6YA 1QPLA 4DH0A 2IF4A 3O5KA 4DRIA 2XPBA 5I98A 2MLYA 1FJDA 1B6CA 2ZR4A 3UQIA 2ZR6A 4ODPA 4TW6A 4W9PA 4G50A 3UI6A 1FKJA 4TW8A 4DZ2A 3O5LA 3LUOA 3RGCA 2XP5A 3O5EA 2XP6A 2N87A 1FKSA 2Q5AA 1ZK6A 1Q1CA 1NSGA 4QIBA 3O5JA 1FKGA 3H9RB 3NRKA 3O5OA 5HUAA 2D9FA 1C9HA 2XPAA 4ODQA 3CGMA 1TCOC 3UQBA 2VN1A 2KE0A 2KFWA 1FKIA 2Y78A 3NI6A 5D75A 4LAYA 3RFWA 4GGQA 1F8AB 1FAPA 1D6OA 4FN2A 5HT1A 3TC5A 2L2SA 3NTPA 3O5GA 4LAXA 4JFIA 2UZ5A 4TNSA 1T11A 4DRKA 5B8IC 3O5FA 1QPFA 4BF8A 2VCDA 4MSPA 1ZCNA 4U85A 2ZQTA 1D7JA 2MPHA 3KACA 5HW7A 2PV1A 4U84A 3WH0A 1U79A 4DZ3A 1JNSA 2DG4A 3O5IA 1Q6UA 2FKEA 1YW5A 3MDYB 1FKFA 2JZVA 2XP3A 4TW7A 2K8IA 3KAGA 4JYSA 1FKLA 4ODOA 2KR7A 2RUDA 4JFLA 3UF8A 1F40A 4DT4A 1J4IA 1BL4A 1EYMA 1FKDA 4FAPA 4JFKA 1R9HA 2F21A 1J4RA 3O5RA 4LAWA 2RSEA 1Q6IA 1L1PA 1ROTA 1J4HA 2ZQSA 3KAHA 3PRBA 1FKKA 5HW6A 4C02B 1KT1A 3KCEA 2KGJA 1NMVA 2KI3A 2XP4A 4JFJA 1JNTA 1W26A 2LGOA 3O5PA 4NNRA 4TYOA 3CGNA 1M5YA 4ODMA 3TDBA 1D7HA 5DIVA 1Q6HA 2PV2A 1FKBA 3KABA 1EQ3A 5HWBA 4TX0A 4ITZA 4DRQA 4DRPA 3B7XA 1NMWA 1FD9A 3O5MA 3PA7A 2FAPA 2M2AA 4J4OA 4ODRA 5HTGA 4ODKA 1HXVA 4DROA 1FKRA 2LPVA 3EY6A 4U86A 4J4NA 4MGVA 4IPXA 2ZQVA 3GPKA 2RUCA 4O2TA 5GPGA 4ODNA 2AWGA 4ODLA 2LJ4A 2MLXA 2F2DA 4G2PA 4IQCA 4DRNA 1D7IA 5HWCA 2PV3A 2OFNA
chains in the Genus database with same CATH superfamily
4HBOA 4ZPTR 3KADA 4WJXA 2RQSA 1OWQA 4Z2LA 3ARWA 4QT3A 5JH8A 1E9LA 5GPRA 2XP7A 2EULA 3WD4A 2F4EA 5J6EA 1PINA 1A7XA 3GU0A 2DG9A 1JNDA 1QZ2A 3KAIA 1D2KA 2MLZA 4ZPWR 1WAWA 2F23A 3JYMA 2DSZA 2YBTA 3AS1A 4DRHA 4ML4A 3ARPA 4WKFA 4L3NA 3CHEA 1FJDA 1H0GA 1HJXA 1WB0A 1FKJA 3O5LA 3ARUA 2XP6A 1ZK6A 1Q1CA 4QIBA 4ZS6A 1FKGA 4IT4A 3NRKA 1TCOC 1WNOA 2KE0A 3FXYA 2Y78A 3NI6A 4GGQA 1FAPA 2PI6A 4Q7NA 4LAXA 2UZ5A 3AQUA 4Z2HA 3ALGA 1W1VA 3CH9A 1JNSA 2O9OA 3BXWA 4TW7A 3KAGA 1FKLA 1GRJA 1ITXA 1LQ0A 4MNLA 4MNJA 1EYMA 1TFVA 4DT4A 1R9HA 2F21A 1UR9A 3PRBA 3KAHA 1GPFA 2XP4A 3BMBA 3O5PA 1M5YA 2PV2A 3KABA 5HWBA 2B31A 3ARTA 3OA5A 4DRQA 3B9EA 4J4OA 4DROA 4DWSD 2P4VA 1XHGA 4U86A 4O2TA 2ZQVA 1E6PA 2RUCA 5GPGA 3AS0A 2F2DA 4IQCA 5HWCA 2PV3A 4Q22A 2OFNA 5I98A 3PR9A 3OOBA 3WL0A 1PBKA 3ARSA 1E44A 2RURA 2M1IA 3B9DA 5DITA 2DG3A 4JFMA 1Y0OA 2PBCA 1HJWA 2ITKA 3IHZA 1HKIA 2KO7A 4WKHA 3WD3A 3IK8A 3KZ7A 2ESCA 4HBEA 1NWSA 3UI5A 4MNKA 2XP8A 2RUQA 1W9UA 4N19A 5DO2A 1ROUA 3CHCA 3ARZA 4P8XA 2PPOA 1BKFA 3VAWA 1N1AA 1VF8A 2ZQUA 2MNTA 3ARXA 1J6YA 1QPLA 4DH0A 2IF4A 3O5KA 4DRIA 2ZR4A 3UQIA 2ZR6A 1CTNA 4TW8A 3LUOA 1ZU8A 2XP5A 1EDQA 2A3BA 2DT1A 1NSGA 4ZPVR 3O5JA 3ALFA 4Z2KA 5HUAA 1E15A 1C9HA 3AS3A 