1Y18B

Fab fragment of catalytic elimination antibody 34e4 e(h50)d mutant in complex with hapten
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
226
structure length
226
Chain Sequence
EVKLLESGGGLAQPGGSLKLSCAASGFDFRRYWMTWVRQAPGKGLEWIGDINPDSRTINYMPSLKDKFIISRDNAKNSLYLQLSRLRSEDSALYYCVRLDFDVYNHYYVLDYWGQGTSVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catalytic antibody 34E4 light chain
publication title Structural origins of efficient proton abstraction from carbon by a catalytic antibody
pubmed doi rcsb
source organism Mus musculus, homo sapiens
molecule tags Immune system
total genus 43
structure length 226
sequence length 226
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2004-11-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1y18B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1y18B01
3HMXL 4GW1B 3CXDL 3D3VA 3G6AB 3DV6B 2G75B 2UY7A 2D31B 4RGNC 1S9XA 1NUDA 1MCNA 1D6VL 5DJZA 1K6QL 2LV4A 5B39G 1HN1A 5C0IB 4YXHH 1JGVH 3HZKB 3VFOA 4HZLA 2F54D 3QIUC 4JZOA 2ZG3A 3A6CL 4YR6B 4XPGH 4S1QH 3B9KB 4BQ8A 4PJEF 2AABH 4EN3C 1I1CA 1JHTB 3MODH 4I3GA 1TJIL 1QSFA 2H9GA 5CGMA 5L8KB 1TMCB 4AEHH 2EYRA 2J6EA 1U3HB 4MVBD 5LGHH 3HR5A 4PJDF 2DI7A 5IJKC 2P8MA 5HHVL 4Z76B 1CK0H 1MCIA 3QXUA 4RFEB 2X1PA 1NDMA 2DM3A 1T2JA 1A14H 4OM0H 5CD3A 2HJLB 3DWTA 5F71A 3NIFF 2M2DA 1AFVL 1ZT7B 3NMEA 3HI6H 3WS6C 3ZO0A 3AXLA 5C0AE 2NXYD 4JFPB 2MFNA 4HUUB 3TLRA 3U7YH 2IJ0C 1GGTA 3TVMB 3UC0H 1X5GA 1IEBA 5E6IB 4ODVH 1UCBH 1H3XA 3DROA 2IFFL 4MJ2A 2FGZA 1B9ZA 4XP1H 3V7AG 1VADA 3RPKA 1B6DA 2HLAA 1U8JB 1A6WL 5D1QD 2ICWJ 3WS3B 2VISB 5JHDD 3CSPA 5C0AB 1HH6B 5FUZL 4O4YH 1FFPA 2J6EH 4TSBH 5IF0B 2AV1B 3TBYB 5EOCH 1MHHB 5GZND 4OQTH 4NBZB 1PX4A 2YBRB 5C0DB 4YFDB 2VABA 4ONFH 4X6FB 2LVEA 1JCKA 4P2RA 4PRNB 