1Y0OA

Crystal structure of reduced atfkbp13
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
125
structure length
125
Chain Sequence
b'CEFSVSPSGLAFCDKVVGYGPEAVKGQLIKAHYVGKLENGKVFDSSYNRGKPLTFRIGVGEVIKGWDQGILGSDGIPPMLTGGKRTLRIPPELAYGDRGAGCKGGSCLIPPASVLLFDIEYIGKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FKBP-type peptidyl-prolyl cis-trans isomerase 3
publication title Crystal structure of reduced AtFKBP13
rcsb
source organism Arabidopsis thaliana
molecule tags Isomerase
total genus 26
structure length 125
sequence length 125
chains with identical sequence B, C, D, E
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2004-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1y0oA00
4TYOA 5HWBA 1EYMA 3PA7A 2PV1A 1L1PA 3TCZA 1FKBA 3JYJA 3LUOA 4JFJA 1KT1A 1YW5A 1FKSA 5GPGA 4LAXA 3O5IA 4ODOA 2M1IA 4FN2A 3FAPA 5HT1A 2M2AA 4N19A 1F40A 4ODPA 2MF9A 4GGQA 3NTPA 2AWGA 3O5KA 1HXVA 1PBKA 2ZQSA 2KR7A 4G2PA 4BF8A 3JYMA 1Q6IA 4ODNA 1JNSA 1YATA 1FD9A 2Q5AA 4TX0A 2M08A 3O5RA 4U84A 2RUDA 1QPFA 2PV3A 2XP3A 2LKNA 2XPBA 3CGMA 4LAWA 3VAWA 3O5JA 1QZ2A 2ZR4A 2KI3A 4IQCA 4TW6A 2KE0A 3O5QA 5HTGA 2ZR6A 2XP5A 3EY6A 3UI4A 4ODQA 4DH0A 1D7HA 1FKHA 1Q1CA 2XP8A 2IF4A 4NNRA 1BKFA 4ODRA 2XP9A 1ZK6A 3IKDA 3JXVA 1U79A 2JZVA 3KACA 2L2SA 4JFIA 3UQIA 1BL4A 4GIVA 1FKKA 4J4NA 4TW8A 4IQ2A 1FKGA 2KO7A 3O5EA 4MGVA 3UI6A 2N87A 4W9PA 2D9FA 1J6YA 4JYSA 4QT3A 1QPLA 4JFMA 1FKTA 2F4EA 2DG9A 4JFKA 3KZ7A 1NSGA 4DRHA 1NMVA 2RUQA 4DT4A 1FKIA 1JNTA 1FKLA 3O5DA 3OOBA 5DIVA 3WH0A 4DRQA 2DG3A 1FKJA 5HWCA 1JVWA 2XP7A 1J4HA 4TW7A 2MLYA 5D75A 4QT2A 4TNSA 1D7IA 2PPPA 1C9HA 3KAIA 2ZQVA 5I98A 5B8IC 2ZQTA 2XP6A 3ODKA 3O5GA 2PV2A 4DRIA 3O5FA 3IHZA 4QIBA 2VCDA 2XPAA 3KABA 3UI5A 3O5LA 3MDYB 4DZ2A 3UQBA 1PINA 4DRPA 2RUCA 1FAPA 1FKRA 2PPOA 1TCOC 2MNTA 3I6CA 5HW6A 4ITZA 1ROTA 4LAVA 1FJDA 2KGJA 1FKFA 2RSEA 2FKEA 2ZR5A 5J6EA 1B6CA 4C02B 1R9HA 3TDBA 4DRNA 4LAYA 3TC5A 4DIPA 2RURA 1J4RA 3IK8A 3B7XA 1F8AB 2RQSA 2XP4A 4G50A 1P5QA 3PRDA 4R0XA 2KFWA 2DG4A 4DRKA 3UQAA 1EQ3A 1D6OA 1W26A 1ZCNA 1N1AA 1J4IA 1Y0OA 4MSPA 5DITA 3RGCA 4O2TA 3CGNA 5BXJA 4JFLA 3O5OA 2VN1A 2LPVA 3KCEA 1A7XA 1Q6UA 3O5PA 4U86A 4DZ3A 2PPNA 5HUAA 4ODKA 1Q6HA 4W9OA 4DRJA 2OFNA 4IPXA 4ODMA 4U85A 3IKGA 4DROA 2UZ5A 2ITKA 5HW8A 5HW7A 2Y78A 3GPKA 2LJ4A 4DRMA 3H9RB 2MLXA 2K8IA 1ROUA 2MLZA 5DIUA 1KT0A 5HKGA 1T11A 2PBCA 3O5MA 1NMWA 4J4OA 2LGOA 3PRBA 1D7JA 2ZQUA 3KAHA 1FKDA 2F21A 4W9QA 3UF8A 2F2DA 3NRKA 3KAGA 2MPHA 2FAPA 3RFWA 4FAPA 3KADA 1M5YA 3NI6A 3KAFA 4ODLA
chains in the Genus database with same CATH superfamily