2XPAA 3CGMA 2VN1A 4S3KA 2KFWA 1FKIA 5D75A 4UDMA 4KR0B 1LG2A 1F8AB 1LL4A 4Z2IA 4DRKA 4TNSA 1QPFA 4BF8A 2VCDA 4U85A 2ZQTA 3WKZA 2MPHA 4PTMA 3WH0A 2QF8A 1ZBCA 1ZBKA 3RM8A 4WK9A 2OLHA 1Q6UA 2XP3A 2K8IA 3RM9A 4JYSA 1EHNA 4Z2JA 1J4IA 1NWTA 4JFKA 1W1PA 5HW6A 1HKMA 1W9VA 4JFJA 3ARYA 1JNTA 1E6RA 1W26A 4TYOA 2G41A 2ETNA 4ITZA 1NMWA 3ARRA 4ODRA 4ODKA 1O6IA 4S3JA 1KFWA 2PN0A 1LL7A 3EY6A 4Z2GA 4MGVA 1GOIA 1NWUA 3GTYX 3CZ8A 4R5EA 3G6LA 3IKGA 3FAPA 2DT2A 3B8SA 1P5QA 4IQ2A 2LKNA 3CHDA 2PPNA 1FFQA 4DRJA 4GIVA 3JYJA 1FKHA 4MTVA 3IKDA 4LAVA 3O5DA 3UQAA 2G8ZA 3G6MA 5BXJA 3PRDA 2FDMA 3UI4A 4DIPA 3KAFA 5HW8A 2ZR5A 4W9OA 3TCZA 1EIBA 1JCHB 3O5QA 2DT3A 1RD6A 1W9PA 1OGGA 1ZL1A 2WLYA 2DSUA 3PRAA 1B6CA 4ODPA 4MNMA 4G50A 3UI6A 3WD1A 2WM0A 1X6LA 1ZBVA 3H9RB 3O5OA 1ZB5A 3UQBA 3RFWA 4LAYA 2AOSA 3RM4A 2YBUA 1SR0A 4FN2A 3CHFA 5HT1A 3TC5A 1IX5A 3NTPA 1E6NA 3O5GA 3WL1A 5B8IC 1NWRA 2DSVA 2DSWA 3KACA 2PV1A 5GQBA 1U79A 4DZ3A 2WK2A 3W4RA 1YW5A 1FKFA 2DPEA 2O92A 2KR7A 3EIPA 2RUDA 4JFLA 3RMEA 1F40A 1BL4A 4FAPA 3O5RA 4LAWA 2WLZA 1L1PA 1ROTA 1FKKA 4C02B 4WIWA 1LG1A 1NMVA 5DF0A 4P8UA 3CGNA 4DWSB 1LJYA 3TDBA 4KQZA 4XAKA 1Q6HA 5DIVA 1FKBA 1NH6A 2A3EA 3B7XA 3O5MA 1FD9A 3PA7A 5HTGA 2FAPA 2M2AA 4HARA 1HXVA 3WD2A 2LPVA 4J4NA 4IPXA 1GUVA 4ODLA 1SYTA 2MLXA 3AROA 4DRNA 4DRMA 1JVWA 1HKKA 3ODKA 4AY1A 5DIUA 4QT2A 4R0XA 4NZCA 3FY1A 2MF9A 2XP9A 2A3AA 4W9QA 1KT0A 3I6CA 1YATA 5HKGA 4QZVB 2PPPA 3JXVA 2M08A 3WQWA 1HKJA 1FKTA 2XPBA 2MLYA 4DWSA 4TW6A 4W9PA 4MAVA 5HBFA 3AS2A 3RGCA 3O5EA 3QOKA 2A3CA 2N87A 4L72B 1FKSA 2Q5AA 5DEZA 1H0IA 4DWSC 1HJVA 1W1TA 2D9FA 4P8WA 4ODQA 2DT0A 1D6OA 2L2SA 4JFIA 1T11A 4NSBA 3O5FA 3WD0A 4MSPA 1ZCNA 1LL6A 1D7JA 3B9AA 5HW7A 4U84A 3WIJA 1E6ZA 2DG4A 3O5IA 4P8VA 2FKEA 3MDYB 2JZVA 4ODOA 1K9TA 1XRVA 4MPKA 4W5UA 3UF8A 1FKDA 3ARVA 3ARQA 1J4RA 2RSEA 1Q6IA 1J4HA 2ZQSA 1KT1A 3KCEA 2KGJA 2KI3A 1X6NA 2LGOA 1FFRA 4NNRA 1OGBA 4ODMA 1D7HA 4LGXA 1EQ3A 4URIA 4TX0A 4IT6A 1UR8A 4DRPA 3WQVA 1FKRA 1ZBWA 1W1YA 3GPKA 4WKAA 2B5UB 4ODNA 1JNEA 2AWGA 2IUZA 2LJ4A 4G2PA 1D7IA 4DZ2A
chains in the Genus database with same CATH topology
4HBOA 4ZPTR 3KADA 4WJXA 2RQSA 1OWQA 4Z2LA 3ARWA 4QT3A 5JH8A 1E9LA 5GPRA 2XP7A 3WD4A 2F4EA 5J6EA 1PINA 1A7XA 2DG9A 1JNDA 1QZ2A 3KAIA 1D2KA 2MLZA 4ZPWR 1WAWA 3JYMA 2DSZA 2YBTA 3AS1A 4DRHA 4ML4A 3ARPA 4WKFA 4L3NA 3CHEA 1FJDA 1H0GA 1HJXA 1WB0A 1FKJA 3O5LA 3ARUA 2XP6A 1ZK6A 1Q1CA 4QIBA 4ZS6A 1FKGA 4IT4A 3NRKA 1TCOC 1WNOA 2KE0A 3FXYA 2Y78A 3NI6A 4GGQA 1FAPA 2PI6A 4Q7NA 4LAXA 2UZ5A 3AQUA 4Z2HA 3ALGA 1W1VA 3CH9A 1JNSA 2O9OA 