1I7TB 3IVKA 2DQUL 4U6VL 5GRUH 5CSZB 1INEL 4ZUVB 4MCYA 3CJJA 1FAKT 3VI3E 4KK5D 1XGRA 2OTWA 3HR6A 4KI5F 4W4OC 5D7LB 2VLRE 2HT3C 5GGRY 4P5MA 3KDMA 4HUMB 2I07A 2VDLL 3BFOA 5EU3B 1JZ3A 3DI3B 3I9GL 4F9PA 7FABL 5TF1H 1ZSDA 2SEBB 4MJIE 5DMGC 2VLME 2ZJSL 5E2WH 1GGCL 2VC2H 5CUSH 4K94H 4DZ8A 4NO2B 1HXYA 2X7LB 1AXSA 4QOKD 3R0NA 4ZS7H 4NKDB 4PBVC 4XPHH 1PLGH 1C7SA 1IGTB 5ICZB 3IT8D 1DQQB 5EU7C 2W1NA 1T5WB 5D7SH 5B3JE 5D6CA 4MJIB 1A6VL 4JZJC 1IL1A 3LMJL 4K3JH 1J0HA 1DQJA 3EO0B 3ZT6A 3LKQB 5FA4A 1U2CA 4G6KH 1L7IH 5IFJB 4L3EA 5DWUH 5IVZA 25C8H 4JZNB 1MRDH 1AR1D 1OCWL 4PREA 4AL8L 3MNVB 1KTRL 2ATPA 3NZHH 5E1AA 4R0LC 2FYYB 32C2B 1NLBL 1QBBA 4PRHE 2EDBA 4E41E 2PCPA 4XMKL 4KVCH 4XWOC 4JFHE 3PDOB 1GL4B 1GXEA 4HW6A 5BRZE 3C87A 3S3SA 5MENA 3ARVA 1KNOA 3IFLH 2XWJB 2AXHA 5A2IH 1LDPL 3Q2CA 1T20B 5BS0E 1FAIL 1JRHL 4PIRF 3ROOA 5CCKH 3EYOA 4TQEL 4Y19E 4DVBB 5CD5C 1E4XI 1JGDA 3KPPA 4PRHB 5E8PB 3MUJA 4E41B 1AC6A 3CFCL 5I1LB 2BOCB 3MLRL 4WHTB 1UT9A 2DQTH 4MMZC 5DUMH 4KRMB 1YJDH 5D93C 5BRZB 5CGYC 2B0SL 5JW5B 3CSYB 3QDAA 5BMFL 4XP4L 4TPRL 4OGZA 3ULUD 2R0KL 2P46B 5AYQA 3BSZH 3O9WC 3SBWC 4F80A 5SWZE 1I3VA 1UKSA 5F70A 4JFYA 3IDUA 5BS0B 1HYRC 2C7UA 2HT2D 1JWMB 4D9LH 1VGKB 4YDKH 3T3ME 1HEZA 2VTFA 5IVXF 4Y19B 1VCAA 3IGAA 3P77A 1LHZA 4NO3A 1A7RH 3BYYA 4QRRA 2C1OA 2IGFL 5FDWB 5F7EH 3T08A 3BEVB 2XQBL 4PGCA 5DJCB 3GJEA 5LVEA 1S8DB 1Q94B 1ZA3B 2OYPA 3WJLC 2MQ3A 1YDPB 5IMLB 5C0RH 2DTMH 2ZG1A 3S37X 4YXLH 5F88A 3WNNA 4Z7NF 4LCCB 2JELH 5SWZB 1BQUA 5MI0B 1G1YA 2R29H 1P2CA 2AV7A 4M62L 3QULB 2EKSB 1U41A 4F9LC 2IADB 3T4AA 1MCHA 5DR5H 3S3JA 3UDWA 2OJEA 1A7NL 1UM5L 3HAEA 1G7MA 3B9DA 3ARDC 5GGTA 2OBGA 3J8F7 5FOJA 2D0FA 1T7WA 3NCFB 1IE5A 4NWUL 1EIBA 1QSEE 2YWZA 1VFAB 3VXUD 3BQUD 5FUOH 4YPJA 1OAUL 5TPWH 1T21B 3NPSC 1V7MH 1MJUH 3EJYC 