1Y0OA

Crystal structure of reduced atfkbp13
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
125
structure length
125
Chain Sequence
CEFSVSPSGLAFCDKVVGYGPEAVKGQLIKAHYVGKLENGKVFDSSYNRGKPLTFRIGVGEVIKGWDQGILGSDGIPPMLTGGKRTLRIPPELAYGDRGAGCKGGSCLIPPASVLLFDIEYIGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of reduced AtFKBP13
rcsb
source organism Arabidopsis thaliana
molecule tags Isomerase
molecule keywords FKBP-type peptidyl-prolyl cis-trans isomerase 3
total genus 26
structure length 125
sequence length 125
chains with identical sequence B, C, D, E
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2004-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1y0oA00
1JNSA 2ZQSA 3IKDA 1NMVA 4DROA 3KAHA 2XP8A 4IQCA 4MGVA 2LPVA 1KT0A 3O5KA 2LJ4A 5D75A 1PINA 2XP7A 1QZ2A 2LGOA 2MNTA 2Y78A 2MF9A 2PV3A 4QIBA 3H9RB 5HKGA 1Q6HA 1FKRA 4DIPA 4IQ2A 3ODKA 1YW5A 2XP4A 2ZQTA 2F2DA 4FN2A 2ZR6A 5GPGA 2AWGA 2PV1A 2MLXA 3JYMA 4ODKA 2FKEA 3TDBA 2VCDA 1Q1CA 3JXVA 3PRBA 3IHZA 3KCEA 4DRPA 1HXVA 4DRJA 2KO7A 3O5DA 2MLYA 4NNRA 2MPHA 2PPOA 4GGQA 4C02B 2ITKA 3O5JA 2KE0A 2XP6A 4JFKA 4DH0A 4DRQA 2RUDA 1ZK6A 1TCOC 1QPFA 4W9PA 1D7JA 5HW7A 2RURA 4LAWA 1L1PA 3UI4A 1D6OA 3O5MA 2ZQVA 1FKFA 5I98A 4GIVA 4DRIA 3JYJA 4LAVA 3KABA 1J6YA 3EY6A 1ROUA 1FAPA 1FD9A 5B8IC 1FKHA 1M5YA 2FAPA 4J4NA 1FKJA 1FKIA 1J4RA 5DIUA 4DZ3A 2RSEA 5BXJA 2ZR5A 1F40A 3O5PA 1J4IA 3O5IA 4W9QA 4BF8A 3KAFA 1FKSA 1Q6IA 1R9HA 3VAWA 2LKNA 3RGCA 4U84A 1P5QA 3UF8A 1N1AA 2XPBA 4TW8A 1U79A 4U86A 2UZ5A 5HUAA 4G2PA 3O5LA 4J4OA 3UI6A 3B7XA 4ODRA 4IPXA 4QT2A 3IKGA 4ODMA 1J4HA 3I6CA 5HW6A 2PPNA 1PBKA 4LAYA 4O2TA 2N87A 1EQ3A 2PPPA 4JFJA 3KAIA 1B6CA 1FKKA 2MLZA 5HWBA 4N19A 5J6EA 4ODOA 2L2SA 1FJDA 2OFNA 1NMWA 2D9FA 2RQSA 4ITZA 1D7IA 1KT1A 1W26A 3O5GA 4DT4A 1BL4A 2JZVA 4TW6A 1ZCNA 2KR7A 3O5QA 4G50A 4LAXA 2KI3A 4MSPA 3LUOA 2DG3A 3RFWA 1NSGA 2VN1A 5HTGA 3IK8A 4R0XA 3TC5A 1YATA 3PRDA 3KZ7A 5HW8A 3NRKA 2ZR4A 3O5FA 3FAPA 1FKLA 4TW7A 2DG4A 4DRMA 1C9HA 4TX0A 3TCZA 1JVWA 4JFLA 3WH0A 2M1IA 5DITA 4ODQA 2KFWA 2F4EA 4ODLA 3UQIA 4TYOA 1JNTA 3NTPA 4JYSA 3UI5A 4DZ2A 1D7HA 2KGJA 4U85A 4DRKA 3UQAA 2Q5AA 1FKDA 3KACA 1FKGA 3O5EA 4JFIA 3O5OA 4TNSA 5DIVA 2F21A 1Q6UA 4W9OA 2RUQA 4DRNA 1EYMA 2XP9A 2ZQUA 1BKFA 3GPKA 3KADA 3CGMA 2RUCA 4DRHA 1ROTA 2XP3A 3PA7A 2M2AA 4ODNA 4ODPA 3O5RA 1T11A 3OOBA 3UQBA 2XP5A 3MDYB 5HT1A 1F8AB 1QPLA 5HWCA 4QT3A 4FAPA 3NI6A 1FKTA 1Y0OA 2PBCA 3CGNA 3KAGA 4JFMA 2XPAA 2DG9A 1A7XA 2IF4A 1FKBA 2K8IA 2M08A 2PV2A
chains in the Genus database with same CATH superfamily
