1Y0OA

Crystal structure of reduced atfkbp13
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
125
structure length
125
Chain Sequence
CEFSVSPSGLAFCDKVVGYGPEAVKGQLIKAHYVGKLENGKVFDSSYNRGKPLTFRIGVGEVIKGWDQGILGSDGIPPMLTGGKRTLRIPPELAYGDRGAGCKGGSCLIPPASVLLFDIEYIGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FKBP-type peptidyl-prolyl cis-trans isomerase 3
publication title Crystal structure of reduced AtFKBP13
rcsb
source organism Arabidopsis thaliana
molecule tags Isomerase
total genus 26
structure length 125
sequence length 125
chains with identical sequence B, C, D, E
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2004-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1y0oA00
1Y0OA 4ODQA 2Y78A 3ODKA 3KZ7A 2PV1A 3TC5A 1QPFA 1N1AA 2ZQUA 3UQIA 3O5PA 1D7IA 2PPNA 3O5KA 1ROTA 4IQ2A 5HW6A 1EQ3A 5HUAA 3OOBA 5HT1A 5HKGA 1EYMA 3WH0A 3NRKA 2F21A 2XP7A 4QT2A 4JFMA 2N87A 4W9QA 2F4EA 5GPGA 5I98A 1FKHA 3CGMA 4C02B 3KAIA 2KO7A 2LJ4A 1F8AB 2M08A 2MPHA 2Q5AA 4W9PA 2ZQVA 3O5OA 1J4RA 4DRPA 1F40A 3O5MA 4ODPA 1FKJA 1BL4A 3I6CA 3IKDA 2RUQA 4DRNA 4LAXA 4JFIA 4TX0A 3RGCA 5HTGA 3UF8A 4ODKA 2XP8A 5B8IC 4J4OA 1NMVA 1Q6HA 2RQSA 2RSEA 2XPAA 2LKNA 2ZR4A 4ODRA 2DG4A 4DRKA 5HWBA 1D7JA 1YW5A 3PA7A 3EY6A 2AWGA 2MNTA 4IPXA 5DIVA 4R0XA 3IK8A 1D7HA 3GPKA 4QT3A 1KT0A 1D6OA 2OFNA 3B7XA 4IQCA 1HXVA 5BXJA 1FD9A 4TYOA 1FKLA 2XP3A 4LAYA 3JYJA 1Q6IA 4MGVA 3O5IA 3PRBA 2PV3A 4QIBA 2MF9A 4MSPA 1FJDA 4ODLA 2L2SA 2MLXA 2PPPA 3FAPA 4GGQA 4DZ2A 3PRDA 2DG3A 1U79A 3O5FA 1Q1CA 2ZQTA 1R9HA 3NTPA 3UI6A 1B6CA 1P5QA 4G50A 1FAPA 3IKGA 1YATA 1QPLA 4JFKA 4LAWA 4DROA 2M2AA 3MDYB 2K8IA 2ZQSA 3KACA 4TW6A 3CGNA 2FAPA 2VCDA 1J4IA 2MLYA 4U86A 2PPOA 1JNTA 3JYMA 4DT4A 3KABA 4JYSA 3O5EA 3NI6A 1NSGA 3H9RB 4DRJA 4DRMA 3IHZA 1QZ2A 4BF8A 4DZ3A 2RUDA 5HW8A 2ZR6A 4NNRA 4DRQA 2D9FA 2IF4A 3KADA 3O5RA 1J6YA 1J4HA 2RUCA 4TW8A 5D75A 3VAWA 2ZR5A 2VN1A 4JFJA 4W9OA 4FAPA 1KT1A 1M5YA 1FKKA 1FKBA 3RFWA 4DH0A 1JVWA 1W26A 3LUOA 2ITKA 2PV2A 3KAFA 3O5DA 5J6EA 2XPBA 1FKRA 5HWCA 1FKDA 2XP9A 4TW7A 1JNSA 1FKTA 2M1IA 2RURA 4N19A 5HW7A 1NMWA 1L1PA 2KGJA 4ODNA 3TDBA 2FKEA 3KAGA 3JXVA 1PBKA 4TNSA 4DRIA 4DIPA 4LAVA 3O5LA 4U85A 4GIVA 2F2DA 1ZK6A 2JZVA 2XP5A 2KE0A 2XP4A 1FKIA 2PBCA 5DITA 4DRHA 3UI5A 2UZ5A 1FKSA 2DG9A 2MLZA 4FN2A 1BKFA 1A7XA 3O5JA 4JFLA 4ITZA 4ODOA 3UQAA 4ODMA 5DIUA 4O2TA 3TCZA 2KFWA 3KAHA 2XP6A 3O5QA 1ROUA 1PINA 4J4NA 3UI4A 1FKGA 2KI3A 4G2PA 3UQBA 1ZCNA 1Q6UA 2KR7A 1FKFA 2LGOA 4U84A 1TCOC 2LPVA 3O5GA 1T11A 1C9HA 3KCEA
chains in the Genus database with same CATH superfamily