3BXWA 4TW7A 3KAGA 1FKLA 1ITXA 1LQ0A 4MNLA 4MNJA 1EYMA 1TFVA 4DT4A 1R9HA 2F21A 1UR9A 3PRBA 3KAHA 1GPFA 2XP4A 3O5PA 1M5YA 2PV2A 3KABA 5HWBA 2B31A 3ARTA 3OA5A 4DRQA 3B9EA 4J4OA 4DROA 4DWSD 1XHGA 4U86A 4O2TA 2ZQVA 1E6PA 2RUCA 5GPGA 3AS0A 2F2DA 4IQCA 5HWCA 2PV3A 4Q22A 2OFNA 5I98A 3PR9A 3OOBA 3WL0A 1PBKA 3ARSA 2RURA 2M1IA 3B9DA 5DITA 2DG3A 4JFMA 1Y0OA 2PBCA 1HJWA 2ITKA 3IHZA 1HKIA 2KO7A 4WKHA 3WD3A 3IK8A 3KZ7A 2ESCA 4HBEA 1NWSA 3UI5A 4MNKA 2XP8A 2RUQA 1W9UA 4N19A 5DO2A 1ROUA 3CHCA 3ARZA 4P8XA 2PPOA 1BKFA 3VAWA 1N1AA 1VF8A 2ZQUA 2MNTA 3ARXA 1J6YA 1QPLA 4DH0A 2IF4A 3O5KA 4DRIA 2ZR4A 3UQIA 2ZR6A 1CTNA 4TW8A 3LUOA 1ZU8A 2XP5A 1EDQA 2A3BA 2DT1A 1NSGA 4ZPVR 3O5JA 3ALFA 4Z2KA 5HUAA 1E15A 1C9HA 3AS3A 2XPAA 3CGMA 2VN1A 4S3KA 2KFWA 1FKIA 5D75A 4KR0B 1LG2A 1F8AB 1LL4A 4Z2IA 4DRKA 4TNSA 1QPFA 4BF8A 2VCDA 4U85A 2ZQTA 3WKZA 2MPHA 4PTMA 3WH0A 2QF8A 1ZBCA 1ZBKA 3RM8A 4WK9A 2OLHA 1Q6UA 2XP3A 2K8IA 3RM9A 4JYSA 1EHNA 4Z2JA 1J4IA 1NWTA 4JFKA 1W1PA 5HW6A 1HKMA 1W9VA 4JFJA 3ARYA 1JNTA 1E6RA 1W26A 4TYOA 2G41A 4ITZA 1NMWA 3ARRA 4ODRA 4ODKA 1O6IA 4S3JA 1KFWA 4Z2GA 1LL7A 3EY6A 4MGVA 1GOIA 1NWUA 3CZ8A 4R5EA 3G6LA 3IKGA 3FAPA 2DT2A 3B8SA 1P5QA 4IQ2A 2LKNA 3CHDA 2PPNA 1FFQA 4DRJA 4GIVA 3JYJA 1FKHA 4MTVA 3IKDA 4LAVA 3O5DA 3UQAA 2G8ZA 3G6MA 5BXJA 3PRDA 2FDMA 3UI4A 4DIPA 3KAFA 5HW8A 2ZR5A 4W9OA 3TCZA 1EIBA 3O5QA 2DT3A 1RD6A 1W9PA 1OGGA 1ZL1A 2WLYA 2DSUA 3PRAA 1B6CA 4ODPA 4MNMA 4G50A 3UI6A 3WD1A 2WM0A 1X6LA 1ZBVA 3H9RB 3O5OA 1ZB5A 3UQBA 3RFWA 4LAYA 2AOSA 3RM4A 2YBUA 1SR0A 4FN2A 3CHFA 5HT1A 3TC5A 1IX5A 3NTPA 1E6NA 3O5GA 3WL1A 5B8IC 1NWRA 2DSVA 2DSWA 3KACA 2PV1A 5GQBA 1U79A 4DZ3A 2WK2A 3W4RA 1YW5A 1FKFA 2DPEA 2O92A 2KR7A 2RUDA 4JFLA 3RMEA 1F40A 1BL4A 4FAPA 3O5RA 4LAWA 2WLZA 1L1PA 1ROTA 1FKKA 4C02B 4WIWA 1LG1A 1NMVA 5DF0A 4P8UA 3CGNA 4DWSB 1LJYA 3TDBA 4KQZA 4XAKA 1Q6HA 5DIVA 1FKBA 1NH6A 2A3EA 3B7XA 3O5MA 1FD9A 3PA7A 5HTGA 2FAPA 2M2AA 4HARA 1HXVA 3WD2A 2LPVA 4J4NA 4IPXA 1GUVA 4ODLA 1SYTA 2MLXA 3AROA 4DRNA 4DRMA 1JVWA 1HKKA 3ODKA 4AY1A 5DIUA 4QT2A 4R0XA 4NZCA 3FY1A 2MF9A 2XP9A 2A3AA 4W9QA 1KT0A 3I6CA 1YATA 5HKGA 4QZVB 2PPPA 3JXVA 2M08A 3WQWA 1HKJA 1FKTA 2XPBA 2MLYA 4DWSA 4TW6A 4W9PA 4MAVA 5HBFA 3AS2A 3RGCA 3O5EA 3QOKA 2A3CA 2N87A 4L72B 1FKSA 2Q5AA 5DEZA 1H0IA 4DWSC 1HJVA 1W1TA 2D9FA 4P8WA 4ODQA 2DT0A 1D6OA 2L2SA 4JFIA 1T11A 4NSBA 3O5FA 3WD0A 4MSPA 1ZCNA 1LL6A 1D7JA 3B9AA 5HW7A 4U84A 3WIJA 1E6ZA 2DG4A 3O5IA 4P8VA 2FKEA 3MDYB 2JZVA 4ODOA 1K9TA 1XRVA 4MPKA 4W5UA 3UF8A 1FKDA 3ARVA 3ARQA 1J4RA 2RSEA 1Q6IA 1J4HA 2ZQSA 1KT1A 3KCEA 