3WD4A 1JNSA 5GPRA 2AOSA 1GRJA 4IQCA 2LPVA 1KT0A 1ZBWA 1PINA 2XP7A 3BMBA 3QOKA 4QIBA 2MF9A 5DEZA 3WD1A 3AS1A 4WIWA 1YW5A 2F2DA 2ZR6A 5GPGA 3TDBA 3JXVA 3IHZA 3AS2A 4DRPA 4DRJA 3AQUA 2MPHA 4GGQA 1LG1A 4JFKA 4DH0A 2YBUA 4DRQA 2RURA 3B9AA 3CHCA 1D6OA 1EDQA 4Z2HA 1HKJA 3AROA 1J6YA 1ROUA 1OWQA 1FD9A 2FAPA 2DSVA 1FKJA 1RD6A 1J4RA 4LGXA 1J4IA 4W9QA 4BF8A 1FKSA 4ML4A 1LG2A 2DT1A 4TW8A 2UZ5A 5HUAA 4G2PA 4J4OA 4ODMA 1J4HA 3G6LA 3I6CA 5HW6A 4QZVB 3ARYA 4WK9A 2N87A 1W1PA 1X6LA 4P8VA 2DT3A 2MLZA 5HWBA 5JH8A 2OFNA 1D7IA 2JZVA 4TW6A 2KR7A 4LAXA 3GU0A 2PI6A 3FXYA 3RM9A 3IK8A 3PRDA 5HW8A 1FKLA 3TCZA 3WH0A 4ODLA 3ARXA 1LQ0A 1ZBVA 1HKKA 3NTPA 4WKFA 3ARQA 1ITXA 1D7HA 5DF0A 4NSBA 4JFIA 5DIVA 2F21A 2RUQA 2XP9A 3KADA 3OA5A 4P8UA 3G6MA 3PA7A 1KFWA 2WLYA 1ZL1A 3O5RA 4IT6A 1F8AB 3NI6A 4Z2JA 2PV2A 1FFQA 1SR0A 1H0GA 2K8IA 1WB0A 3IKDA 1OGGA 4S3JA 3PRAA 4MGVA 3WL1A 4Q22A 4MPKA 2LGOA 2PV3A 1Q6HA 4IQ2A 2ZQTA 2XP4A 1NWTA 1X6NA 4L72B 3GTYX 2MLXA 4ODKA 2FKEA 4MNKA 4AY1A 2VCDA 1Q1CA 3PRBA 1LJYA 4KQZA 1HJXA 2KO7A 3O5DA 3RMEA 1E6RA 1W9PA 2XP6A 4PTMA 2RUDA 3FY1A 2PN0A 1QPFA 4MNLA 1D7JA 5HW7A 3ARVA 4LAWA 1WNOA 1ZU8A 3O5MA 2ESCA 4DWSC 1FKFA 5I98A 1XRVA 4GIVA 1HJVA 1EHNA 1LL6A 5B8IC 4J4NA 1W1TA 3WD0A 1LL7A 2A3BA 1NH6A 1Q6IA 1R9HA 2LKNA 3RGCA 5DO2A 4U84A 1P5QA 3UF8A 2IUZA 1E9LA 3ARWA 3WQWA 3IKGA 1W9VA 1NWSA 1ZB5A 1PBKA 2G8ZA 3WIJA 4JFJA 4N19A 4ODOA 2RQSA 1KT1A 1W26A 3O5GA 1BL4A 3O5QA 3WD2A 4MSPA 3RFWA 2DG3A 1NSGA 2VN1A 4R0XA 4KR0B 1LL4A 1YATA 3O5FA 1C9HA 4TX0A 4ODQA 3UQIA 4L3NA 3BXWA 2KGJA 4U85A 4HARA 2B5UB 3O5EA 1Q6UA 4W9OA 3PR9A 4DRHA 1BKFA 1E44A 4DWSB 2M2AA 4ZS6A 5HBFA 1T11A 3MDYB 3ARUA 4QT3A 1CTNA 2EULA 3CHFA 2ETNA 2PBCA 3WKZA 3CGNA 4JFMA 2IF4A 2ZQSA 4DROA 2XP8A 3ARRA 3O5KA 2LJ4A 2MNTA 1D2KA 4DIPA 2A3AA 1UR9A 3CH9A 1NWRA 4FN2A 2AWGA 3AS0A 4UDMA 1GUVA 2MLYA 4XAKA 2PPOA 4C02B 3O5JA 1ZK6A 1TCOC 4W9PA 1W1YA 1TFVA 1L1PA 2ZQVA 3W4RA 3JYJA 3KABA 1HKIA 4P8XA 1FAPA 1VF8A 3ARTA 1FKHA 1M5YA 4MNJA 2RSEA 2ZR5A 2DT0A 3KAFA 3VAWA 3RM4A 3CZ8A 2DSZA 1U79A 4U86A 3O5LA 3UI6A 3B7XA 4ODRA 4IPXA 3ARSA 5GQBA 4WKAA 1OGBA 2YBTA 1E15A 4LAYA 4O2TA 1IX5A 1B6CA 1FKKA 2G41A 4ZPTR 1JNDA 3WQVA 4G50A 5HTGA 3TC5A 3KZ7A 3NRKA 2WM0A 4TW7A 3B9DA 2DG4A 2A3EA 4DRMA 1JVWA 4JFLA 2M1IA 1K9TA 2F4EA 2DSUA 4TYOA 1JNTA 4DZ2A 3UQAA 4DRKA 3KACA 2WLZA 1ZBCA 1FKGA 3O5OA 4DRNA 1EYMA 2ZQUA 3GPKA 3ALGA 2RUCA 1ROTA 2XP3A 1HKMA 1ZBKA 3OOBA 3UQBA 3CHEA 2FDMA 3RM8A 2A3CA 4WJXA 3KAGA 3B8SA 2DG9A 1A7XA 2Q5AA 2QF8A 4Z2GA 1JNEA 1NMVA 3KAHA 4Z2IA 1H0IA 4NZCA 5D75A 1QZ2A 2Y78A 4HBEA 5HKGA 1FKRA 3H9RB 4WKHA 4Z2KA 3WL0A 3ODKA 1XHGA 3ARZA 3AS3A 4P8WA 2PV1A 1GPFA 3JYMA 3KCEA 2F23A 1HXVA 1E6PA 4NNRA 2ITKA 2KE0A 3WD3A 1W1VA 4Z2LA 3UI4A 4DRIA 2O9OA 4LAVA 2DT2A 3EY6A 1FKIA 4DZ3A 5DIUA 5BXJA 1F40A 3O5PA 1UR8A 3O5IA 4DWSD 1N1AA 2XPBA 2O92A 4Q7NA 1W9UA 4QT2A 1FFRA 4DWSA 2PPNA 