4ODQA 1LG1A 4Z2HA 3WD2A 3UQIA 3O5PA 3O5KA 4IQ2A 1LL4A 5HT1A 2WLYA 2F21A 2XP7A 3CHDA 4JFMA 3ARXA 4NZCA 5I98A 3CGMA 1VF8A 3CHFA 4C02B 2LJ4A 2M08A 2ZQVA 5JH8A 4LAXA 4TX0A 4MNLA 3RGCA 1HJVA 4ODKA 2XP8A 2A3EA 2RQSA 2RSEA 5HWBA 2ZR4A 2DG4A 1D7JA 4IPXA 4R0XA 4IQCA 3ARZA 1HKMA 1E6NA 1FJDA 3WQVA 4GGQA 1HKJA 3AQUA 1R9HA 3NTPA 1YATA 4LAWA 2EULA 1WB0A 2K8IA 3KACA 1ZBWA 1J4IA 2MLYA 4U86A 2PPOA 2DPEA 3JYMA 3G6LA 1NSGA 3ARVA 2DT2A 3KADA 3B8SA 1J4HA 4PTMA 1ZBVA 2DSVA 4Z2GA 3AS0A 2ITKA 3O5DA 2G41A 3ARTA 4QZVB 1D2KA 4ML4A 1E6PA 3AS1A 3TDBA 4KQZA 4LAVA 2XP4A 2KE0A 3AROA 1FKIA 5DEZA 4WIWA 1OGBA 3O5JA 2QF8A 3TCZA 2XP6A 3O5QA 1ROUA 4J4NA 4P8XA 4WKFA 1XHGA 4ZS6A 3UQBA 4U84A 3B9AA 1T11A 4MAVA 4TYOA 3ARQA 2WK2A 3CHEA 2PN0A 3KZ7A 4DWSC 3TC5A 1K9TA 3CZ8A 3WL0A 1D7IA 2G8ZA 2PPNA 3GTYX 2A3AA 5HW6A 1GOIA 4MNJA 1OWQA 1JNEA 1X6NA 1EYMA 4QT2A 4Z2KA 4WKAA 3BMBA 1W9VA 1JNDA 3KAIA 2KO7A 2MPHA 2Q5AA 1KFWA 1E6ZA 4IT4A 3O5OA 1J4RA 1F40A 4NSBA 1NWRA 3IKDA 1HKKA 1SR0A 5B8IC 1NMVA 3W4RA 4ODRA 4ZPTR 1YW5A 4XAKA 1D7HA 4DWSD 1KT0A 1H0GA 1D6OA 2OFNA 1HXVA 1LL6A 2OLHA 4LAYA 1LG2A 4ODLA 2L2SA 2DSWA 2MLXA 1TFVA 1FFQA 3O5FA 1P5QA 4G50A 4MPKA 1QPLA 3MDYB 4TW6A 3CGNA 2VCDA 1SYTA 2O92A 1JCHB 3H9RB 3IHZA 1QZ2A 1W1PA 5DF0A 4HBOA 2ZR6A 4NNRA 3ARSA 4TW8A 3WL1A 2ZR5A 4JFJA 2A3BA 4FAPA 3RMEA 2DT1A 1LJYA 1FKBA 3WIJA 1JVWA 3LUOA 3RM8A 4HARA 1FKRA 2M1IA 2B5UB 2RURA 4N19A 5HW7A 1NMWA 1NWUA 3OA5A 1L1PA 2FDMA 2FKEA 1PBKA 4TNSA 2F23A 3O5LA 4GIVA 2F2DA 1ZK6A 4DRHA 5GPRA 3RM9A 3GU0A 2DG9A 3ARRA 4FN2A 1BKFA 1A7XA 3EIPA 4ODOA 3UQAA 4ODMA 4AY1A 4MTVA 2WLZA 1PINA 1FKGA 3CHCA 1E6RA 1ZCNA 3WD1A 2LPVA 3O5GA 1C9HA 2Y78A 3ODKA 2PV1A 1QPFA 3ARUA 5HKGA 4DWSA 2N87A 4Q22A 4W9PA 2YBUA 3ARPA 4HBEA 3I6CA 4DRNA 4JFIA 5HTGA 2ESCA 2O9OA 4J4OA 1GRJA 1Q6HA 2XPAA 2LKNA 4DRKA 2DT3A 3PA7A 2AWGA 1ZBKA 5DIVA 3IK8A 3GPKA 4QT3A 5BXJA 1FD9A 4LGXA 2XP3A 3ALGA 3JYJA 1Q6IA 4MGVA 3O5IA 2PV3A 4MSPA 1FFRA 2PPPA 1WAWA 3FAPA 2DG3A 1Q1CA 2ZQTA 2DSUA 3UI6A 1B6CA 3PR9A 1W9UA 1W1YA 2ETNA 2M2AA 1IX5A 4W5UA 1W1TA 4WK9A 4JYSA 4DT4A 3O5EA 4DRJA 4MNMA 4BF8A 1RD6A 2D9FA 3O5RA 1ITXA 2RUCA 3VAWA 4Z2JA 2VN1A 4W9OA 5GQBA 1OGGA 1FKKA 4KR0B 3RFWA 2PV2A 5J6EA 4S3JA 4DWSB 1FKDA 4P8UA 4TW7A 5DO2A 1NWSA 1O6IA 4DIPA 3WD3A 2A3CA 2P4VA 3RM4A 2PBCA 5DITA 4S3KA 2MLZA 4ITZA 5DIUA 4O2TA 2YBTA 4Z2IA 1ZBCA 4IT6A 3QOKA 1XRVA 2KI3A 4G2PA 1Q6UA 2KR7A 1FKFA 1W9PA 2LGOA 1TCOC 1EHNA 2IUZA 3ALFA 4MNKA 4P8VA 4ZPVR 1UR8A 1Y0OA 4URIA 4ZPWR 1HKIA 1N1AA 2ZQUA 1ROTA 1EQ3A 5HUAA 3OOBA 3WKZA 3ARWA 2B31A 3WH0A 1WNOA 3NRKA 3B9DA 4W9QA 2F4EA 5GPGA 1FKHA 1E44A 1F8AB 1HJXA 4DRPA 3O5MA 4ODPA 3WQWA 1FKJA 1BL4A 2RUQA 3UF8A 3AS3A 4L72B 1GUVA 3WD4A 3EY6A 2MNTA 1ZB5A 3PRAA 1NH6A 4P8WA 3B7XA 1FKLA 1CTNA 5HBFA 3PRBA 4QIBA 2MF9A 1ZU8A 2WM0A 4DZ2A 3PRDA 1U79A 4UDMA 1FAPA 3IKGA 1ZL1A 4JFKA 1UR9A 4DROA 2ZQSA 