2KGJA 2KI3A 1X6NA 2LGOA 1FFRA 4NNRA 1OGBA 4ODMA 1D7HA 4LGXA 1EQ3A 4URIA 4TX0A 4IT6A 1UR8A 4DRPA 3WQVA 1FKRA 1ZBWA 1W1YA 3GPKA 4WKAA 4ODNA 1JNEA 2AWGA 2IUZA 2LJ4A 4G2PA 1D7IA 4DZ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JVW A;  3OOB A;  3IKG A;  1PBK A;  3FAP A;  2RUR A;  2M1I A;  3KAD A;  1P5Q A;  5DIT A;  3ODK A;  4IQ2 A;  2LKN A;  2DG3 A;  2RQS A;  5DIU A;  4QT2 A;  4JFM A;  2PPN A;  1Y0O A;  4DRJ A;  2PBC A;  2ITK A;  3JYJ A;  1FKH A;  4GIV A;  3IHZ A;  4QT3 A;  4R0X A;  3IKD A;  2KO7 A;  2MF9 A;  2XP7 A;  3IK8 A;  3KZ7 A;  2XP9 A;  4LAV A;  2F4E A;  5J6E A;  3O5D A;  3UQA A;  1PIN A;  1A7X A;  1KT0 A;  3I6C A;  1YAT A;  4W9Q A;  3PRD A;  3UI5 A;  2DG9 A;  5BXJ A;  2XP8 A;  5HKG A;  2RUQ A;  2PPP A;  3UI4 A;  4DIP A;  1QZ2 A;  3KAI A;  4DRM A;  3JXV A;  3KAF A;  2MLZ A;  2M08 A;  3JYM A;  4N19 A;  5HW8 A;  2ZR5 A;  1ROU A;  4W9O A;  4DRH A;  3TCZ A;  3O5Q A;  1FKT A;  1BKF A;  2PPO A;  1N1A A;  3VAW A;  2ZQU A;  2MNT A;  1J6Y A;  1QPL A;  4DH0 A;  2IF4 A;  3O5K A;  4DRI A;  2XPB A;  5I98 A;  2MLY A;  1FJD A;  1B6C A;  2ZR4 A;  3UQI A;  2ZR6 A;  4ODP A;  4TW6 A;  4W9P A;  4G50 A;  3UI6 A;  1FKJ A;  4TW8 A;  4DZ2 A;  3O5L A;  3LUO A;  3RGC A;  2XP5 A;  3O5E A;  2XP6 A;  2N87 A;  1FKS A;  2Q5A A;  1ZK6 A;  1Q1C A;  1NSG A;  4QIB A;  3O5J A;  1FKG A;  3H9R B;  3NRK A;  3O5O A;  5HUA A;  2D9F A;  1C9H A;  2XPA A;  4ODQ A;  3CGM A;  1TCO C;  3UQB A;  2VN1 A;  2KE0 A;  2KFW A;  1FKI A;  2Y78 A;  3NI6 A;  5D75 A;  4LAY A;  3RFW A;  4GGQ A;  1F8A B;  1FAP A;  1D6O A;  4FN2 A;  5HT1 A;  3TC5 A;  2L2S A;  3NTP A;  3O5G A;  4LAX A;  4JFI A;  2UZ5 A;  4TNS A;  1T11 A;  4DRK A;  5B8I C;  3O5F A;  1QPF A;  4BF8 A;  2VCD A;  4MSP A;  1ZCN A;  4U85 A;  2ZQT A;  1D7J A;  2MPH A;  3KAC A;  5HW7 A;  2PV1 A;  4U84 A;  3WH0 A;  1U79 A;  4DZ3 A;  1JNS A;  2DG4 A;  3O5I A;  1Q6U A;  2FKE A;  1YW5 A;  3MDY B;  1FKF A;  2JZV A;  2XP3 A;  4TW7 A;  2K8I A;  3KAG A;  4JYS A;  1FKL A;  4ODO A;  2KR7 A;  2RUD A;  4JFL A;  3UF8 A;  1F40 A;  4DT4 A;  1J4I A;  1BL4 A;  1EYM A;  1FKD A;  4FAP A;  4JFK A;  1R9H A;  2F21 A;  1J4R A;  3O5R A;  4LAW A;  2RSE A;  1Q6I A;  1L1P A;  1ROT A;  1J4H A;  2ZQS A;  3KAH A;  3PRB A;  1FKK A;  5HW6 A;  4C02 B;  1KT1 A;  3KCE A;  2KGJ A;  1NMV A;  2KI3 A;  2XP4 A;  4JFJ A;  1JNT A;  1W26 A;  2LGO A;  3O5P A;  4NNR A;  4TYO A;  3CGN A;  1M5Y A;  4ODM A;  3TDB A;  1D7H A;  5DIV A;  1Q6H A;  2PV2 A;  1FKB A;  3KAB A;  1EQ3 A;  5HWB A;  4TX0 A;  4ITZ A;  4DRQ A;  4DRP A;  3B7X A;  1NMW A;  1FD9 A;  3O5M A;  3PA7 A;  2FAP A;  2M2A A;  4J4O A;  4ODR A;  5HTG A;  4ODK A;  1HXV A;  4DRO A;  1FKR A;  2LPV A;  3EY6 A;  4U86 A;  4J4N A;  4MGV A;  4IPX A;  2ZQV A;  3GPK A;  2RUC A;  4O2T A;  5GPG A;  4ODN A;  2AWG A;  4ODL A;  2LJ4 A;  2MLX A;  2F2D A;  4G2P A;  4IQC A;  4DRN A;  1D7I A;  5HWC A;  2PV3 A;  2OFN A; 