1EQ3A 2PPPA 3KAIA 5J6EA 4HBOA 2L2SA 4MTVA 1FJDA 4ITZA 1NMWA 2D9FA 4DT4A 1ZCNA 1SYTA 2KI3A 3LUOA 1JCHB 4ZPWR 4S3KA 4IT4A 2ZR4A 3FAPA 2P4VA 4W5UA 5DITA 4ZPVR 2KFWA 4R5EA 3EIPA 1O6IA 4JYSA 2B31A 3UI5A 1NWUA 1FKDA 4URIA 3ALFA 4MNMA 2OLHA 1GOIA 2DSWA 4TNSA 1E6ZA 3ARPA 2DPEA 1E6NA 3CGMA 4ODNA 1EIBA 4ODPA 1HJWA 4MAVA 2XP5A 5HT1A 1QPLA 3CHDA 4FAPA 2WK2A 1FKTA 1Y0OA 1WAWA 2XPAA 3B9EA 5HWCA 1FKBA 2M08A
chains in the Genus database with same CATH topology
3WD4A 1JNSA 5GPRA 2AOSA 4IQCA 2LPVA 1KT0A 1ZBWA 1PINA 2XP7A 4QIBA 3QOKA 2MF9A 5DEZA 3WD1A 3AS1A 4WIWA 1YW5A 2F2DA 2ZR6A 5GPGA 3TDBA 3JXVA 3IHZA 3AS2A 4DRPA 4DRJA 3AQUA 2MPHA 4GGQA 1LG1A 4JFKA 4DH0A 2YBUA 4DRQA 2RURA 3B9AA 3CHCA 1D6OA 1EDQA 4Z2HA 1HKJA 3AROA 1J6YA 1ROUA 1OWQA 1FD9A 2FAPA 2DSVA 1FKJA 1RD6A 1J4RA 4LGXA 1J4IA 4W9QA 4BF8A 1FKSA 4ML4A 1LG2A 2DT1A 4TW8A 2UZ5A 5HUAA 4G2PA 4J4OA 4ODMA 1J4HA 3G6LA 3I6CA 5HW6A 4QZVB 3ARYA 4WK9A 2N87A 1W1PA 1X6LA 4P8VA 2DT3A 2MLZA 5HWBA 5JH8A 2OFNA 1D7IA 2JZVA 4TW6A 2KR7A 4LAXA 2PI6A 3FXYA 3RM9A 3IK8A 3PRDA 5HW8A 1FKLA 3TCZA 3WH0A 4ODLA 3ARXA 1LQ0A 1ZBVA 1HKKA 3NTPA 4WKFA 3ARQA 1ITXA 1D7HA 5DF0A 4NSBA 4JFIA 5DIVA 2F21A 2RUQA 2XP9A 3KADA 3OA5A 4P8UA 3G6MA 3PA7A 1KFWA 2WLYA 1ZL1A 3O5RA 4IT6A 1F8AB 3NI6A 4Z2JA 2PV2A 1FFQA 1SR0A 1H0GA 2K8IA 1WB0A 3IKDA 1OGGA 4S3JA 3PRAA 4MGVA 3WL1A 4Q22A 4MPKA 2LGOA 2PV3A 1Q6HA 4IQ2A 2ZQTA 2XP4A 1NWTA 1X6NA 4L72B 2MLXA 4ODKA 2FKEA 4MNKA 4AY1A 2VCDA 1Q1CA 3PRBA 1LJYA 4KQZA 1HJXA 2KO7A 3O5DA 3RMEA 1E6RA 1W9PA 2XP6A 4PTMA 2RUDA 3FY1A 1QPFA 4MNLA 1D7JA 5HW7A 3ARVA 4LAWA 1WNOA 1ZU8A 3O5MA 2ESCA 4DWSC 1FKFA 5I98A 1XRVA 4GIVA 1HJVA 1EHNA 1LL6A 5B8IC 4J4NA 1W1TA 3WD0A 1LL7A 2A3BA 1NH6A 1Q6IA 1R9HA 2LKNA 3RGCA 5DO2A 4U84A 1P5QA 3UF8A 2IUZA 1E9LA 3ARWA 3WQWA 3IKGA 1W9VA 1NWSA 1ZB5A 1PBKA 2G8ZA 3WIJA 4JFJA 4N19A 4ODOA 2RQSA 1KT1A 1W26A 3O5GA 1BL4A 3O5QA 3WD2A 4MSPA 3RFWA 2DG3A 1NSGA 2VN1A 4R0XA 4KR0B 1LL4A 1YATA 3O5FA 1C9HA 4TX0A 4ODQA 3UQIA 4L3NA 3BXWA 2KGJA 4U85A 4HARA 3O5EA 1Q6UA 4W9OA 3PR9A 4DRHA 1BKFA 4DWSB 2M2AA 4ZS6A 5HBFA 1T11A 3MDYB 3ARUA 4QT3A 1CTNA 3CHFA 2PBCA 3WKZA 3CGNA 4JFMA 2IF4A 2ZQSA 4DROA 2XP8A 3ARRA 3O5KA 2LJ4A 2MNTA 1D2KA 4DIPA 2A3AA 1UR9A 3CH9A 1NWRA 4FN2A 2AWGA 3AS0A 1GUVA 2MLYA 4XAKA 2PPOA 4C02B 3O5JA 1ZK6A 1TCOC 4W9PA 1W1YA 1TFVA 1L1PA 2ZQVA 3W4RA 3JYJA 3KABA 1HKIA 4P8XA 1FAPA 1VF8A 3ARTA 1FKHA 1M5YA 4MNJA 2RSEA 2ZR5A 2DT0A 3KAFA 3VAWA 3RM4A 3CZ8A 2DSZA 1U79A 4U86A 3O5LA 3UI6A 3B7XA 4ODRA 4IPXA 3ARSA 5GQBA 4WKAA 1OGBA 2YBTA 1E15A 4LAYA 4O2TA 1IX5A 1B6CA 1FKKA 2G41A 4ZPTR 1JNDA 3WQVA 4G50A 5HTGA 3TC5A 3KZ7A 3NRKA 2WM0A 4TW7A 3B9DA 2DG4A 2A3EA 4DRMA 1JVWA 4JFLA 2M1IA 1K9TA 2F4EA 2DSUA 4TYOA 1JNTA 4DZ2A 