3WD0A 2FAPA 1LQ0A 1JNTA 3B9EA 3G6MA 3KABA 4L3NA 4DRMA 3NI6A 4WKHA 4DZ3A 2RUDA 5HW8A 2PI6A 4DRQA 2IF4A 1J6YA 1E9LA 5D75A 4WJXA 1KT1A 1M5YA 4R5EA 4DH0A 1W26A 3KAFA 1GPFA 2XPBA 4Q7NA 5HWCA 2XP9A 1JNSA 1FKTA 3AS2A 2KGJA 4ODNA 1NWTA 3KAGA 1X6LA 3JXVA 4DRIA 1W1VA 3CH9A 4U85A 1EIBA 2JZVA 2XP5A 1E15A 4Z2LA 3UI5A 2UZ5A 1FKSA 2AOSA 4JFLA 1EDQA 2DT0A 2KFWA 3FXYA 1H0IA 3KAHA 3FY1A 3UI4A 1HJWA 1LL7A 3BXWA 3ARYA 2DSZA 3KCEA
chains in the Genus database with same CATH topology
4ODQA 1LG1A 4Z2HA 3WD2A 3UQIA 3O5PA 3O5KA 4IQ2A 1LL4A 5HT1A 2WLYA 2F21A 2XP7A 3CHDA 4JFMA 3ARXA 4NZCA 5I98A 3CGMA 1VF8A 3CHFA 4C02B 2LJ4A 2M08A 2ZQVA 5JH8A 4LAXA 4TX0A 4MNLA 3RGCA 1HJVA 4ODKA 2XP8A 2A3EA 2RQSA 2RSEA 5HWBA 2ZR4A 2DG4A 1D7JA 4IPXA 4R0XA 4IQCA 3ARZA 1HKMA 1E6NA 1FJDA 3WQVA 4GGQA 1HKJA 3AQUA 1R9HA 3NTPA 1YATA 4LAWA 1WB0A 2K8IA 3KACA 1ZBWA 1J4IA 2MLYA 4U86A 2PPOA 2DPEA 3JYMA 3G6LA 1NSGA 3ARVA 2DT2A 3KADA 3B8SA 1J4HA 4PTMA 1ZBVA 2DSVA 4Z2GA 3AS0A 2ITKA 3O5DA 2G41A 3ARTA 4QZVB 1D2KA 4ML4A 1E6PA 3AS1A 3TDBA 4KQZA 4LAVA 2XP4A 2KE0A 3AROA 1FKIA 5DEZA 4WIWA 1OGBA 3O5JA 2QF8A 3TCZA 2XP6A 3O5QA 1ROUA 4J4NA 4P8XA 4WKFA 1XHGA 4ZS6A 3UQBA 4U84A 3B9AA 1T11A 4MAVA 4TYOA 3ARQA 2WK2A 3CHEA 3KZ7A 4DWSC 3TC5A 1K9TA 3CZ8A 3WL0A 1D7IA 2G8ZA 2PPNA 2A3AA 5HW6A 1GOIA 4MNJA 1OWQA 1JNEA 1X6NA 1EYMA 4QT2A 4Z2KA 4WKAA 1W9VA 1JNDA 3KAIA 2KO7A 2MPHA 2Q5AA 1KFWA 1E6ZA 4IT4A 3O5OA 1J4RA 1F40A 4NSBA 1NWRA 3IKDA 1HKKA 1SR0A 5B8IC 1NMVA 3W4RA 4ODRA 4ZPTR 1YW5A 4XAKA 1D7HA 4DWSD 1KT0A 1H0GA 1D6OA 2OFNA 1HXVA 1LL6A 2OLHA 4LAYA 1LG2A 4ODLA 2L2SA 2DSWA 2MLXA 1TFVA 1FFQA 3O5FA 1P5QA 4G50A 4MPKA 1QPLA 3MDYB 4TW6A 3CGNA 2VCDA 1SYTA 2O92A 3H9RB 3IHZA 1QZ2A 1W1PA 5DF0A 4HBOA 2ZR6A 4NNRA 3ARSA 4TW8A 3WL1A 2ZR5A 4JFJA 2A3BA 4FAPA 3RMEA 2DT1A 1LJYA 1FKBA 3WIJA 1JVWA 3LUOA 3RM8A 4HARA 1FKRA 2M1IA 2RURA 4N19A 5HW7A 1NMWA 1NWUA 3OA5A 1L1PA 2FDMA 2FKEA 1PBKA 4TNSA 3O5LA 4GIVA 2F2DA 1ZK6A 4DRHA 5GPRA 3RM9A 2DG9A 3ARRA 4FN2A 1BKFA 1A7XA 4ODOA 3UQAA 4ODMA 4AY1A 4MTVA 2WLZA 1PINA 1FKGA 3CHCA 1E6RA 1ZCNA 3WD1A 2LPVA 3O5GA 1C9HA 2Y78A 3ODKA 2PV1A 1QPFA 3ARUA 5HKGA 4DWSA 2N87A 4Q22A 4W9PA 2YBUA 3ARPA 4HBEA 3I6CA 4DRNA 4JFIA 5HTGA 2ESCA 2O9OA 4J4OA 1Q6HA 2XPAA 2LKNA 4DRKA 2DT3A 3PA7A 2AWGA 1ZBKA 5DIVA 3IK8A 3GPKA 4QT3A 5BXJA 1FD9A 4LGXA 2XP3A 3ALGA 3JYJA 1Q6IA 4MGVA 3O5IA 2PV3A 4MSPA 1FFRA 2PPPA 1WAWA 3FAPA 2DG3A 1Q1CA 2ZQTA 2DSUA 3UI6A 1B6CA 3PR9A 1W9UA 1W1YA 2M2AA 1IX5A 4W5UA 1W1TA 4WK9A 4JYSA 4DT4A 3O5EA 4DRJA 4MNMA 4BF8A 1RD6A 2D9FA 3O5RA 1ITXA 2RUCA 3VAWA 4Z2JA 2VN1A 4W9OA 5GQBA 1OGGA 1FKKA 4KR0B 3RFWA 2PV2A 5J6EA 4S3JA 4DWSB 1FKDA 4P8UA 4TW7A 5DO2A 1NWSA 1O6IA 4DIPA 3WD3A 2A3CA 3RM4A 2PBCA 5DITA 4S3KA 2MLZA 