#chains in the Genus database with same CATH topology
 4HBO A;  4ZPT R;  3KAD A;  4WJX A;  2RQS A;  1OWQ A;  4Z2L A;  3ARW A;  4QT3 A;  5JH8 A;  1E9L A;  5GPR A;  2XP7 A;  2EUL A;  3WD4 A;  2F4E A;  5J6E A;  1PIN A;  1A7X A;  3GU0 A;  2DG9 A;  1JND A;  1QZ2 A;  3KAI A;  1D2K A;  2MLZ A;  4ZPW R;  1WAW A;  2F23 A;  3JYM A;  2DSZ A;  2YBT A;  3AS1 A;  4DRH A;  4ML4 A;  3ARP A;  4WKF A;  4L3N A;  3CHE A;  1FJD A;  1H0G A;  1HJX A;  1WB0 A;  1FKJ A;  3O5L A;  3ARU A;  2XP6 A;  1ZK6 A;  1Q1C A;  4QIB A;  4ZS6 A;  1FKG A;  4IT4 A;  3NRK A;  1TCO C;  1WNO A;  2KE0 A;  3FXY A;  2Y78 A;  3NI6 A;  4GGQ A;  1FAP A;  2PI6 A;  4Q7N A;  4LAX A;  2UZ5 A;  3AQU A;  4Z2H A;  3ALG A;  1W1V A;  3CH9 A;  1JNS A;  2O9O A;  3BXW A;  4TW7 A;  3KAG A;  1FKL A;  1GRJ A;  1ITX A;  1LQ0 A;  4MNL A;  4MNJ A;  1EYM A;  1TFV A;  4DT4 A;  1R9H A;  2F21 A;  1UR9 A;  3PRB A;  3KAH A;  1GPF A;  2XP4 A;  3BMB A;  3O5P A;  1M5Y A;  2PV2 A;  3KAB A;  5HWB A;  2B31 A;  3ART A;  3OA5 A;  4DRQ A;  3B9E A;  4J4O A;  4DRO A;  4DWS D;  2P4V A;  1XHG A;  4U86 A;  4O2T A;  2ZQV A;  1E6P A;  2RUC A;  5GPG A;  3AS0 A;  2F2D A;  4IQC A;  5HWC A;  2PV3 A;  4Q22 A;  2OFN A;  5I98 A;  3PR9 A;  3OOB A;  3WL0 A;  1PBK A;  3ARS A;  1E44 A;  2RUR A;  2M1I A;  3B9D A;  5DIT A;  2DG3 A;  4JFM A;  1Y0O A;  2PBC A;  1HJW A;  2ITK A;  3IHZ A;  1HKI A;  2KO7 A;  4WKH A;  3WD3 A;  3IK8 A;  3KZ7 A;  2ESC A;  4HBE A;  1NWS A;  3UI5 A;  4MNK A;  2XP8 A;  2RUQ A;  1W9U A;  4N19 A;  5DO2 A;  1ROU A;  3CHC A;  3ARZ A;  4P8X A;  2PPO A;  1BKF A;  3VAW A;  1N1A A;  1VF8 A;  2ZQU A;  2MNT A;  3ARX A;  1J6Y A;  1QPL A;  4DH0 A;  2IF4 A;  3O5K A;  4DRI A;  2ZR4 A;  3UQI A;  2ZR6 A;  1CTN A;  4TW8 A;  3LUO A;  1ZU8 A;  2XP5 A;  1EDQ A;  2A3B A;  2DT1 A;  1NSG A;  4ZPV R;  3O5J A;  3ALF A;  4Z2K A;  5HUA A;  1E15 A;  1C9H A;  3AS3 A;  2XPA A;  3CGM A;  2VN1 A;  4S3K A;  2KFW A;  1FKI A;  5D75 A;  4UDM A;  4KR0 B;  1LG2 A;  1F8A B;  1LL4 A;  4Z2I A;  4DRK A;  4TNS A;  1QPF A;  4BF8 A;  2VCD A;  4U85 A;  2ZQT A;  3WKZ A;  2MPH A;  4PTM A;  3WH0 A;  2QF8 A;  1ZBC A;  1ZBK A;  3RM8 A;  4WK9 A;  2OLH A;  1Q6U A;  2XP3 A;  2K8I