3WL0A 2B5UB 5HWBA 2A3AA 4WIWA 4JFJA 1W1PA 4ODOA 1F40A 4DWSD 2ZQSA 2KR7A 3B8SA 1ZB5A 3ARTA 1W9VA 2RUDA 1QPFA 1ZBKA 2PV3A 3O5JA 4TW6A 4ZS6A 1W9PA 3O5QA 5HTGA 3UI4A 4NNRA 4MNMA 4ODRA 3IKDA 3CHCA 2JZVA 4QZVB 2L2SA 4GIVA 4IQ2A 1FKGA 2D9FA 4QT3A 1QPLA 2F4EA 2DG9A 1XHGA 1NMVA 2YBUA 5DIVA 1FKLA 4DRQA 3WH0A 2DG3A 5D75A 4QT2A 2A3CA 3ARXA 3ARUA 2ZQVA 5B8IC 2XP6A 4DRIA 3O5FA 2A3BA 3IHZA 3UI5A 2RUCA 1FAPA 3B9DA 4MNLA 3CZ8A 1LJYA 1HKMA 3ALGA 1FKFA 2FKEA 4IT4A 3TDBA 1E15A 1ZBWA 1F8AB 2RQSA 4R0XA 1D6OA 1J4IA 4WJXA 3BXWA 4JFLA 3G6MA 3KCEA 1A7XA 1NWSA 4IPXA 4ODMA 4DROA 5HW8A 5HW7A 3AS1A 4DRMA 3H9RB 3OA5A 2MLXA 2YBTA 2B31A 3O5MA 1NMWA 3PRBA 1LG2A 3KAHA 2F21A 3KAGA 5JH8A 3RFWA 2DT3A 4FAPA 1E9LA 1LL7A 1H0IA 1KT1A 5DF0A 2O92A 1CTNA 4N19A 2DT1A 3NTPA 1PBKA 4BF8A 1Q6IA 4P8WA 1FD9A 2Q5AA 1HKJA 1ITXA 1D2KA 2XP3A 3CGMA 3VAWA 1JCHB 2KI3A 2P4VA 1RD6A 2XP5A 4MNKA 2A3EA 2IF4A 3FY1A 1WAWA 1ZK6A 3JXVA 4ZPWR 1FKKA 3AQUA 3UI6A 1LL6A 4W9PA 3RMEA 3WQVA 3AROA 3KZ7A 4DRHA 2RUQA 3WL1A 4DT4A 1FKIA 3ARQA 5DO2A 1JVWA 1J4HA 1VF8A 2MLYA 2WLZA 2ETNA 2PPPA 3KAIA 1KFWA 5GQBA 3WQWA 2VCDA 3KABA 3ARPA 4W5UA 2F23A 1E6ZA 2MNTA 3B9EA 5HW6A 1ROTA 2ZR5A 2DSZA 1B6CA 5J6EA 4DRNA 4LAYA 2EULA 2RURA 3BMBA 3ARWA 1GUVA 1P5QA 2KFWA 4DRKA 1EDQA 2WK2A 1N1AA 1W1VA 1W9UA 4MSPA 3RM4A 3CGNA 1GOIA 4MTVA 5BXJA 4DWSC 4DWSB 1FFRA 1Q6UA 5HUAA 2PPNA 4URIA 1Q6HA 4DRJA 2UZ5A 2Y78A 2LJ4A 1E6NA 2MLZA 3WD0A 2LGOA 1D7JA 2ZQUA 1HKKA 1OWQA 3CHEA 2FAPA 1FFQA 3NI6A 4WK9A 1EYMA 2PV1A 1L1PA 3TCZA 4Z2JA 2G8ZA 3GU0A 1YW5A 1FKSA 5GPGA 4LAXA 4Z2GA 3O5IA 1TFVA 5HT1A 1X6NA 4ODPA 4HBEA 4G2PA 3AS2A 3JYMA 4IT6A 1JNSA 1YATA 2M08A 2WM0A 3FXYA 4LAWA 2DSWA 3G6LA 4IQCA 3AS0A 2IUZA 2KE0A 1UR8A 2ZR6A 3EY6A 4DH0A 1Q1CA 1BKFA 2XP9A 3CH9A 5DEZA 1U79A 3GTYX 4XAKA 3KACA 3UQIA 1BL4A 4TW8A 2KO7A 1JNEA 1J6YA 4JFMA 4S3KA 2QF8A 2PI6A 4JFKA 1NSGA 1JNTA 3OOBA 1LL4A 1NWUA 5HWCA 2AOSA 1D7IA 1C9HA 1HJVA 1X6LA 3ODKA 3O5GA 2PV2A 2WLYA 4DZ2A 2XPAA 1GRJA 3O5LA 4NZCA 2PPOA 1TCOC 4P8VA 3W4RA 3PRAA 4ITZA 4LAVA 4MNJA 2RSEA 4C02B 4ZPVR 1R9HA 1SR0A 3TC5A 4DIPA 4L72B 2XP4A 4G50A 3UQAA 1EQ3A 2DG4A 4LGXA 1Y0OA 5DITA 4R5EA 3QOKA 3ARRA 4O2TA 3RM9A 2DSUA 2LPVA 4DZ3A 4U86A 4ODKA 2DT0A 1EHNA 3CHDA 3IKGA 2FDMA 1EIBA 3GPKA 1IX5A 3AS3A 4Z2LA 4P8UA 1ROUA 2K8IA 5DIUA 4WKHA 1KT0A 1T11A 4J4OA 4ZPTR 4W9QA 1FKDA 3UF8A 1NWTA 4Z2HA 3ARSA 2MPHA 1ZBVA 4Q22A 3KADA 4WKAA 4ODLA 1UR9A 4TYOA 4MPKA 3PA7A 1FKBA 1HJWA 3ALFA 3LUOA 3JYJA 2PN0A 1H0GA 2G41A 3WKZA 1OGGA 1LG1A 1ZU8A 2M1IA 3PR9A 4FN2A 4S3JA 3EIPA 3FAPA 2M2AA 2MF9A 4GGQA 1HXVA 2AWGA 3O5KA 2ESCA 4Z2KA 4ODNA 3WD3A 4TX0A 1E6PA 3O5RA 4U84A 2LKNA 2XPBA 1QZ2A 2ZR4A 4AY1A 3WIJA 1E6RA 1K9TA 4ODQA 3RM8A 1NWRA 1D7HA 1FKHA 2XP8A 4UDMA 4JFIA 3B9AA 4J4NA 4P8XA 3O5EA 1OGBA 4MGVA 2N87A 1WB0A 4JYSA 4WKFA 4PTMA 1FKTA 2O9OA 4NSBA 3O5DA 1FKJA 1XRVA 2XP7A 4TW7A 