3UQAA 4DRKA 3KACA 2WLZA 1ZBCA 1FKGA 3O5OA 4DRNA 1EYMA 2ZQUA 3GPKA 3ALGA 2RUCA 1ROTA 2XP3A 1HKMA 1ZBKA 3OOBA 3UQBA 3CHEA 2FDMA 3RM8A 2A3CA 4WJXA 3KAGA 3B8SA 2DG9A 1A7XA 2Q5AA 2QF8A 4Z2GA 1JNEA 1NMVA 3KAHA 4Z2IA 1H0IA 4NZCA 5D75A 1QZ2A 2Y78A 4HBEA 5HKGA 1FKRA 3H9RB 4WKHA 4Z2KA 3WL0A 3ODKA 1XHGA 3ARZA 3AS3A 4P8WA 2PV1A 1GPFA 3JYMA 3KCEA 1HXVA 1E6PA 4NNRA 2ITKA 2KE0A 3WD3A 1W1VA 4Z2LA 3UI4A 4DRIA 2O9OA 4LAVA 2DT2A 3EY6A 1FKIA 4DZ3A 5DIUA 5BXJA 1F40A 3O5PA 1UR8A 3O5IA 4DWSD 1N1AA 2XPBA 2O92A 4Q7NA 1W9UA 4QT2A 1FFRA 4DWSA 2PPNA 1EQ3A 2PPPA 3KAIA 5J6EA 4HBOA 2L2SA 4MTVA 1FJDA 4ITZA 1NMWA 2D9FA 4DT4A 1ZCNA 1SYTA 2KI3A 3LUOA 4ZPWR 4S3KA 4IT4A 2ZR4A 3FAPA 4W5UA 5DITA 4ZPVR 2KFWA 4R5EA 1O6IA 4JYSA 2B31A 3UI5A 1NWUA 1FKDA 4URIA 3ALFA 4MNMA 2OLHA 1GOIA 2DSWA 4TNSA 1E6ZA 3ARPA 2DPEA 1E6NA 3CGMA 4ODNA 1EIBA 4ODPA 1HJWA 4MAVA 2XP5A 5HT1A 1QPLA 3CHDA 4FAPA 2WK2A 1FKTA 1Y0OA 1WAWA 2XPAA 3B9EA 5HWCA 1FKBA 2M08A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JNS A;  2ZQS A;  3IKD A;  1NMV A;  4DRO A;  3KAH A;  2XP8 A;  4IQC A;  4MGV A;  2LPV A;  1KT0 A;  3O5K A;  2LJ4 A;  5D75 A;  1PIN A;  2XP7 A;  1QZ2 A;  2LGO A;  2MNT A;  2Y78 A;  2MF9 A;  2PV3 A;  4QIB A;  3H9R B;  5HKG A;  1Q6H A;  1FKR A;  4DIP A;  4IQ2 A;  3ODK A;  1YW5 A;  2XP4 A;  2ZQT A;  2F2D A;  4FN2 A;  2ZR6 A;  5GPG A;  2AWG A;  2PV1 A;  2MLX A;  3JYM A;  4ODK A;  2FKE A;  3TDB A;  2VCD A;  1Q1C A;  3JXV A;  3PRB A;  3IHZ A;  3KCE A;  4DRP A;  1HXV A;  4DRJ A;  2KO7 A;  3O5D A;  2MLY A;  4NNR A;  2MPH A;  2PPO A;  4GGQ A;  4C02 B;  2ITK A;  3O5J A;  2KE0 A;  2XP6 A;  4JFK A;  4DH0 A;  4DRQ A;  2RUD A;  1ZK6 A;  1TCO C;  1QPF A;  4W9P A;  1D7J A;  5HW7 A;  2RUR A;  4LAW A;  1L1P A;  3UI4 A;  1D6O A;  3O5M A;  2ZQV A;  1FKF A;  5I98 A;  4GIV A;  4DRI A;  3JYJ A;  4LAV A;  3KAB A;  1J6Y A;  3EY6 A;  1ROU A;  1FAP A;  1FD9 A;  5B8I C;  1FKH A;  1M5Y A;  2FAP A;  4J4N A;  1FKJ A;  1FKI A;  1J4R A;  5DIU A;  4DZ3 A;  2RSE A;  5BXJ A;  2ZR5 A;  1F40 A;  3O5P A;  1J4I A;  3O5I A;  4W9Q A;  4BF8 A;  3KAF A;  1FKS A;  1Q6I A;  1R9H A;  3VAW A;  2LKN A;  3RGC A;  4U84 A;  1P5Q A;  3UF8 A;  1N1A A;  2XPB A;  4TW8 A;  1U79 A;  4U86 A;  2UZ5 A;  5HUA A;  4G2P A;  3O5L A;  4J4O A;  3UI6 A;  3B7X A;  4ODR A;  4IPX A;  4QT2 A;  3IKG A;  4ODM A;  1J4H A;  3I6C A;  5HW6 A;  2PPN A;  1PBK A;  4LAY A;  4O2T A;  2N87 A;  1EQ3 A;  2PPP A;  4JFJ A;  3KAI A;  1B6C A;  1FKK A;  2MLZ A;  5HWB A;  4N19 A;  5J6E A;  4ODO A;  2L2S A;  1FJD A;  2OFN A;  1NMW A;  2D9F A;  2RQS A;  4ITZ A;  1D7I A;  1KT1 A;  1W26 A;  3O5G A;  4DT4 A;  1BL4 A;  2JZV A;  4TW6 A;  1ZCN A;  2KR7 A;  3O5Q A;  4G50 A;  4LAX A;  2KI3 