4ITZA 5DIUA 4O2TA 2YBTA 4Z2IA 1ZBCA 4IT6A 3QOKA 1XRVA 2KI3A 4G2PA 1Q6UA 2KR7A 1FKFA 1W9PA 2LGOA 1TCOC 1EHNA 2IUZA 3ALFA 4MNKA 4P8VA 4ZPVR 1UR8A 1Y0OA 4URIA 4ZPWR 1HKIA 1N1AA 2ZQUA 1ROTA 1EQ3A 5HUAA 3OOBA 3WKZA 3ARWA 2B31A 3WH0A 1WNOA 3NRKA 3B9DA 4W9QA 2F4EA 5GPGA 1FKHA 1F8AB 1HJXA 4DRPA 3O5MA 4ODPA 3WQWA 1FKJA 1BL4A 2RUQA 3UF8A 3AS3A 4L72B 1GUVA 3WD4A 3EY6A 2MNTA 1ZB5A 3PRAA 1NH6A 4P8WA 3B7XA 1FKLA 1CTNA 5HBFA 3PRBA 4QIBA 2MF9A 1ZU8A 2WM0A 4DZ2A 3PRDA 1U79A 1FAPA 3IKGA 1ZL1A 4JFKA 1UR9A 4DROA 2ZQSA 3WD0A 2FAPA 1LQ0A 1JNTA 3B9EA 3G6MA 3KABA 4L3NA 4DRMA 3NI6A 4WKHA 4DZ3A 2RUDA 5HW8A 2PI6A 4DRQA 2IF4A 1J6YA 1E9LA 5D75A 4WJXA 1KT1A 1M5YA 4R5EA 4DH0A 1W26A 3KAFA 1GPFA 2XPBA 4Q7NA 5HWCA 2XP9A 1JNSA 1FKTA 3AS2A 2KGJA 4ODNA 1NWTA 3KAGA 1X6LA 3JXVA 4DRIA 1W1VA 3CH9A 4U85A 1EIBA 2JZVA 2XP5A 1E15A 4Z2LA 3UI5A 2UZ5A 1FKSA 2AOSA 4JFLA 1EDQA 2DT0A 2KFWA 3FXYA 1H0IA 3KAHA 3FY1A 3UI4A 1HJWA 1LL7A 3BXWA 3ARYA 2DSZA 3KCEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y0O A;  4ODQ A;  2Y78 A;  3ODK A;  3KZ7 A;  2PV1 A;  3TC5 A;  1QPF A;  1N1A A;  2ZQU A;  3UQI A;  3O5P A;  1D7I A;  2PPN A;  3O5K A;  1ROT A;  4IQ2 A;  5HW6 A;  1EQ3 A;  5HUA A;  3OOB A;  5HT1 A;  5HKG A;  1EYM A;  3WH0 A;  3NRK A;  2F21 A;  2XP7 A;  4QT2 A;  4JFM A;  2N87 A;  4W9Q A;  2F4E A;  5GPG A;  5I98 A;  1FKH A;  3CGM A;  4C02 B;  3KAI A;  2KO7 A;  2LJ4 A;  1F8A B;  2M08 A;  2MPH A;  2Q5A A;  4W9P A;  2ZQV A;  3O5O A;  1J4R A;  4DRP A;  1F40 A;  3O5M A;  4ODP A;  1FKJ A;  1BL4 A;  3I6C A;  3IKD A;  2RUQ A;  4DRN A;  4LAX A;  4JFI A;  4TX0 A;  3RGC A;  5HTG A;  3UF8 A;  4ODK A;  2XP8 A;  5B8I C;  4J4O A;  1NMV A;  1Q6H A;  2RQS A;  2RSE A;  2XPA A;  2LKN A;  2ZR4 A;  4ODR A;  2DG4 A;  4DRK A;  5HWB A;  1D7J A;  1YW5 A;  3PA7 A;  3EY6 A;  2AWG A;  2MNT A;  4IPX A;  5DIV A;  4R0X A;  3IK8 A;  1D7H A;  3GPK A;  4QT3 A;  1KT0 A;  1D6O A;  2OFN A;  3B7X A;  4IQC A;  1HXV A;  5BXJ A;  1FD9 A;  4TYO A;  1FKL A;  2XP3 A;  4LAY A;  3JYJ A;  1Q6I A;  4MGV A;  3O5I A;  3PRB A;  2PV3 A;  4QIB A;  2MF9 A;  4MSP A;  1FJD A;  4ODL A;  2L2S A;  2MLX A;  2PPP A;  3FAP A;  4GGQ A;  4DZ2 A;  3PRD A;  2DG3 A;  1U79 A;  3O5F A;  1Q1C A;  2ZQT A;  1R9H A;  3NTP A;  3UI6 A;  1B6C A;  1P5Q A;  4G50 A;  1FAP A;  3IKG A;  1YAT A;  1QPL A;  4JFK A;  4LAW A;  4DRO A;  2M2A A;  3MDY B;  2K8I A;  2ZQS A;  3KAC A;  4TW6 A;  3CGN A;  2FAP A;  2VCD A;  1J4I A;  2MLY A;  4U86 A;  2PPO A;  1JNT A;  3JYM A;  4DT4 A;  3KAB A;  4JYS A;  3O5E A;  3NI6 A;  1NSG A;  3H9R B;  4DRJ A;  4DRM A;  3IHZ A;  1QZ2 A;  4BF8 A;  4DZ3 A;  2RUD A;  5HW8 A;  2ZR6 A;  4NNR A;  4DRQ A;  2D9F A;  2IF4 A;  3KAD A;  3O5R A;  1J6Y