A;  3RM9 A;  4JYS A;  1EHN A;  4Z2J A;  1J4I A;  1NWT A;  4JFK A;  1W1P A;  5HW6 A;  1HKM A;  1W9V A;  4JFJ A;  3ARY A;  1JNT A;  1E6R A;  1W26 A;  4TYO A;  2G41 A;  2ETN A;  4ITZ A;  1NMW A;  3ARR A;  4ODR A;  4ODK A;  1O6I A;  4S3J A;  1KFW A;  2PN0 A;  1LL7 A;  3EY6 A;  4Z2G A;  4MGV A;  1GOI A;  1NWU A;  3GTY X;  3CZ8 A;  4R5E A;  3G6L A;  3IKG A;  3FAP A;  2DT2 A;  3B8S A;  1P5Q A;  4IQ2 A;  2LKN A;  3CHD A;  2PPN A;  1FFQ A;  4DRJ A;  4GIV A;  3JYJ A;  1FKH A;  4MTV A;  3IKD A;  4LAV A;  3O5D A;  3UQA A;  2G8Z A;  3G6M A;  5BXJ A;  3PRD A;  2FDM A;  3UI4 A;  4DIP A;  3KAF A;  5HW8 A;  2ZR5 A;  4W9O A;  3TCZ A;  1EIB A;  1JCH B;  3O5Q A;  2DT3 A;  1RD6 A;  1W9P A;  1OGG A;  1ZL1 A;  2WLY A;  2DSU A;  3PRA A;  1B6C A;  4ODP A;  4MNM A;  4G50 A;  3UI6 A;  3WD1 A;  2WM0 A;  1X6L A;  1ZBV A;  3H9R B;  3O5O A;  1ZB5 A;  3UQB A;  3RFW A;  4LAY A;  2AOS A;  3RM4 A;  2YBU A;  1SR0 A;  4FN2 A;  3CHF A;  5HT1 A;  3TC5 A;  1IX5 A;  3NTP A;  1E6N A;  3O5G A;  3WL1 A;  5B8I C;  1NWR A;  2DSV A;  2DSW A;  3KAC A;  2PV1 A;  5GQB A;  1U79 A;  4DZ3 A;  2WK2 A;  3W4R A;  1YW5 A;  1FKF A;  2DPE A;  2O92 A;  2KR7 A;  3EIP A;  2RUD A;  4JFL A;  3RME A;  1F40 A;  1BL4 A;  4FAP A;  3O5R A;  4LAW A;  2WLZ A;  1L1P A;  1ROT A;  1FKK A;  4C02 B;  4WIW A;  1LG1 A;  1NMV A;  5DF0 A;  4P8U A;  3CGN A;  4DWS B;  1LJY A;  3TDB A;  4KQZ A;  4XAK A;  1Q6H A;  5DIV A;  1FKB A;  1NH6 A;  2A3E A;  3B7X A;  3O5M A;  1FD9 A;  3PA7 A;  5HTG A;  2FAP A;  2M2A A;  4HAR A;  1HXV A;  3WD2 A;  2LPV A;  4J4N A;  4IPX A;  1GUV A;  4ODL A;  1SYT A;  2MLX A;  3ARO A;  4DRN A;  4DRM A;  1JVW A;  1HKK A;  3ODK A;  4AY1 A;  5DIU A;  4QT2 A;  4R0X A;  4NZC A;  3FY1 A;  2MF9 A;  2XP9 A;  2A3A A;  4W9Q A;  1KT0 A;  3I6C A;  1YAT A;  5HKG A;  4QZV B;  2PPP A;  3JXV A;  2M08 A;  3WQW A;  1HKJ A;  1FKT A;  2XPB A;  2MLY A;  4DWS A;  4TW6 A;  4W9P A;  4MAV A;  5HBF A;  3AS2 A;  3RGC A;  3O5E A;  3QOK A;  2A3C A;  2N87 A;  4L72 B;  1FKS A;  2Q5A A;  5DEZ A;  1H0I A;  4DWS C;  1HJV A;  1W1T A;  2D9F A;  4P8W A;  4ODQ A;  2DT0 A;  1D6O A;  2L2S A;  4JFI A;  1T11 A;  4NSB A;  3O5F A;  3WD0 A;  4MSP A;  1ZCN A;  1LL6 A;  1D7J A;  3B9A A;  5HW7 A;  4U84 A;  3WIJ A;  1E6Z A;  2DG4 A;  3O5I A;  4P8V A;  2FKE A;  3MDY B;  2JZV A;  4ODO A;  1K9T A;  1XRV A;  4MPK A;  4W5U A;  3UF8 A;  1FKD A;  3ARV A;  3ARQ A;  1J4R A;  2RSE A;  1Q6I A;  1J4H A;  2ZQS A;  1KT1 A;  3KCE A;  2KGJ A;  2KI3 A;  1X6N A;  2LGO A;  1FFR A;  4NNR A;  1OGB A;  4ODM A;  1D7H A;  4LGX A;  1EQ3 A;  4URI A;  4TX0 A;  4IT6 A;  1UR8 A;  4DRP A;  3WQV A;  1FKR A;  1ZBW A;  1W1Y A;  3GPK A;  4WKA A;  2B5U B;  4ODN A;  1JNE A;  2AWG A;  2IUZ A;  2LJ4 A;  4G2P A;  1D7I A;  4DZ2 A; 