4A2MA 5TGBB 2CLZA 1LP9F 1QBLL 4Y5YB 2EDDA 2BZDA 5DZLA 5DRNA 2FHBA 4YK4B 4I4WB 2IAMB 4J3UA 3BAEL 3D85D 5C07E 3L3OA 4U1MB 5KSAB 4WWKB 3BH8B 4MLSA 3B8SA 3P4OA 4KKCD 1RZKH 4IS6A 4FABH 3NFPA 2DTSA 5HHNB 1QSEB 5MEQA 5I1IL 1AGEB 2APWA 2JKXA 1OP3K 3S4SB 3TPUB 2DQIL 1ZGLP 2XXMB 4LNVA 1G6RB 1CFNA 2EYSA 4ALAL 2VERN 1J8HD 5CEZL 5HYJE 3VCLA 4M93B 5T3ZD 2HTKD 3MRJB 2R2HA 2YSSA 1FFOA 4GQ9L 4PB0H 5DS8B 5FO8B 2QQLL 4Y1AD 3SE4A 1G7JA 1VFUA 1J9CT 1CLOH 1BJMA 5GGTH 5C07B 4KV5E 1AP2B 1I7ZB 2C3HA 4PFEA 3SDXB 4GKSA 4LBEA 4NOFA 5C0JA 1A47A 2R56L 4PRAA 3EJZC 3QWOA 3HUJA 4P3DA 3EIFA 5ESVA 3MRBA 4L8CB 3SKOB 5TE4H 1SYVA 1I7UA 1ED3B 3QNZA 1X5LA 4GLRI 1N2RB 1UWGH 4CAGA 1EFXB 1RU9H 5D7IE 4R7NB 4PBXA 3GHBH 5C0BD 1C5DA 3SDAC 2RFXB 2VAAB 1HSBA 1BVLB 5DJ2A 1XGUA 4JPKL 4L4TA 4P59L 2VXQH 4D0CA 3N06B 3WNKA 1EBPA 5DEFA 2ARJB 1FYTA 5JW4M 1RUAL 1KB5L 5EN2B 3UJIH 4TVSa 4C4KT 1SJXA 3G5XA 3IJYB 4K8RH 5DVMA 3T2QA 3F58L 4P3CH 3SDCB 4G42B 1PSKL 1NCCH 4YDIL 2XTLA 1MRFL 4F7PA 5GGSY 5C7XL 1T0NA 3QWQB 1I8LC 5E6IA 1J10A 1CLYH 5BXFA 4M6NL 3W0WE 4X7DC 3DYMA 2GCYB 2CDEA 5T1KA 5D2LA 1IM3B 1KJVA 1A7QL 1MSPA 3C09B 2A1WH 2J4WL 1QLEL 4NNPL 3BH9A 1BWMA 4R2GC 3W11C 4N0FA 5IB1B 1S7TA 2XPGB 5DEZA 2AQ1A 4PLKD 5TDPB 3LQZB 4ZUSA 3IFPA 4YHIA 2Y5TA 4IOFD 2BFVL 5IF0A 1NLDL 1R24B 2DJUA 1LEKA 5JPNB 1EMTL 3MNWB 3ULVF 4OAWA 4PJHA 2DQJH 2KUTA 2Y06L 3W0WB 5EZLB 4PTTB 1BVKB 1MHHA 4HEPG 4M5ZL 1A64A 4WUUE 4HT1H 4ZQKB 4LPTA 2EIZA 4OD1H 1HI6A 3VDCA 2H2SC 4QXGH 5HI3D 4ZUUA 1LMKA 5GISH 1U91A 3U7WH 4GXUN 4LEOA 4TNVK 4ZFGH 2H41A 1I1AA 2IQ9H 2ENYA 3C6SB 4XVSL 3S35L 5ETUB 3R4DA 3G5VA 3H9YA 4NZUL 4Y89A 3VXTB 4JM2A 3QH3A 2CIIB 4V1DE 1JPGA 2DI8A 3GKWL 2ZUVA 1M7DA 2A74A 3EO1B 3HE6A 4KI1A 5I1EL 3VWKC 1CXEA 4K7PY 4Q97A 3DMMC 5LXGL 4XNQB 4WEUD 3BD3A 4WW2A 1AO7D 