1W1TA 1W1YA 4TNSA 4HARA 1LQ0A 5I98A 1JNDA 2ZQTA 4MAVA 1SYTA 2OLHA 3ARVA 4QIBA 4HBOA 3UQBA 3MDYB 1PINA 4DWSA 4DRPA 1FKRA 3WD2A 1E44A 1NH6A 3I6CA 4KQZA 3WD1A 1ZBCA 1FJDA 2KGJA 3CHFA 1J4RA 1WNOA 3B7XA 3IK8A 1ZL1A 3PRDA 1W26A 3ARZA 1ZCNA 3RGCA 2DSVA 5GPRA 3O5OA 2VN1A 3O5PA 2DT2A 4W9OA 2OFNA 5HBFA 2DPEA 4U85A 4ML4A 4Z2IA 2ITKA 4Q7NA 1GPFA 5HKGA 2PBCA 1O6IA 1HKIA 2F2DA 3WD4A 4L3NA 3NRKA 1HJXA 3ARYA 4KR0B 1M5YA 3KAFA
chains in the Genus database with same CATH topology
3WL0A 5HWBA 2A3AA 4WIWA 4JFJA 1W1PA 4ODOA 1F40A 4DWSD 2ZQSA 2KR7A 3B8SA 1ZB5A 3ARTA 1W9VA 2RUDA 1QPFA 1ZBKA 2PV3A 3O5JA 4TW6A 4ZS6A 1W9PA 3O5QA 5HTGA 3UI4A 4NNRA 4MNMA 4ODRA 3IKDA 3CHCA 2JZVA 4QZVB 2L2SA 4GIVA 4IQ2A 1FKGA 2D9FA 4QT3A 1QPLA 2F4EA 2DG9A 1XHGA 1NMVA 2YBUA 5DIVA 1FKLA 4DRQA 3WH0A 2DG3A 5D75A 4QT2A 2A3CA 3ARXA 3ARUA 2ZQVA 5B8IC 2XP6A 4DRIA 3O5FA 2A3BA 3IHZA 3UI5A 2RUCA 1FAPA 3B9DA 4MNLA 3CZ8A 1LJYA 1HKMA 3ALGA 1FKFA 2FKEA 4IT4A 3TDBA 1E15A 1ZBWA 1F8AB 2RQSA 4R0XA 1D6OA 1J4IA 4WJXA 3BXWA 4JFLA 3G6MA 3KCEA 1A7XA 1NWSA 4IPXA 4ODMA 4DROA 5HW8A 5HW7A 3AS1A 4DRMA 3H9RB 3OA5A 2MLXA 2YBTA 2B31A 3O5MA 1NMWA 3PRBA 1LG2A 3KAHA 2F21A 3KAGA 5JH8A 3RFWA 2DT3A 4FAPA 1E9LA 1LL7A 1H0IA 1KT1A 5DF0A 2O92A 1CTNA 4N19A 2DT1A 3NTPA 1PBKA 4BF8A 1Q6IA 4P8WA 1FD9A 2Q5AA 1HKJA 1ITXA 1D2KA 2XP3A 3CGMA 3VAWA 2KI3A 1RD6A 2XP5A 4MNKA 2A3EA 2IF4A 3FY1A 1WAWA 1ZK6A 3JXVA 4ZPWR 1FKKA 3AQUA 3UI6A 1LL6A 4W9PA 3RMEA 3WQVA 3AROA 3KZ7A 4DRHA 2RUQA 3WL1A 4DT4A 1FKIA 3ARQA 5DO2A 1JVWA 1J4HA 1VF8A 2MLYA 2WLZA 2PPPA 3KAIA 1KFWA 5GQBA 3WQWA 2VCDA 3KABA 3ARPA 4W5UA 1E6ZA 2MNTA 3B9EA 5HW6A 1ROTA 2ZR5A 2DSZA 1B6CA 5J6EA 4DRNA 4LAYA 2RURA 3ARWA 1GUVA 1P5QA 2KFWA 4DRKA 1EDQA 2WK2A 1N1AA 1W1VA 1W9UA 4MSPA 3RM4A 3CGNA 1GOIA 4MTVA 5BXJA 4DWSC 4DWSB 1FFRA 1Q6UA 5HUAA 2PPNA 4URIA 1Q6HA 4DRJA 2UZ5A 2Y78A 2LJ4A 1E6NA 2MLZA 3WD0A 2LGOA 1D7JA 2ZQUA 1HKKA 1OWQA 3CHEA 2FAPA 1FFQA 3NI6A 4WK9A 1EYMA 2PV1A 1L1PA 3TCZA 4Z2JA 2G8ZA 1YW5A 1FKSA 5GPGA 4LAXA 4Z2GA 3O5IA 1TFVA 5HT1A 1X6NA 4ODPA 4HBEA 4G2PA 3AS2A 3JYMA 4IT6A 1JNSA 1YATA 2M08A 2WM0A 3FXYA 4LAWA 2DSWA 3G6LA 4IQCA 2IUZA 2KE0A 3AS0A 1UR8A 2ZR6A 3EY6A 4DH0A 1Q1CA 1BKFA 2XP9A 3CH9A 5DEZA 1U79A 4XAKA 3KACA 3UQIA 1BL4A 4TW8A 2KO7A 1JNEA 1J6YA 4JFMA 4S3KA 2QF8A 2PI6A 4JFKA 1NSGA 1JNTA 3OOBA 1LL4A 1NWUA 5HWCA 2AOSA 1D7IA 1C9HA 1HJVA 1X6LA 3ODKA 3O5GA 2PV2A 2WLYA 4DZ2A 2XPAA 4NZCA 3O5LA 2PPOA 1TCOC 4P8VA 3W4RA 3PRAA 4ITZA 4LAVA 4MNJA 2RSEA 4C02B 4ZPVR 1R9HA 1SR0A 3TC5A 4DIPA 4L72B 2XP4A 4G50A 3UQAA 1EQ3A 2DG4A 4LGXA 1Y0OA 5DITA 4R5EA 3QOKA 3ARRA 4O2TA 3RM9A 2DSUA 2LPVA 4DZ3A 4U86A 4ODKA 2DT0A 1EHNA 3CHDA 3IKGA 2FDMA 1EIBA 3GPKA 1IX5A 3AS3A 4Z2LA 4P8UA 1ROUA 2K8IA 5DIUA 