#chains in the Genus database with same CATH homology
 4HBO A;  4ZPT R;  3KAD A;  4WJX A;  2RQS A;  1OWQ A;  4Z2L A;  3ARW A;  4QT3 A;  5JH8 A;  1E9L A;  5GPR A;  2XP7 A;  3WD4 A;  2F4E A;  5J6E A;  1PIN A;  1A7X A;  2DG9 A;  1JND A;  1QZ2 A;  3KAI A;  1D2K A;  2MLZ A;  4ZPW R;  1WAW A;  3JYM A;  2DSZ A;  2YBT A;  3AS1 A;  4DRH A;  4ML4 A;  3ARP A;  4WKF A;  4L3N A;  3CHE A;  1FJD A;  1H0G A;  1HJX A;  1WB0 A;  1FKJ A;  3O5L A;  3ARU A;  2XP6 A;  1ZK6 A;  1Q1C A;  4QIB A;  4ZS6 A;  1FKG A;  4IT4 A;  3NRK A;  1TCO C;  1WNO A;  2KE0 A;  3FXY A;  2Y78 A;  3NI6 A;  4GGQ A;  1FAP A;  2PI6 A;  4Q7N A;  4LAX A;  2UZ5 A;  3AQU A;  4Z2H A;  3ALG A;  1W1V A;  3CH9 A;  1JNS A;  2O9O A;  3BXW A;  4TW7 A;  3KAG A;  1FKL A;  1ITX A;  1LQ0 A;  4MNL A;  4MNJ A;  1EYM A;  1TFV A;  4DT4 A;  1R9H A;  2F21 A;  1UR9 A;  3PRB A;  3KAH A;  1GPF A;  2XP4 A;  3O5P A;  1M5Y A;  2PV2 A;  3KAB A;  5HWB A;  2B31 A;  3ART A;  3OA5 A;  4DRQ A;  3B9E A;  4J4O A;  4DRO A;  4DWS D;  1XHG A;  4U86 A;  4O2T A;  2ZQV A;  1E6P A;  2RUC A;  5GPG A;  3AS0 A;  2F2D A;  4IQC A;  5HWC A;  2PV3 A;  4Q22 A;  2OFN A;  5I98 A;  3PR9 A;  3OOB A;  3WL0 A;  1PBK A;  3ARS A;  2RUR A;  2M1I A;  3B9D A;  5DIT A;  2DG3 A;  4JFM A;  1Y0O A;  2PBC A;  1HJW A;  2ITK A;  3IHZ A;  1HKI A;  2KO7 A;  4WKH A;  3WD3 A;  3IK8 A;  3KZ7 A;  2ESC A;  4HBE A;  1NWS A;  3UI5 A;  4MNK A;  2XP8 A;  2RUQ A;  1W9U A;  4N19 A;  5DO2 A;  1ROU A;  3CHC A;  3ARZ A;  4P8X A;  2PPO A;  1BKF A;  3VAW A;  1N1A A;  1VF8 A;  2ZQU A;  2MNT A;  3ARX A;  1J6Y A;  1QPL A;  4DH0 A;  2IF4 A;  3O5K A;  4DRI A;  2ZR4 A;  3UQI A;  2ZR6 A;  1CTN A;  4TW8 A;  3LUO A;  1ZU8 A;  2XP5 A;  1EDQ A;  2A3B A;  2DT1 A;  1NSG A;  4ZPV R;  3O5J A;  3ALF A;  4Z2K A;  5HUA A;  1E15 A;  1C9H A;  3AS3 A;  2XPA A;  3CGM A;  2VN1 A;  4S3K A;  2KFW A;  1FKI A;  5D75 A;  4KR0 B;  1LG2 A;  1F8A B;  1LL4 A;  4Z2I A;  4DRK A;  4TNS A;  1QPF A;  4BF8 A;  2VCD A;  4U85 A;  2ZQT A;  3WKZ A;  2MPH A;  4PTM A;  3WH0 A;  2QF8 A;  1ZBC A;  1ZBK A;  3RM8 A;  4WK9 A;  2OLH A;  1Q6U A;  2XP3 A;  2K8I A;  3RM9 A;  4JYS A;  1EHN A;  4Z2J A;  1J4I A;  1NWT A;  4JFK A;  1W1P A;  5HW6 A;  1HKM A;  1W9V A;  4JFJ A;  3ARY A;  1JNT A;  1E6R A;  1W26 A;  4TYO A;  2G41 A;  4ITZ A;  1NMW A;  3ARR A;  4ODR A;  