A;  1J4H A;  2RUC A;  4TW8 A;  5D75 A;  3VAW A;  2ZR5 A;  2VN1 A;  4JFJ A;  4W9O A;  4FAP A;  1KT1 A;  1M5Y A;  1FKK A;  1FKB A;  3RFW A;  4DH0 A;  1JVW A;  1W26 A;  3LUO A;  2ITK A;  2PV2 A;  3KAF A;  3O5D A;  5J6E A;  2XPB A;  1FKR A;  5HWC A;  1FKD A;  2XP9 A;  4TW7 A;  1JNS A;  1FKT A;  2M1I A;  2RUR A;  4N19 A;  5HW7 A;  1NMW A;  1L1P A;  2KGJ A;  4ODN A;  3TDB A;  2FKE A;  3KAG A;  3JXV A;  1PBK A;  4TNS A;  4DRI A;  4DIP A;  4LAV A;  3O5L A;  4U85 A;  4GIV A;  2F2D A;  1ZK6 A;  2JZV A;  2XP5 A;  2KE0 A;  2XP4 A;  1FKI A;  2PBC A;  5DIT A;  4DRH A;  3UI5 A;  2UZ5 A;  1FKS A;  2DG9 A;  2MLZ A;  4FN2 A;  1BKF A;  1A7X A;  3O5J A;  4JFL A;  4ITZ A;  4ODO A;  3UQA A;  4ODM A;  5DIU A;  4O2T A;  3TCZ A;  2KFW A;  3KAH A;  2XP6 A;  3O5Q A;  1ROU A;  1PIN A;  4J4N A;  3UI4 A;  1FKG A;  2KI3 A;  4G2P A;  3UQB A;  1ZCN A;  1Q6U A;  2KR7 A;  1FKF A;  2LGO A;  4U84 A;  1TCO C;  2LPV A;  3O5G A;  1T11 A;  1C9H A;  3KCE A; 
#chains in the Genus database with same CATH topology
 4ODQ A;  1LG1 A;  4Z2H A;  3WD2 A;  3UQI A;  3O5P A;  3O5K A;  4IQ2 A;  1LL4 A;  5HT1 A;  2WLY A;  2F21 A;  2XP7 A;  3CHD A;  4JFM A;  3ARX A;  4NZC A;  5I98 A;  3CGM A;  1VF8 A;  3CHF A;  4C02 B;  2LJ4 A;  2M08 A;  2ZQV A;  5JH8 A;  4LAX A;  4TX0 A;  4MNL A;  3RGC A;  1HJV A;  4ODK A;  2XP8 A;  2A3E A;  2RQS A;  2RSE A;  5HWB A;  2ZR4 A;  2DG4 A;  1D7J A;  4IPX A;  4R0X A;  4IQC A;  3ARZ A;  1HKM A;  1E6N A;  1FJD A;  3WQV A;  4GGQ A;  1HKJ A;  3AQU A;  1R9H A;  3NTP A;  1YAT A;  4LAW A;  2EUL A;  1WB0 A;  2K8I A;  3KAC A;  1ZBW A;  1J4I A;  2MLY A;  4U86 A;  2PPO A;  2DPE A;  3JYM A;  3G6L A;  1NSG A;  3ARV A;  2DT2 A;  3KAD A;  3B8S A;  1J4H A;  4PTM A;  1ZBV A;  2DSV A;  4Z2G A;  3AS0 A;  2ITK A;  3O5D A;  2G41 A;  3ART A;  4QZV B;  1D2K A;  4ML4 A;  1E6P A;  3AS1 A;  3TDB A;  4KQZ A;  4LAV A;  2XP4 A;  2KE0 A;  3ARO A;  1FKI A;  5DEZ A;  4WIW A;  1OGB A;  3O5J A;  2QF8 A;  3TCZ A;  2XP6 A;  3O5Q A;  1ROU A;  4J4N A;  4P8X A;  4WKF A;  1XHG A;  4ZS6 A;  3UQB A;  4U84 A;  3B9A A;  1T11 A;  4MAV A;  4TYO A;  3ARQ A;  2WK2 A;  3CHE A;  2PN0 A;  3KZ7 A;  4DWS C;  3TC5 A;  1K9T A;  3CZ8 A;  3WL0 A;  1D7I A;  2G8Z A;  2PPN A;  3GTY X;  2A3A A;  5HW6 A;  1GOI A;  4MNJ A;  1OWQ A;  1JNE A;  1X6N A;  1EYM A;  4QT2 A;  4Z2K A;  4WKA A;  3BMB A;  1W9V A;  1JND A;  3KAI A;  2KO7 A;  2MPH A;  2Q5A A;  1KFW A;  1E6Z A;  4IT4 A;  3O5O A;  1J4R A;  1F40 A;  4NSB A;  1NWR A;  3IKD A;  1HKK A;  1SR0 A;  5B8I C;  1NMV A;  3W4R A;  4ODR A;  4ZPT R;  1YW5 A;  4XAK A;  1D7H A;  4DWS D;  1KT0 A;  1H0G A;  1D6O A;  2OFN A;  1HXV A;  1LL6 A;  2OLH A;  4LAY A;  1LG2 A;  4ODL A;  