4WKHA 1KT0A 1T11A 4J4OA 4ZPTR 4W9QA 1FKDA 3UF8A 1NWTA 4Z2HA 3ARSA 2MPHA 1ZBVA 4Q22A 3KADA 4WKAA 4ODLA 1UR9A 4TYOA 4MPKA 3PA7A 1FKBA 1HJWA 3ALFA 3JYJA 3LUOA 1H0GA 2G41A 3WKZA 1OGGA 1LG1A 1ZU8A 2M1IA 3PR9A 4FN2A 4S3JA 3FAPA 2M2AA 2MF9A 4GGQA 1HXVA 2AWGA 3O5KA 2ESCA 4Z2KA 4ODNA 3WD3A 4TX0A 1E6PA 3O5RA 4U84A 2LKNA 2XPBA 1QZ2A 2ZR4A 4AY1A 3WIJA 1E6RA 1K9TA 4ODQA 3RM8A 1NWRA 1D7HA 1FKHA 2XP8A 4JFIA 3B9AA 4J4NA 4P8XA 3O5EA 1OGBA 4MGVA 2N87A 1WB0A 4JYSA 4WKFA 4PTMA 1FKTA 2O9OA 4NSBA 3O5DA 1FKJA 1XRVA 2XP7A 4TW7A 1W1TA 1W1YA 4TNSA 4HARA 1LQ0A 5I98A 1JNDA 2ZQTA 4MAVA 1SYTA 2OLHA 3ARVA 4QIBA 4HBOA 3UQBA 3MDYB 1PINA 4DWSA 4DRPA 1FKRA 3WD2A 1NH6A 3I6CA 4KQZA 3WD1A 1ZBCA 1FJDA 2KGJA 3CHFA 1J4RA 1WNOA 3B7XA 3IK8A 1ZL1A 3PRDA 1W26A 3ARZA 1ZCNA 3RGCA 2DSVA 5GPRA 3O5OA 3O5PA 2VN1A 2DT2A 4W9OA 2OFNA 5HBFA 2DPEA 4U85A 4ML4A 4Z2IA 2ITKA 4Q7NA 1GPFA 5HKGA 2PBCA 1O6IA 1HKIA 2F2DA 3WD4A 4L3NA 3NRKA 1HJXA 3ARYA 4KR0B 1M5YA 3KAFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TYO A;  5HWB A;  1EYM A;  3PA7 A;  2PV1 A;  1L1P A;  3TCZ A;  1FKB A;  3JYJ A;  3LUO A;  4JFJ A;  1KT1 A;  1YW5 A;  1FKS A;  5GPG A;  4LAX A;  3O5I A;  4ODO A;  2M1I A;  4FN2 A;  3FAP A;  5HT1 A;  2M2A A;  4N19 A;  1F40 A;  4ODP A;  2MF9 A;  4GGQ A;  3NTP A;  2AWG A;  3O5K A;  1HXV A;  1PBK A;  2ZQS A;  2KR7 A;  4G2P A;  4BF8 A;  3JYM A;  1Q6I A;  4ODN A;  1JNS A;  1YAT A;  1FD9 A;  2Q5A A;  4TX0 A;  2M08 A;  3O5R A;  4U84 A;  2RUD A;  1QPF A;  2PV3 A;  2XP3 A;  2LKN A;  2XPB A;  3CGM A;  4LAW A;  3VAW A;  3O5J A;  1QZ2 A;  2ZR4 A;  2KI3 A;  4IQC A;  4TW6 A;  2KE0 A;  3O5Q A;  5HTG A;  2ZR6 A;  2XP5 A;  3EY6 A;  3UI4 A;  4ODQ A;  4DH0 A;  1D7H A;  1FKH A;  1Q1C A;  2XP8 A;  2IF4 A;  4NNR A;  1BKF A;  4ODR A;  2XP9 A;  1ZK6 A;  3IKD A;  3JXV A;  1U79 A;  2JZV A;  3KAC A;  2L2S A;  4JFI A;  3UQI A;  1BL4 A;  4GIV A;  1FKK A;  4J4N A;  4TW8 A;  4IQ2 A;  1FKG A;  2KO7 A;  3O5E A;  4MGV A;  3UI6 A;  2N87 A;  4W9P A;  2D9F A;  1J6Y A;  4JYS A;  4QT3 A;  1QPL A;  4JFM A;  1FKT A;  2F4E A;  2DG9 A;  4JFK A;  3KZ7 A;  1NSG A;  4DRH A;  1NMV A;  2RUQ A;  4DT4 A;  1FKI A;  1JNT A;  1FKL A;  3O5D A;  3OOB A;  5DIV A;  3WH0 A;  4DRQ A;  2DG3 A;  1FKJ A;  5HWC A;  1JVW A;  2XP7 A;  1J4H A;  4TW7 A;  2MLY A;  5D75 A;  4QT2 A;  4TNS A;  1D7I A;  2PPP A;  1C9H A;  3KAI A;  2ZQV A;  5I98 A;  5B8I C;  2ZQT A;  2XP6 A;  3ODK A;  3O5G A;  2PV2 A;  4DRI A;  3O5F A;  3IHZ A;  4QIB A;  2VCD A;  2XPA A;  3KAB A;  3UI5 A;  3O5L A;  3MDY B;  4DZ2 A;  3UQB A;  1PIN A;  4DRP A;  2RUC A;  1FAP A;  1FKR A;  2PPO A;  1TCO C;  2MNT A;  3I6C A;  5HW6 A;  4ITZ A;  1ROT A;  4LAV A;  1FJD A;  2KGJ A;  1FKF A;  