4ODK A;  1O6I A;  4S3J A;  1KFW A;  4Z2G A;  1LL7 A;  3EY6 A;  4MGV A;  1GOI A;  1NWU A;  3CZ8 A;  4R5E A;  3G6L A;  3IKG A;  3FAP A;  2DT2 A;  3B8S A;  1P5Q A;  4IQ2 A;  2LKN A;  3CHD A;  2PPN A;  1FFQ A;  4DRJ A;  4GIV A;  3JYJ A;  1FKH A;  4MTV A;  3IKD A;  4LAV A;  3O5D A;  3UQA A;  2G8Z A;  3G6M A;  5BXJ A;  3PRD A;  2FDM A;  3UI4 A;  4DIP A;  3KAF A;  5HW8 A;  2ZR5 A;  4W9O A;  3TCZ A;  1EIB A;  3O5Q A;  2DT3 A;  1RD6 A;  1W9P A;  1OGG A;  1ZL1 A;  2WLY A;  2DSU A;  3PRA A;  1B6C A;  4ODP A;  4MNM A;  4G50 A;  3UI6 A;  3WD1 A;  2WM0 A;  1X6L A;  1ZBV A;  3H9R B;  3O5O A;  1ZB5 A;  3UQB A;  3RFW A;  4LAY A;  2AOS A;  3RM4 A;  2YBU A;  1SR0 A;  4FN2 A;  3CHF A;  5HT1 A;  3TC5 A;  1IX5 A;  3NTP A;  1E6N A;  3O5G A;  3WL1 A;  5B8I C;  1NWR A;  2DSV A;  2DSW A;  3KAC A;  2PV1 A;  5GQB A;  1U79 A;  4DZ3 A;  2WK2 A;  3W4R A;  1YW5 A;  1FKF A;  2DPE A;  2O92 A;  2KR7 A;  2RUD A;  4JFL A;  3RME A;  1F40 A;  1BL4 A;  4FAP A;  3O5R A;  4LAW A;  2WLZ A;  1L1P A;  1ROT A;  1FKK A;  4C02 B;  4WIW A;  1LG1 A;  1NMV A;  5DF0 A;  4P8U A;  3CGN A;  4DWS B;  1LJY A;  3TDB A;  4KQZ A;  4XAK A;  1Q6H A;  5DIV A;  1FKB A;  1NH6 A;  2A3E A;  3B7X A;  3O5M A;  1FD9 A;  3PA7 A;  5HTG A;  2FAP A;  2M2A A;  4HAR A;  1HXV A;  3WD2 A;  2LPV A;  4J4N A;  4IPX A;  1GUV A;  4ODL A;  1SYT A;  2MLX A;  3ARO A;  4DRN A;  4DRM A;  1JVW A;  1HKK A;  3ODK A;  4AY1 A;  5DIU A;  4QT2 A;  4R0X A;  4NZC A;  3FY1 A;  2MF9 A;  2XP9 A;  2A3A A;  4W9Q A;  1KT0 A;  3I6C A;  1YAT A;  5HKG A;  4QZV B;  2PPP A;  3JXV A;  2M08 A;  3WQW A;  1HKJ A;  1FKT A;  2XPB A;  2MLY A;  4DWS A;  4TW6 A;  4W9P A;  4MAV A;  5HBF A;  3AS2 A;  3RGC A;  3O5E A;  3QOK A;  2A3C A;  2N87 A;  4L72 B;  1FKS A;  2Q5A A;  5DEZ A;  1H0I A;  4DWS C;  1HJV A;  1W1T A;  2D9F A;  4P8W A;  4ODQ A;  2DT0 A;  1D6O A;  2L2S A;  4JFI A;  1T11 A;  4NSB A;  3O5F A;  3WD0 A;  4MSP A;  1ZCN A;  1LL6 A;  1D7J A;  3B9A A;  5HW7 A;  4U84 A;  3WIJ A;  1E6Z A;  2DG4 A;  3O5I A;  4P8V A;  2FKE A;  3MDY B;  2JZV A;  4ODO A;  1K9T A;  1XRV A;  4MPK A;  4W5U A;  3UF8 A;  1FKD A;  3ARV A;  3ARQ A;  1J4R A;  2RSE A;  1Q6I A;  1J4H A;  2ZQS A;  1KT1 A;  3KCE A;  2KGJ A;  2KI3 A;  1X6N A;  2LGO A;  1FFR A;  4NNR A;  1OGB A;  4ODM A;  1D7H A;  4LGX A;  1EQ3 A;  4URI A;  4TX0 A;  4IT6 A;  1UR8 A;  4DRP A;  3WQV A;  1FKR A;  1ZBW A;  1W1Y A;  3GPK A;  4WKA A;  4ODN A;  1JNE A;  2AWG A;  2IUZ A;  2LJ4 A;  4G2P A;  1D7I A;  4DZ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...