2L2S A;  2DSW A;  2MLX A;  1TFV A;  1FFQ A;  3O5F A;  1P5Q A;  4G50 A;  4MPK A;  1QPL A;  3MDY B;  4TW6 A;  3CGN A;  2VCD A;  1SYT A;  2O92 A;  1JCH B;  3H9R B;  3IHZ A;  1QZ2 A;  1W1P A;  5DF0 A;  4HBO A;  2ZR6 A;  4NNR A;  3ARS A;  4TW8 A;  3WL1 A;  2ZR5 A;  4JFJ A;  2A3B A;  4FAP A;  3RME A;  2DT1 A;  1LJY A;  1FKB A;  3WIJ A;  1JVW A;  3LUO A;  3RM8 A;  4HAR A;  1FKR A;  2M1I A;  2B5U B;  2RUR A;  4N19 A;  5HW7 A;  1NMW A;  1NWU A;  3OA5 A;  1L1P A;  2FDM A;  2FKE A;  1PBK A;  4TNS A;  2F23 A;  3O5L A;  4GIV A;  2F2D A;  1ZK6 A;  4DRH A;  5GPR A;  3RM9 A;  3GU0 A;  2DG9 A;  3ARR A;  4FN2 A;  1BKF A;  1A7X A;  3EIP A;  4ODO A;  3UQA A;  4ODM A;  4AY1 A;  4MTV A;  2WLZ A;  1PIN A;  1FKG A;  3CHC A;  1E6R A;  1ZCN A;  3WD1 A;  2LPV A;  3O5G A;  1C9H A;  2Y78 A;  3ODK A;  2PV1 A;  1QPF A;  3ARU A;  5HKG A;  4DWS A;  2N87 A;  4Q22 A;  4W9P A;  2YBU A;  3ARP A;  4HBE A;  3I6C A;  4DRN A;  4JFI A;  5HTG A;  2ESC A;  2O9O A;  4J4O A;  1GRJ A;  1Q6H A;  2XPA A;  2LKN A;  4DRK A;  2DT3 A;  3PA7 A;  2AWG A;  1ZBK A;  5DIV A;  3IK8 A;  3GPK A;  4QT3 A;  5BXJ A;  1FD9 A;  4LGX A;  2XP3 A;  3ALG A;  3JYJ A;  1Q6I A;  4MGV A;  3O5I A;  2PV3 A;  4MSP A;  1FFR A;  2PPP A;  1WAW A;  3FAP A;  2DG3 A;  1Q1C A;  2ZQT A;  2DSU A;  3UI6 A;  1B6C A;  3PR9 A;  1W9U A;  1W1Y A;  2ETN A;  2M2A A;  1IX5 A;  4W5U A;  1W1T A;  4WK9 A;  4JYS A;  4DT4 A;  3O5E A;  4DRJ A;  4MNM A;  4BF8 A;  1RD6 A;  2D9F A;  3O5R A;  1ITX A;  2RUC A;  3VAW A;  4Z2J A;  2VN1 A;  4W9O A;  5GQB A;  1OGG A;  1FKK A;  4KR0 B;  3RFW A;  2PV2 A;  5J6E A;  4S3J A;  4DWS B;  1FKD A;  4P8U A;  4TW7 A;  5DO2 A;  1NWS A;  1O6I A;  4DIP A;  3WD3 A;  2A3C A;  2P4V A;  3RM4 A;  2PBC A;  5DIT A;  4S3K A;  2MLZ A;  4ITZ A;  5DIU A;  4O2T A;  2YBT A;  4Z2I A;  1ZBC A;  4IT6 A;  3QOK A;  1XRV A;  2KI3 A;  4G2P A;  1Q6U A;  2KR7 A;  1FKF A;  1W9P A;  2LGO A;  1TCO C;  1EHN A;  2IUZ A;  3ALF A;  4MNK A;  4P8V A;  4ZPV R;  1UR8 A;  1Y0O A;  4URI A;  4ZPW R;  1HKI A;  1N1A A;  2ZQU A;  1ROT A;  1EQ3 A;  5HUA A;  3OOB A;  3WKZ A;  3ARW A;  2B31 A;  3WH0 A;  1WNO A;  3NRK A;  3B9D A;  4W9Q A;  2F4E A;  5GPG A;  1FKH A;  1E44 A;  1F8A B;  1HJX A;  4DRP A;  3O5M A;  4ODP A;  3WQW A;  1FKJ A;  1BL4 A;  2RUQ A;  3UF8 A;  3AS3 A;  4L72 B;  1GUV A;  3WD4 A;  3EY6 A;  2MNT A;  1ZB5 A;  3PRA A;  1NH6 A;  4P8W A;  3B7X A;  1FKL A;  1CTN A;  5HBF A;  3PRB A;  4QIB A;  2MF9 A;  1ZU8 A;  2WM0 A;  4DZ2 A;  3PRD A;  1U79 A;  4UDM A;  1FAP A;  3IKG A;  1ZL1 A;  4JFK A;  1UR9 A;  4DRO A;  2ZQS A;  3WD0 A;  2FAP A;  1LQ0 A;  1JNT A;  3B9E A;  3G6M A;  3KAB A;  4L3N A;  4DRM A;  3NI6 A;  4WKH A;  4DZ3 A;  2RUD A;  