2RSE A;  2FKE A;  2ZR5 A;  5J6E A;  1B6C A;  4C02 B;  1R9H A;  3TDB A;  4DRN A;  4LAY A;  3TC5 A;  4DIP A;  2RUR A;  1J4R A;  3IK8 A;  3B7X A;  1F8A B;  2RQS A;  2XP4 A;  4G50 A;  1P5Q A;  3PRD A;  4R0X A;  2KFW A;  2DG4 A;  4DRK A;  3UQA A;  1EQ3 A;  1D6O A;  1W26 A;  1ZCN A;  1N1A A;  1J4I A;  1Y0O A;  4MSP A;  5DIT A;  3RGC A;  4O2T A;  3CGN A;  5BXJ A;  4JFL A;  3O5O A;  2VN1 A;  2LPV A;  3KCE A;  1A7X A;  1Q6U A;  3O5P A;  4U86 A;  4DZ3 A;  2PPN A;  5HUA A;  4ODK A;  1Q6H A;  4W9O A;  4DRJ A;  2OFN A;  4IPX A;  4ODM A;  4U85 A;  3IKG A;  4DRO A;  2UZ5 A;  2ITK A;  5HW8 A;  5HW7 A;  2Y78 A;  3GPK A;  2LJ4 A;  4DRM A;  3H9R B;  2MLX A;  2K8I A;  1ROU A;  2MLZ A;  5DIU A;  1KT0 A;  5HKG A;  1T11 A;  2PBC A;  3O5M A;  1NMW A;  4J4O A;  2LGO A;  3PRB A;  1D7J A;  2ZQU A;  3KAH A;  1FKD A;  2F21 A;  4W9Q A;  3UF8 A;  2F2D A;  3NRK A;  3KAG A;  2MPH A;  2FAP A;  3RFW A;  4FAP A;  3KAD A;  1M5Y A;  3NI6 A;  3KAF A;  4ODL A; 
#chains in the Genus database with same CATH topology
 3WL0 A;  2B5U B;  5HWB A;  2A3A A;  4WIW A;  4JFJ A;  1W1P A;  4ODO A;  1F40 A;  4DWS D;  2ZQS A;  2KR7 A;  3B8S A;  1ZB5 A;  3ART A;  1W9V A;  2RUD A;  1QPF A;  1ZBK A;  2PV3 A;  3O5J A;  4TW6 A;  4ZS6 A;  1W9P A;  3O5Q A;  5HTG A;  3UI4 A;  4NNR A;  4MNM A;  4ODR A;  3IKD A;  3CHC A;  2JZV A;  4QZV B;  2L2S A;  4GIV A;  4IQ2 A;  1FKG A;  2D9F A;  4QT3 A;  1QPL A;  2F4E A;  2DG9 A;  1XHG A;  1NMV A;  2YBU A;  5DIV A;  1FKL A;  4DRQ A;  3WH0 A;  2DG3 A;  5D75 A;  4QT2 A;  2A3C A;  3ARX A;  3ARU A;  2ZQV A;  5B8I C;  2XP6 A;  4DRI A;  3O5F A;  2A3B A;  3IHZ A;  3UI5 A;  2RUC A;  1FAP A;  3B9D A;  4MNL A;  3CZ8 A;  1LJY A;  1HKM A;  3ALG A;  1FKF A;  2FKE A;  4IT4 A;  3TDB A;  1E15 A;  1ZBW A;  1F8A B;  2RQS A;  4R0X A;  1D6O A;  1J4I A;  4WJX A;  3BXW A;  4JFL A;  3G6M A;  3KCE A;  1A7X A;  1NWS A;  4IPX A;  4ODM A;  4DRO A;  5HW8 A;  5HW7 A;  3AS1 A;  4DRM A;  3H9R B;  3OA5 A;  2MLX A;  2YBT A;  2B31 A;  3O5M A;  1NMW A;  3PRB A;  1LG2 A;  3KAH A;  2F21 A;  3KAG A;  5JH8 A;  3RFW A;  2DT3 A;  4FAP A;  1E9L A;  1LL7 A;  1H0I A;  1KT1 A;  5DF0 A;  2O92 A;  1CTN A;  4N19 A;  2DT1 A;  3NTP A;  1PBK A;  4BF8 A;  1Q6I A;  4P8W A;  1FD9 A;  2Q5A A;  1HKJ A;  1ITX A;  1D2K A;  2XP3 A;  3CGM A;  3VAW A;  1JCH B;  2KI3 A;  2P4V A;  1RD6 A;  2XP5 A;  4MNK A;  2A3E A;  2IF4 A;  3FY1 A;  1WAW A;  1ZK6 A;  3JXV A;  4ZPW R;  1FKK A;  3AQU A;  3UI6 A;  1LL6 A;  4W9P A;  3RME A;  3WQV A;  3ARO A;  3KZ7 A;  4DRH A;  2RUQ A;  3WL1 A;  4DT4 A;  1FKI A;  3ARQ A;  5DO2 A;  1JVW A;  1J4H A;  1VF8 A;  2MLY A;  2WLZ A;  2ETN A;  2PPP A;  3KAI A;  1KFW A;  5GQB A;  3WQW A;  2VCD A;  