A;  4MSP A;  3LUO A;  2DG3 A;  3RFW A;  1NSG A;  2VN1 A;  5HTG A;  3IK8 A;  4R0X A;  3TC5 A;  1YAT A;  3PRD A;  3KZ7 A;  5HW8 A;  3NRK A;  2ZR4 A;  3O5F A;  3FAP A;  1FKL A;  4TW7 A;  2DG4 A;  4DRM A;  1C9H A;  4TX0 A;  3TCZ A;  1JVW A;  4JFL A;  3WH0 A;  2M1I A;  5DIT A;  4ODQ A;  2KFW A;  2F4E A;  4ODL A;  3UQI A;  4TYO A;  1JNT A;  3NTP A;  4JYS A;  3UI5 A;  4DZ2 A;  1D7H A;  2KGJ A;  4U85 A;  4DRK A;  3UQA A;  2Q5A A;  1FKD A;  3KAC A;  1FKG A;  3O5E A;  4JFI A;  3O5O A;  4TNS A;  5DIV A;  2F21 A;  1Q6U A;  4W9O A;  2RUQ A;  4DRN A;  1EYM A;  2XP9 A;  2ZQU A;  1BKF A;  3GPK A;  3KAD A;  3CGM A;  2RUC A;  4DRH A;  1ROT A;  2XP3 A;  3PA7 A;  2M2A A;  4ODN A;  4ODP A;  3O5R A;  1T11 A;  3OOB A;  3UQB A;  2XP5 A;  3MDY B;  5HT1 A;  1F8A B;  1QPL A;  5HWC A;  4QT3 A;  4FAP A;  3NI6 A;  1FKT A;  1Y0O A;  2PBC A;  3CGN A;  3KAG A;  4JFM A;  2XPA A;  2DG9 A;  1A7X A;  2IF4 A;  1FKB A;  2K8I A;  2M08 A;  2PV2 A; 
#chains in the Genus database with same CATH topology
 3WD4 A;  1JNS A;  5GPR A;  2AOS A;  1GRJ A;  4IQC A;  2LPV A;  1KT0 A;  1ZBW A;  1PIN A;  2XP7 A;  3BMB A;  3QOK A;  4QIB A;  2MF9 A;  5DEZ A;  3WD1 A;  3AS1 A;  4WIW A;  1YW5 A;  2F2D A;  2ZR6 A;  5GPG A;  3TDB A;  3JXV A;  3IHZ A;  3AS2 A;  4DRP A;  4DRJ A;  3AQU A;  2MPH A;  4GGQ A;  1LG1 A;  4JFK A;  4DH0 A;  2YBU A;  4DRQ A;  2RUR A;  3B9A A;  3CHC A;  1D6O A;  1EDQ A;  4Z2H A;  1HKJ A;  3ARO A;  1J6Y A;  1ROU A;  1OWQ A;  1FD9 A;  2FAP A;  2DSV A;  1FKJ A;  1RD6 A;  1J4R A;  4LGX A;  1J4I A;  4W9Q A;  4BF8 A;  1FKS A;  4ML4 A;  1LG2 A;  2DT1 A;  4TW8 A;  2UZ5 A;  5HUA A;  4G2P A;  4J4O A;  4ODM A;  1J4H A;  3G6L A;  3I6C A;  5HW6 A;  4QZV B;  3ARY A;  4WK9 A;  2N87 A;  1W1P A;  1X6L A;  4P8V A;  2DT3 A;  2MLZ A;  5HWB A;  5JH8 A;  2OFN A;  1D7I A;  2JZV A;  4TW6 A;  2KR7 A;  4LAX A;  3GU0 A;  2PI6 A;  3FXY A;  3RM9 A;  3IK8 A;  3PRD A;  5HW8 A;  1FKL A;  3TCZ A;  3WH0 A;  4ODL A;  3ARX A;  1LQ0 A;  1ZBV A;  1HKK A;  3NTP A;  4WKF A;  3ARQ A;  1ITX A;  1D7H A;  5DF0 A;  4NSB A;  4JFI A;  5DIV A;  2F21 A;  2RUQ A;  2XP9 A;  3KAD A;  3OA5 A;  4P8U A;  3G6M A;  3PA7 A;  1KFW A;  2WLY A;  1ZL1 A;  3O5R A;  4IT6 A;  1F8A B;  3NI6 A;  4Z2J A;  2PV2 A;  1FFQ A;  1SR0 A;  1H0G A;  2K8I A;  1WB0 A;  3IKD A;  1OGG A;  4S3J A;  3PRA A;  4MGV A;  3WL1 A;  4Q22 A;  4MPK A;  2LGO A;  2PV3 A;  1Q6H A;  4IQ2 A;  2ZQT A;  2XP4 A;  1NWT A;  1X6N A;  4L72 B;  3GTY X;  2MLX A;  4ODK A;  2FKE A;  4MNK A;  4AY1 A;  2VCD A;  1Q1C A;  3PRB A;  1LJY A;  4KQZ A;  1HJX A;  2KO7 A;  3O5D A;  3RME A;  1E6R A;  1W9P A;  2XP6 A;  4PTM A;  2RUD A;  3FY1 A;  2PN0 A;  1QPF A;  4MNL A;  1D7J A;  