5HW8 A;  2PI6 A;  4DRQ A;  2IF4 A;  1J6Y A;  1E9L A;  5D75 A;  4WJX A;  1KT1 A;  1M5Y A;  4R5E A;  4DH0 A;  1W26 A;  3KAF A;  1GPF A;  2XPB A;  4Q7N A;  5HWC A;  2XP9 A;  1JNS A;  1FKT A;  3AS2 A;  2KGJ A;  4ODN A;  1NWT A;  3KAG A;  1X6L A;  3JXV A;  4DRI A;  1W1V A;  3CH9 A;  4U85 A;  1EIB A;  2JZV A;  2XP5 A;  1E15 A;  4Z2L A;  3UI5 A;  2UZ5 A;  1FKS A;  2AOS A;  4JFL A;  1EDQ A;  2DT0 A;  2KFW A;  3FXY A;  1H0I A;  3KAH A;  3FY1 A;  3UI4 A;  1HJW A;  1LL7 A;  3BXW A;  3ARY A;  2DSZ A;  3KCE A; 
#chains in the Genus database with same CATH homology
 4ODQ A;  1LG1 A;  4Z2H A;  3WD2 A;  3UQI A;  3O5P A;  3O5K A;  4IQ2 A;  1LL4 A;  5HT1 A;  2WLY A;  2F21 A;  2XP7 A;  3CHD A;  4JFM A;  3ARX A;  4NZC A;  5I98 A;  3CGM A;  1VF8 A;  3CHF A;  4C02 B;  2LJ4 A;  2M08 A;  2ZQV A;  5JH8 A;  4LAX A;  4TX0 A;  4MNL A;  3RGC A;  1HJV A;  4ODK A;  2XP8 A;  2A3E A;  2RQS A;  2RSE A;  5HWB A;  2ZR4 A;  2DG4 A;  1D7J A;  4IPX A;  4R0X A;  4IQC A;  3ARZ A;  1HKM A;  1E6N A;  1FJD A;  3WQV A;  4GGQ A;  1HKJ A;  3AQU A;  1R9H A;  3NTP A;  1YAT A;  4LAW A;  1WB0 A;  2K8I A;  3KAC A;  1ZBW A;  1J4I A;  2MLY A;  4U86 A;  2PPO A;  2DPE A;  3JYM A;  3G6L A;  1NSG A;  3ARV A;  2DT2 A;  3KAD A;  3B8S A;  1J4H A;  4PTM A;  1ZBV A;  2DSV A;  4Z2G A;  3AS0 A;  2ITK A;  3O5D A;  2G41 A;  3ART A;  4QZV B;  1D2K A;  4ML4 A;  1E6P A;  3AS1 A;  3TDB A;  4KQZ A;  4LAV A;  2XP4 A;  2KE0 A;  3ARO A;  1FKI A;  5DEZ A;  4WIW A;  1OGB A;  3O5J A;  2QF8 A;  3TCZ A;  2XP6 A;  3O5Q A;  1ROU A;  4J4N A;  4P8X A;  4WKF A;  1XHG A;  4ZS6 A;  3UQB A;  4U84 A;  3B9A A;  1T11 A;  4MAV A;  4TYO A;  3ARQ A;  2WK2 A;  3CHE A;  3KZ7 A;  4DWS C;  3TC5 A;  1K9T A;  3CZ8 A;  3WL0 A;  1D7I A;  2G8Z A;  2PPN A;  2A3A A;  5HW6 A;  1GOI A;  4MNJ A;  1OWQ A;  1JNE A;  1X6N A;  1EYM A;  4QT2 A;  4Z2K A;  4WKA A;  1W9V A;  1JND A;  3KAI A;  2KO7 A;  2MPH A;  2Q5A A;  1KFW A;  1E6Z A;  4IT4 A;  3O5O A;  1J4R A;  1F40 A;  4NSB A;  1NWR A;  3IKD A;  1HKK A;  1SR0 A;  5B8I C;  1NMV A;  3W4R A;  4ODR A;  4ZPT R;  1YW5 A;  4XAK A;  1D7H A;  4DWS D;  1KT0 A;  1H0G A;  1D6O A;  2OFN A;  1HXV A;  1LL6 A;  2OLH A;  4LAY A;  1LG2 A;  4ODL A;  2L2S A;  2DSW A;  2MLX A;  1TFV A;  1FFQ A;  3O5F A;  1P5Q A;  4G50 A;  4MPK A;  1QPL A;  3MDY B;  4TW6 A;  3CGN A;  2VCD A;  1SYT A;  2O92 A;  3H9R B;  3IHZ A;  1QZ2 A;  1W1P A;  5DF0 A;  4HBO A;  2ZR6 A;  4NNR A;  3ARS A;  4TW8 A;  3WL1 A;  2ZR5 A;  4JFJ A;  2A3B A;  4FAP A;  3RME A;  2DT1 A;  1LJY A;  1FKB A;  3WIJ A;  1JVW A;  3LUO A;  3RM8 A;  4HAR A;  1FKR A;  2M1I A;  2RUR A;  4N19 A;  5HW7 A;  1NMW A;  1NWU A;  3OA5 A;  1L1P A;  2FDM A;  2FKE A;  1PBK A;  