3KAB A;  3ARP A;  4W5U A;  2F23 A;  1E6Z A;  2MNT A;  3B9E A;  5HW6 A;  1ROT A;  2ZR5 A;  2DSZ A;  1B6C A;  5J6E A;  4DRN A;  4LAY A;  2EUL A;  2RUR A;  3BMB A;  3ARW A;  1GUV A;  1P5Q A;  2KFW A;  4DRK A;  1EDQ A;  2WK2 A;  1N1A A;  1W1V A;  1W9U A;  4MSP A;  3RM4 A;  3CGN A;  1GOI A;  4MTV A;  5BXJ A;  4DWS C;  4DWS B;  1FFR A;  1Q6U A;  5HUA A;  2PPN A;  4URI A;  1Q6H A;  4DRJ A;  2UZ5 A;  2Y78 A;  2LJ4 A;  1E6N A;  2MLZ A;  3WD0 A;  2LGO A;  1D7J A;  2ZQU A;  1HKK A;  1OWQ A;  3CHE A;  2FAP A;  1FFQ A;  3NI6 A;  4WK9 A;  1EYM A;  2PV1 A;  1L1P A;  3TCZ A;  4Z2J A;  2G8Z A;  3GU0 A;  1YW5 A;  1FKS A;  5GPG A;  4LAX A;  4Z2G A;  3O5I A;  1TFV A;  5HT1 A;  1X6N A;  4ODP A;  4HBE A;  4G2P A;  3AS2 A;  3JYM A;  4IT6 A;  1JNS A;  1YAT A;  2M08 A;  2WM0 A;  3FXY A;  4LAW A;  2DSW A;  3G6L A;  4IQC A;  3AS0 A;  2IUZ A;  2KE0 A;  1UR8 A;  2ZR6 A;  3EY6 A;  4DH0 A;  1Q1C A;  1BKF A;  2XP9 A;  3CH9 A;  5DEZ A;  1U79 A;  3GTY X;  4XAK A;  3KAC A;  3UQI A;  1BL4 A;  4TW8 A;  2KO7 A;  1JNE A;  1J6Y A;  4JFM A;  4S3K A;  2QF8 A;  2PI6 A;  4JFK A;  1NSG A;  1JNT A;  3OOB A;  1LL4 A;  1NWU A;  5HWC A;  2AOS A;  1D7I A;  1C9H A;  1HJV A;  1X6L A;  3ODK A;  3O5G A;  2PV2 A;  2WLY A;  4DZ2 A;  2XPA A;  1GRJ A;  3O5L A;  4NZC A;  2PPO A;  1TCO C;  4P8V A;  3W4R A;  3PRA A;  4ITZ A;  4LAV A;  4MNJ A;  2RSE A;  4C02 B;  4ZPV R;  1R9H A;  1SR0 A;  3TC5 A;  4DIP A;  4L72 B;  2XP4 A;  4G50 A;  3UQA A;  1EQ3 A;  2DG4 A;  4LGX A;  1Y0O A;  5DIT A;  4R5E A;  3QOK A;  3ARR A;  4O2T A;  3RM9 A;  2DSU A;  2LPV A;  4DZ3 A;  4U86 A;  4ODK A;  2DT0 A;  1EHN A;  3CHD A;  3IKG A;  2FDM A;  1EIB A;  3GPK A;  1IX5 A;  3AS3 A;  4Z2L A;  4P8U A;  1ROU A;  2K8I A;  5DIU A;  4WKH A;  1KT0 A;  1T11 A;  4J4O A;  4ZPT R;  4W9Q A;  1FKD A;  3UF8 A;  1NWT A;  4Z2H A;  3ARS A;  2MPH A;  1ZBV A;  4Q22 A;  3KAD A;  4WKA A;  4ODL A;  1UR9 A;  4TYO A;  4MPK A;  3PA7 A;  1FKB A;  1HJW A;  3ALF A;  3LUO A;  3JYJ A;  2PN0 A;  1H0G A;  2G41 A;  3WKZ A;  1OGG A;  1LG1 A;  1ZU8 A;  2M1I A;  3PR9 A;  4FN2 A;  4S3J A;  3EIP A;  3FAP A;  2M2A A;  2MF9 A;  4GGQ A;  1HXV A;  2AWG A;  3O5K A;  2ESC A;  4Z2K A;  4ODN A;  3WD3 A;  4TX0 A;  1E6P A;  3O5R A;  4U84 A;  2LKN A;  2XPB A;  1QZ2 A;  2ZR4 A;  4AY1 A;  3WIJ A;  1E6R A;  1K9T A;  4ODQ A;  3RM8 A;  1NWR A;  1D7H A;  1FKH A;  2XP8 A;  4UDM A;  4JFI A;  3B9A A;  4J4N A;  4P8X A;  3O5E A;  1OGB A;  4MGV A;  2N87 A;  1WB0 A;  4JYS A;  4WKF A;  4PTM A;  1FKT A;  2O9O A;  4NSB A;  3O5D A;  1FKJ A;  1XRV A;  2XP7 A;  4TW7 A;  1W1T A;  1W1Y A;  4TNS A;  4HAR A;  1LQ0 A;  5I98 A;  1JND A;  2ZQT A;  4MAV A;  1SYT A;  2OLH A;  3ARV A;  4QIB A;  