5HW7 A;  3ARV A;  4LAW A;  1WNO A;  1ZU8 A;  3O5M A;  2ESC A;  4DWS C;  1FKF A;  5I98 A;  1XRV A;  4GIV A;  1HJV A;  1EHN A;  1LL6 A;  5B8I C;  4J4N A;  1W1T A;  3WD0 A;  1LL7 A;  2A3B A;  1NH6 A;  1Q6I A;  1R9H A;  2LKN A;  3RGC A;  5DO2 A;  4U84 A;  1P5Q A;  3UF8 A;  2IUZ A;  1E9L A;  3ARW A;  3WQW A;  3IKG A;  1W9V A;  1NWS A;  1ZB5 A;  1PBK A;  2G8Z A;  3WIJ A;  4JFJ A;  4N19 A;  4ODO A;  2RQS A;  1KT1 A;  1W26 A;  3O5G A;  1BL4 A;  3O5Q A;  3WD2 A;  4MSP A;  3RFW A;  2DG3 A;  1NSG A;  2VN1 A;  4R0X A;  4KR0 B;  1LL4 A;  1YAT A;  3O5F A;  1C9H A;  4TX0 A;  4ODQ A;  3UQI A;  4L3N A;  3BXW A;  2KGJ A;  4U85 A;  4HAR A;  2B5U B;  3O5E A;  1Q6U A;  4W9O A;  3PR9 A;  4DRH A;  1BKF A;  1E44 A;  4DWS B;  2M2A A;  4ZS6 A;  5HBF A;  1T11 A;  3MDY B;  3ARU A;  4QT3 A;  1CTN A;  2EUL A;  3CHF A;  2ETN A;  2PBC A;  3WKZ A;  3CGN A;  4JFM A;  2IF4 A;  2ZQS A;  4DRO A;  2XP8 A;  3ARR A;  3O5K A;  2LJ4 A;  2MNT A;  1D2K A;  4DIP A;  2A3A A;  1UR9 A;  3CH9 A;  1NWR A;  4FN2 A;  2AWG A;  3AS0 A;  4UDM A;  1GUV A;  2MLY A;  4XAK A;  2PPO A;  4C02 B;  3O5J A;  1ZK6 A;  1TCO C;  4W9P A;  1W1Y A;  1TFV A;  1L1P A;  2ZQV A;  3W4R A;  3JYJ A;  3KAB A;  1HKI A;  4P8X A;  1FAP A;  1VF8 A;  3ART A;  1FKH A;  1M5Y A;  4MNJ A;  2RSE A;  2ZR5 A;  2DT0 A;  3KAF A;  3VAW A;  3RM4 A;  3CZ8 A;  2DSZ A;  1U79 A;  4U86 A;  3O5L A;  3UI6 A;  3B7X A;  4ODR A;  4IPX A;  3ARS A;  5GQB A;  4WKA A;  1OGB A;  2YBT A;  1E15 A;  4LAY A;  4O2T A;  1IX5 A;  1B6C A;  1FKK A;  2G41 A;  4ZPT R;  1JND A;  3WQV A;  4G50 A;  5HTG A;  3TC5 A;  3KZ7 A;  3NRK A;  2WM0 A;  4TW7 A;  3B9D A;  2DG4 A;  2A3E A;  4DRM A;  1JVW A;  4JFL A;  2M1I A;  1K9T A;  2F4E A;  2DSU A;  4TYO A;  1JNT A;  4DZ2 A;  3UQA A;  4DRK A;  3KAC A;  2WLZ A;  1ZBC A;  1FKG A;  3O5O A;  4DRN A;  1EYM A;  2ZQU A;  3GPK A;  3ALG A;  2RUC A;  1ROT A;  2XP3 A;  1HKM A;  1ZBK A;  3OOB A;  3UQB A;  3CHE A;  2FDM A;  3RM8 A;  2A3C A;  4WJX A;  3KAG A;  3B8S A;  2DG9 A;  1A7X A;  2Q5A A;  2QF8 A;  4Z2G A;  1JNE A;  1NMV A;  3KAH A;  4Z2I A;  1H0I A;  4NZC A;  5D75 A;  1QZ2 A;  2Y78 A;  4HBE A;  5HKG A;  1FKR A;  3H9R B;  4WKH A;  4Z2K A;  3WL0 A;  3ODK A;  1XHG A;  3ARZ A;  3AS3 A;  4P8W A;  2PV1 A;  1GPF A;  3JYM A;  3KCE A;  2F23 A;  1HXV A;  1E6P A;  4NNR A;  2ITK A;  2KE0 A;  3WD3 A;  1W1V A;  4Z2L A;  3UI4 A;  4DRI A;  2O9O A;  4LAV A;  2DT2 A;  3EY6 A;  1FKI A;  4DZ3 A;  5DIU A;  5BXJ A;  1F40 A;  3O5P A;  1UR8 A;  3O5I A;  4DWS D;  1N1A A;  2XPB A;  2O92 A;  4Q7N A;  1W9U A;  4QT2 A;  1FFR A;  4DWS A;  2PPN A;  1EQ3 A;  2PPP A;  3KAI A;  5J6E A;  4HBO A;  2L2S A;  4MTV A;  1FJD A;  4ITZ A;  1NMW A;  2D9F