4TNS A;  3O5L A;  4GIV A;  2F2D A;  1ZK6 A;  4DRH A;  5GPR A;  3RM9 A;  2DG9 A;  3ARR A;  4FN2 A;  1BKF A;  1A7X A;  4ODO A;  3UQA A;  4ODM A;  4AY1 A;  4MTV A;  2WLZ A;  1PIN A;  1FKG A;  3CHC A;  1E6R A;  1ZCN A;  3WD1 A;  2LPV A;  3O5G A;  1C9H A;  2Y78 A;  3ODK A;  2PV1 A;  1QPF A;  3ARU A;  5HKG A;  4DWS A;  2N87 A;  4Q22 A;  4W9P A;  2YBU A;  3ARP A;  4HBE A;  3I6C A;  4DRN A;  4JFI A;  5HTG A;  2ESC A;  2O9O A;  4J4O A;  1Q6H A;  2XPA A;  2LKN A;  4DRK A;  2DT3 A;  3PA7 A;  2AWG A;  1ZBK A;  5DIV A;  3IK8 A;  3GPK A;  4QT3 A;  5BXJ A;  1FD9 A;  4LGX A;  2XP3 A;  3ALG A;  3JYJ A;  1Q6I A;  4MGV A;  3O5I A;  2PV3 A;  4MSP A;  1FFR A;  2PPP A;  1WAW A;  3FAP A;  2DG3 A;  1Q1C A;  2ZQT A;  2DSU A;  3UI6 A;  1B6C A;  3PR9 A;  1W9U A;  1W1Y A;  2M2A A;  1IX5 A;  4W5U A;  1W1T A;  4WK9 A;  4JYS A;  4DT4 A;  3O5E A;  4DRJ A;  4MNM A;  4BF8 A;  1RD6 A;  2D9F A;  3O5R A;  1ITX A;  2RUC A;  3VAW A;  4Z2J A;  2VN1 A;  4W9O A;  5GQB A;  1OGG A;  1FKK A;  4KR0 B;  3RFW A;  2PV2 A;  5J6E A;  4S3J A;  4DWS B;  1FKD A;  4P8U A;  4TW7 A;  5DO2 A;  1NWS A;  1O6I A;  4DIP A;  3WD3 A;  2A3C A;  3RM4 A;  2PBC A;  5DIT A;  4S3K A;  2MLZ A;  4ITZ A;  5DIU A;  4O2T A;  2YBT A;  4Z2I A;  1ZBC A;  4IT6 A;  3QOK A;  1XRV A;  2KI3 A;  4G2P A;  1Q6U A;  2KR7 A;  1FKF A;  1W9P A;  2LGO A;  1TCO C;  1EHN A;  2IUZ A;  3ALF A;  4MNK A;  4P8V A;  4ZPV R;  1UR8 A;  1Y0O A;  4URI A;  4ZPW R;  1HKI A;  1N1A A;  2ZQU A;  1ROT A;  1EQ3 A;  5HUA A;  3OOB A;  3WKZ A;  3ARW A;  2B31 A;  3WH0 A;  1WNO A;  3NRK A;  3B9D A;  4W9Q A;  2F4E A;  5GPG A;  1FKH A;  1F8A B;  1HJX A;  4DRP A;  3O5M A;  4ODP A;  3WQW A;  1FKJ A;  1BL4 A;  2RUQ A;  3UF8 A;  3AS3 A;  4L72 B;  1GUV A;  3WD4 A;  3EY6 A;  2MNT A;  1ZB5 A;  3PRA A;  1NH6 A;  4P8W A;  3B7X A;  1FKL A;  1CTN A;  5HBF A;  3PRB A;  4QIB A;  2MF9 A;  1ZU8 A;  2WM0 A;  4DZ2 A;  3PRD A;  1U79 A;  1FAP A;  3IKG A;  1ZL1 A;  4JFK A;  1UR9 A;  4DRO A;  2ZQS A;  3WD0 A;  2FAP A;  1LQ0 A;  1JNT A;  3B9E A;  3G6M A;  3KAB A;  4L3N A;  4DRM A;  3NI6 A;  4WKH A;  4DZ3 A;  2RUD A;  5HW8 A;  2PI6 A;  4DRQ A;  2IF4 A;  1J6Y A;  1E9L A;  5D75 A;  4WJX A;  1KT1 A;  1M5Y A;  4R5E A;  4DH0 A;  1W26 A;  3KAF A;  1GPF A;  2XPB A;  4Q7N A;  5HWC A;  2XP9 A;  1JNS A;  1FKT A;  3AS2 A;  2KGJ A;  4ODN A;  1NWT A;  3KAG A;  1X6L A;  3JXV A;  4DRI A;  1W1V A;  3CH9 A;  4U85 A;  1EIB A;  2JZV A;  2XP5 A;  1E15 A;  4Z2L A;  3UI5 A;  2UZ5 A;  1FKS A;  2AOS A;  4JFL A;  1EDQ A;  2DT0 A;  2KFW A;  3FXY A;  1H0I A;  3KAH A;  3FY1 A;  3UI4 A;  1HJW A;  1LL7 A;  3BXW A;  3ARY A;  2DSZ A;  3KCE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...