4HBO A;  3UQB A;  3MDY B;  1PIN A;  4DWS A;  4DRP A;  1FKR A;  3WD2 A;  1E44 A;  1NH6 A;  3I6C A;  4KQZ A;  3WD1 A;  1ZBC A;  1FJD A;  2KGJ A;  3CHF A;  1J4R A;  1WNO A;  3B7X A;  3IK8 A;  1ZL1 A;  3PRD A;  1W26 A;  3ARZ A;  1ZCN A;  3RGC A;  2DSV A;  5GPR A;  3O5O A;  2VN1 A;  3O5P A;  2DT2 A;  4W9O A;  2OFN A;  5HBF A;  2DPE A;  4U85 A;  4ML4 A;  4Z2I A;  2ITK A;  4Q7N A;  1GPF A;  5HKG A;  2PBC A;  1O6I A;  1HKI A;  2F2D A;  3WD4 A;  4L3N A;  3NRK A;  1HJX A;  3ARY A;  4KR0 B;  1M5Y A;  3KAF A; 
#chains in the Genus database with same CATH homology
 3WL0 A;  5HWB A;  2A3A A;  4WIW A;  4JFJ A;  1W1P A;  4ODO A;  1F40 A;  4DWS D;  2ZQS A;  2KR7 A;  3B8S A;  1ZB5 A;  3ART A;  1W9V A;  2RUD A;  1QPF A;  1ZBK A;  2PV3 A;  3O5J A;  4TW6 A;  4ZS6 A;  1W9P A;  3O5Q A;  5HTG A;  3UI4 A;  4NNR A;  4MNM A;  4ODR A;  3IKD A;  3CHC A;  2JZV A;  4QZV B;  2L2S A;  4GIV A;  4IQ2 A;  1FKG A;  2D9F A;  4QT3 A;  1QPL A;  2F4E A;  2DG9 A;  1XHG A;  1NMV A;  2YBU A;  5DIV A;  1FKL A;  4DRQ A;  3WH0 A;  2DG3 A;  5D75 A;  4QT2 A;  2A3C A;  3ARX A;  3ARU A;  2ZQV A;  5B8I C;  2XP6 A;  4DRI A;  3O5F A;  2A3B A;  3IHZ A;  3UI5 A;  2RUC A;  1FAP A;  3B9D A;  4MNL A;  3CZ8 A;  1LJY A;  1HKM A;  3ALG A;  1FKF A;  2FKE A;  4IT4 A;  3TDB A;  1E15 A;  1ZBW A;  1F8A B;  2RQS A;  4R0X A;  1D6O A;  1J4I A;  4WJX A;  3BXW A;  4JFL A;  3G6M A;  3KCE A;  1A7X A;  1NWS A;  4IPX A;  4ODM A;  4DRO A;  5HW8 A;  5HW7 A;  3AS1 A;  4DRM A;  3H9R B;  3OA5 A;  2MLX A;  2YBT A;  2B31 A;  3O5M A;  1NMW A;  3PRB A;  1LG2 A;  3KAH A;  2F21 A;  3KAG A;  5JH8 A;  3RFW A;  2DT3 A;  4FAP A;  1E9L A;  1LL7 A;  1H0I A;  1KT1 A;  5DF0 A;  2O92 A;  1CTN A;  4N19 A;  2DT1 A;  3NTP A;  1PBK A;  4BF8 A;  1Q6I A;  4P8W A;  1FD9 A;  2Q5A A;  1HKJ A;  1ITX A;  1D2K A;  2XP3 A;  3CGM A;  3VAW A;  2KI3 A;  1RD6 A;  2XP5 A;  4MNK A;  2A3E A;  2IF4 A;  3FY1 A;  1WAW A;  1ZK6 A;  3JXV A;  4ZPW R;  1FKK A;  3AQU A;  3UI6 A;  1LL6 A;  4W9P A;  3RME A;  3WQV A;  3ARO A;  3KZ7 A;  4DRH A;  2RUQ A;  3WL1 A;  4DT4 A;  1FKI A;  3ARQ A;  5DO2 A;  1JVW A;  1J4H A;  1VF8 A;  2MLY A;  2WLZ A;  2PPP A;  3KAI A;  1KFW A;  5GQB A;  3WQW A;  2VCD A;  3KAB A;  3ARP A;  4W5U A;  1E6Z A;  2MNT A;  3B9E A;  5HW6 A;  1ROT A;  2ZR5 A;  2DSZ A;  1B6C A;  5J6E A;  4DRN A;  4LAY A;  2RUR A;  3ARW A;  1GUV A;  1P5Q A;  2KFW A;  4DRK A;  1EDQ A;  2WK2 A;  1N1A A;  1W1V A;  1W9U A;  4MSP A;  3RM4 A;  3CGN A;  1GOI A;  4MTV A;  5BXJ A;  4DWS C;  4DWS B;  1FFR A;  1Q6U A;  5HUA A;  2PPN A;  4URI A;  1Q6H A;  4DRJ A;  2UZ5 A;  2Y78 A;  2LJ4 A;  1E6N A;  2MLZ A;  3WD0 A;  2LGO A;  1D7J A;  2ZQU A;  1HKK A;  1OWQ A;  3CHE