A;  4DT4 A;  1ZCN A;  1SYT A;  2KI3 A;  3LUO A;  1JCH B;  4ZPW R;  4S3K A;  4IT4 A;  2ZR4 A;  3FAP A;  2P4V A;  4W5U A;  5DIT A;  4ZPV R;  2KFW A;  4R5E A;  3EIP A;  1O6I A;  4JYS A;  2B31 A;  3UI5 A;  1NWU A;  1FKD A;  4URI A;  3ALF A;  4MNM A;  2OLH A;  1GOI A;  2DSW A;  4TNS A;  1E6Z A;  3ARP A;  2DPE A;  1E6N A;  3CGM A;  4ODN A;  1EIB A;  4ODP A;  1HJW A;  4MAV A;  2XP5 A;  5HT1 A;  1QPL A;  3CHD A;  4FAP A;  2WK2 A;  1FKT A;  1Y0O A;  1WAW A;  2XPA A;  3B9E A;  5HWC A;  1FKB A;  2M08 A; 
#chains in the Genus database with same CATH homology
 3WD4 A;  1JNS A;  5GPR A;  2AOS A;  4IQC A;  2LPV A;  1KT0 A;  1ZBW A;  1PIN A;  2XP7 A;  4QIB A;  3QOK A;  2MF9 A;  5DEZ A;  3WD1 A;  3AS1 A;  4WIW A;  1YW5 A;  2F2D A;  2ZR6 A;  5GPG A;  3TDB A;  3JXV A;  3IHZ A;  3AS2 A;  4DRP A;  4DRJ A;  3AQU A;  2MPH A;  4GGQ A;  1LG1 A;  4JFK A;  4DH0 A;  2YBU A;  4DRQ A;  2RUR A;  3B9A A;  3CHC A;  1D6O A;  1EDQ A;  4Z2H A;  1HKJ A;  3ARO A;  1J6Y A;  1ROU A;  1OWQ A;  1FD9 A;  2FAP A;  2DSV A;  1FKJ A;  1RD6 A;  1J4R A;  4LGX A;  1J4I A;  4W9Q A;  4BF8 A;  1FKS A;  4ML4 A;  1LG2 A;  2DT1 A;  4TW8 A;  2UZ5 A;  5HUA A;  4G2P A;  4J4O A;  4ODM A;  1J4H A;  3G6L A;  3I6C A;  5HW6 A;  4QZV B;  3ARY A;  4WK9 A;  2N87 A;  1W1P A;  1X6L A;  4P8V A;  2DT3 A;  2MLZ A;  5HWB A;  5JH8 A;  2OFN A;  1D7I A;  2JZV A;  4TW6 A;  2KR7 A;  4LAX A;  2PI6 A;  3FXY A;  3RM9 A;  3IK8 A;  3PRD A;  5HW8 A;  1FKL A;  3TCZ A;  3WH0 A;  4ODL A;  3ARX A;  1LQ0 A;  1ZBV A;  1HKK A;  3NTP A;  4WKF A;  3ARQ A;  1ITX A;  1D7H A;  5DF0 A;  4NSB A;  4JFI A;  5DIV A;  2F21 A;  2RUQ A;  2XP9 A;  3KAD A;  3OA5 A;  4P8U A;  3G6M A;  3PA7 A;  1KFW A;  2WLY A;  1ZL1 A;  3O5R A;  4IT6 A;  1F8A B;  3NI6 A;  4Z2J A;  2PV2 A;  1FFQ A;  1SR0 A;  1H0G A;  2K8I A;  1WB0 A;  3IKD A;  1OGG A;  4S3J A;  3PRA A;  4MGV A;  3WL1 A;  4Q22 A;  4MPK A;  2LGO A;  2PV3 A;  1Q6H A;  4IQ2 A;  2ZQT A;  2XP4 A;  1NWT A;  1X6N A;  4L72 B;  2MLX A;  4ODK A;  2FKE A;  4MNK A;  4AY1 A;  2VCD A;  1Q1C A;  3PRB A;  1LJY A;  4KQZ A;  1HJX A;  2KO7 A;  3O5D A;  3RME A;  1E6R A;  1W9P A;  2XP6 A;  4PTM A;  2RUD A;  3FY1 A;  1QPF A;  4MNL A;  1D7J A;  5HW7 A;  3ARV A;  4LAW A;  1WNO A;  1ZU8 A;  3O5M A;  2ESC A;  4DWS C;  1FKF A;  5I98 A;  1XRV A;  4GIV A;  1HJV A;  1EHN A;  1LL6 A;  5B8I C;  4J4N A;  1W1T A;  3WD0 A;  1LL7 A;  2A3B A;  1NH6 A;  1Q6I A;  1R9H A;  2LKN A;  3RGC A;  5DO2 A;  4U84 A;  1P5Q A;  3UF8 A;  2IUZ A;  1E9L A;  3ARW A;  3WQW A;  3IKG A;  1W9V A;  1NWS A;  1ZB5 A;  1PBK A;  2G8Z A;  3WIJ A;  4JFJ A;  4N19 A;  4ODO A;  2RQS A;  1KT1 A;  1W26 A;  3O5G A;  1BL4 A;  3O5Q A;  3WD2 A;  4MSP A;  