A;  2FAP A;  1FFQ A;  3NI6 A;  4WK9 A;  1EYM A;  2PV1 A;  1L1P A;  3TCZ A;  4Z2J A;  2G8Z A;  1YW5 A;  1FKS A;  5GPG A;  4LAX A;  4Z2G A;  3O5I A;  1TFV A;  5HT1 A;  1X6N A;  4ODP A;  4HBE A;  4G2P A;  3AS2 A;  3JYM A;  4IT6 A;  1JNS A;  1YAT A;  2M08 A;  2WM0 A;  3FXY A;  4LAW A;  2DSW A;  3G6L A;  4IQC A;  2IUZ A;  2KE0 A;  3AS0 A;  1UR8 A;  2ZR6 A;  3EY6 A;  4DH0 A;  1Q1C A;  1BKF A;  2XP9 A;  3CH9 A;  5DEZ A;  1U79 A;  4XAK A;  3KAC A;  3UQI A;  1BL4 A;  4TW8 A;  2KO7 A;  1JNE A;  1J6Y A;  4JFM A;  4S3K A;  2QF8 A;  2PI6 A;  4JFK A;  1NSG A;  1JNT A;  3OOB A;  1LL4 A;  1NWU A;  5HWC A;  2AOS A;  1D7I A;  1C9H A;  1HJV A;  1X6L A;  3ODK A;  3O5G A;  2PV2 A;  2WLY A;  4DZ2 A;  2XPA A;  4NZC A;  3O5L A;  2PPO A;  1TCO C;  4P8V A;  3W4R A;  3PRA A;  4ITZ A;  4LAV A;  4MNJ A;  2RSE A;  4C02 B;  4ZPV R;  1R9H A;  1SR0 A;  3TC5 A;  4DIP A;  4L72 B;  2XP4 A;  4G50 A;  3UQA A;  1EQ3 A;  2DG4 A;  4LGX A;  1Y0O A;  5DIT A;  4R5E A;  3QOK A;  3ARR A;  4O2T A;  3RM9 A;  2DSU A;  2LPV A;  4DZ3 A;  4U86 A;  4ODK A;  2DT0 A;  1EHN A;  3CHD A;  3IKG A;  2FDM A;  1EIB A;  3GPK A;  1IX5 A;  3AS3 A;  4Z2L A;  4P8U A;  1ROU A;  2K8I A;  5DIU A;  4WKH A;  1KT0 A;  1T11 A;  4J4O A;  4ZPT R;  4W9Q A;  1FKD A;  3UF8 A;  1NWT A;  4Z2H A;  3ARS A;  2MPH A;  1ZBV A;  4Q22 A;  3KAD A;  4WKA A;  4ODL A;  1UR9 A;  4TYO A;  4MPK A;  3PA7 A;  1FKB A;  1HJW A;  3ALF A;  3JYJ A;  3LUO A;  1H0G A;  2G41 A;  3WKZ A;  1OGG A;  1LG1 A;  1ZU8 A;  2M1I A;  3PR9 A;  4FN2 A;  4S3J A;  3FAP A;  2M2A A;  2MF9 A;  4GGQ A;  1HXV A;  2AWG A;  3O5K A;  2ESC A;  4Z2K A;  4ODN A;  3WD3 A;  4TX0 A;  1E6P A;  3O5R A;  4U84 A;  2LKN A;  2XPB A;  1QZ2 A;  2ZR4 A;  4AY1 A;  3WIJ A;  1E6R A;  1K9T A;  4ODQ A;  3RM8 A;  1NWR A;  1D7H A;  1FKH A;  2XP8 A;  4JFI A;  3B9A A;  4J4N A;  4P8X A;  3O5E A;  1OGB A;  4MGV A;  2N87 A;  1WB0 A;  4JYS A;  4WKF A;  4PTM A;  1FKT A;  2O9O A;  4NSB A;  3O5D A;  1FKJ A;  1XRV A;  2XP7 A;  4TW7 A;  1W1T A;  1W1Y A;  4TNS A;  4HAR A;  1LQ0 A;  5I98 A;  1JND A;  2ZQT A;  4MAV A;  1SYT A;  2OLH A;  3ARV A;  4QIB A;  4HBO A;  3UQB A;  3MDY B;  1PIN A;  4DWS A;  4DRP A;  1FKR A;  3WD2 A;  1NH6 A;  3I6C A;  4KQZ A;  3WD1 A;  1ZBC A;  1FJD A;  2KGJ A;  3CHF A;  1J4R A;  1WNO A;  3B7X A;  3IK8 A;  1ZL1 A;  3PRD A;  1W26 A;  3ARZ A;  1ZCN A;  3RGC A;  2DSV A;  5GPR A;  3O5O A;  3O5P A;  2VN1 A;  2DT2 A;  4W9O A;  2OFN A;  5HBF A;  2DPE A;  4U85 A;  4ML4 A;  4Z2I A;  2ITK A;  4Q7N A;  1GPF A;  5HKG A;  2PBC A;  1O6I A;  1HKI A;  2F2D A;  3WD4 A;  4L3N A;  3NRK A;  1HJX A;  3ARY A;  4KR0 B;  1M5Y A;  3KAF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...