3RFW A;  2DG3 A;  1NSG A;  2VN1 A;  4R0X A;  4KR0 B;  1LL4 A;  1YAT A;  3O5F A;  1C9H A;  4TX0 A;  4ODQ A;  3UQI A;  4L3N A;  3BXW A;  2KGJ A;  4U85 A;  4HAR A;  3O5E A;  1Q6U A;  4W9O A;  3PR9 A;  4DRH A;  1BKF A;  4DWS B;  2M2A A;  4ZS6 A;  5HBF A;  1T11 A;  3MDY B;  3ARU A;  4QT3 A;  1CTN A;  3CHF A;  2PBC A;  3WKZ A;  3CGN A;  4JFM A;  2IF4 A;  2ZQS A;  4DRO A;  2XP8 A;  3ARR A;  3O5K A;  2LJ4 A;  2MNT A;  1D2K A;  4DIP A;  2A3A A;  1UR9 A;  3CH9 A;  1NWR A;  4FN2 A;  2AWG A;  3AS0 A;  1GUV A;  2MLY A;  4XAK A;  2PPO A;  4C02 B;  3O5J A;  1ZK6 A;  1TCO C;  4W9P A;  1W1Y A;  1TFV A;  1L1P A;  2ZQV A;  3W4R A;  3JYJ A;  3KAB A;  1HKI A;  4P8X A;  1FAP A;  1VF8 A;  3ART A;  1FKH A;  1M5Y A;  4MNJ A;  2RSE A;  2ZR5 A;  2DT0 A;  3KAF A;  3VAW A;  3RM4 A;  3CZ8 A;  2DSZ A;  1U79 A;  4U86 A;  3O5L A;  3UI6 A;  3B7X A;  4ODR A;  4IPX A;  3ARS A;  5GQB A;  4WKA A;  1OGB A;  2YBT A;  1E15 A;  4LAY A;  4O2T A;  1IX5 A;  1B6C A;  1FKK A;  2G41 A;  4ZPT R;  1JND A;  3WQV A;  4G50 A;  5HTG A;  3TC5 A;  3KZ7 A;  3NRK A;  2WM0 A;  4TW7 A;  3B9D A;  2DG4 A;  2A3E A;  4DRM A;  1JVW A;  4JFL A;  2M1I A;  1K9T A;  2F4E A;  2DSU A;  4TYO A;  1JNT A;  4DZ2 A;  3UQA A;  4DRK A;  3KAC A;  2WLZ A;  1ZBC A;  1FKG A;  3O5O A;  4DRN A;  1EYM A;  2ZQU A;  3GPK A;  3ALG A;  2RUC A;  1ROT A;  2XP3 A;  1HKM A;  1ZBK A;  3OOB A;  3UQB A;  3CHE A;  2FDM A;  3RM8 A;  2A3C A;  4WJX A;  3KAG A;  3B8S A;  2DG9 A;  1A7X A;  2Q5A A;  2QF8 A;  4Z2G A;  1JNE A;  1NMV A;  3KAH A;  4Z2I A;  1H0I A;  4NZC A;  5D75 A;  1QZ2 A;  2Y78 A;  4HBE A;  5HKG A;  1FKR A;  3H9R B;  4WKH A;  4Z2K A;  3WL0 A;  3ODK A;  1XHG A;  3ARZ A;  3AS3 A;  4P8W A;  2PV1 A;  1GPF A;  3JYM A;  3KCE A;  1HXV A;  1E6P A;  4NNR A;  2ITK A;  2KE0 A;  3WD3 A;  1W1V A;  4Z2L A;  3UI4 A;  4DRI A;  2O9O A;  4LAV A;  2DT2 A;  3EY6 A;  1FKI A;  4DZ3 A;  5DIU A;  5BXJ A;  1F40 A;  3O5P A;  1UR8 A;  3O5I A;  4DWS D;  1N1A A;  2XPB A;  2O92 A;  4Q7N A;  1W9U A;  4QT2 A;  1FFR A;  4DWS A;  2PPN A;  1EQ3 A;  2PPP A;  3KAI A;  5J6E A;  4HBO A;  2L2S A;  4MTV A;  1FJD A;  4ITZ A;  1NMW A;  2D9F A;  4DT4 A;  1ZCN A;  1SYT A;  2KI3 A;  3LUO A;  4ZPW R;  4S3K A;  4IT4 A;  2ZR4 A;  3FAP A;  4W5U A;  5DIT A;  4ZPV R;  2KFW A;  4R5E A;  1O6I A;  4JYS A;  2B31 A;  3UI5 A;  1NWU A;  1FKD A;  4URI A;  3ALF A;  4MNM A;  2OLH A;  1GOI A;  2DSW A;  4TNS A;  1E6Z A;  3ARP A;  2DPE A;  1E6N A;  3CGM A;  4ODN A;  1EIB A;  4ODP A;  1HJW A;  4MAV A;  2XP5 A;  5HT1 A;  1QPL A;  3CHD A;  4FAP A;  2WK2 A;  1FKT A;  1Y0O A;  1WAW A;  2XPA A;  3B9E A;  5HWC A;  1FKB A;  2M08 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...