2VIRA 2CXKA 1ZLWH 1RZGB 3X3GH 1PQZB 2O5ZH 5HTSA 1QRKA 1FZJA 3PGDB 2VLRA 2Y36L 1XF3B 3U36A 4KGLA 2VXSH 4LMQI 2CMRL 2Z91B 4V1DB 4Z7VE 1VERA 8FABB 1FH5H 1BAFL 1YEJL 1X6NA 4RAVA 3BESR 3MCLH 4IDJL 3FCTB 3QG6A 3P30L 4DVRL 1EO7A 4U1KA 1J5OL 2GK0A 5T1LA 5IFJA 4LSRL 3NAAH 1SM3L 3D3VD 4JLRB 5IB4A 3RVWD 4GBXB 4X83A 3QRGH 1BQHA 2K7PA 1XZ0B 1H8OA 5FKPB 4Z7VB 2H32A 3B2VL 2NTFA 2DM2A 5EBWB 2X10A 3NCJL 1T1YA 4HH9A 4LF3A 1T2XA 1EJOH 3S6CA 4KQ3L 5JPMB 4JDZB 2VDPH 4FN0A 3GKZA 4MXVF 2D2OA 1YN7A 1T20A 1A6TB 4M3JA 2C4FU 5HGBA 3H3BC 5IGXL 1F3JA 2RB8A 1KG0B 4YIQB 4NHCL 4Y16C 4PJ8D 3BKJH 3D1MC 4NKIH 4CNIA 2EYTB 5D72H 1CDUA 2O26U 5I66B 1QSFD 1MUJB 3RUGA 3BP7A 2BOCA 4AQ1B 3HCVB 4R26L 3GK8H 3OKEB 4NQUA 5DDHA 2X05A 5JW5A 2IC2A 2ADIA 1S7XA 4XRCB 4OF7A 1YMHB 3U82B 2QQKL 3T2PA 1EHLH 5BS0A 4NM8L 3O4LE 1SEQL 4MQ7A 3VDBA 2IH1A 3TJEL 5H37H 1G7IB 4JG1L 3EO9L 3BIBX 4Q9RL 1P7HL 1FFQA 2H32H 3VXPA 5HVHB 3HC0B 1ZLVH 3GSQA 1VACA 2HVKB 3MOQA 3BEVA 4R4NC 4LVOB 1JI1A 5TDOB 3BW9A 3RI5F 4QT5A 1OSPH 3S96A 5GGQH 2PR4H 3DX8B 1JGLH 1WCBA 3BEWA 2FO1A 4APQA 3GBLA 2R2CA 3RDTC 4IBLT 3L3DA 3HG1A 4JANA 2UZXB 3O4LB 3AY4C 3MXVL 2VR9A 5LQBH 4OI9A 2YD7A 3QULA 1NKRA 4OLWL 1JFQL 1RZJC 4G7YL 3WN5B 4AEIL 4XXDA 4HH8A 3PP3K 1A1NB 2LU3A 4ENEC 1EZVY 4FG6D 3TN0B 1IM9A 3G08A 5DJAB 3MUY1 3BE1L 3PDDA 4RIRB 4DAGH 1EZVX 3MRIB 4OZ4A 4L29B 1M6OA 2NXZB 4H5SA 3N50A 4TYUA 1VKXB 3DO7B 1D5MB 4EI6A 1I3GL 4NQVB 4LVHC 1TZHB 2B2XL 2YD6A 3UPRB 2NY2C 5LKNA 3P4LA 5B22A 4P2RD 2YWYA 3RNKA 3E6HB 3UPCA 3STLB 2Y25A 4HUVA 3L3JA 3O6MH 5F9AC 3CK0L 3SE3A 2BSTB 3MV11 4J1UA 4KKAC 5E99H 3BRGC 4M48H 3CDGB 5FYKE 4YXKL 3SE8L 3DGGB 4YWGL 2IBGA 1UM4H 4X5XA 5GHWL 3CZJA 1XF2B 1XCQA 1RZFH 2A6JA 3DURA 3OKNA 5I8KL 3OG4B 2EEDA 3HNSL 3RAJL 1C5CL 1OLZA 4P4KD 2XFXB 1YPZA 2FH8A 4D9RE 4HWZB 2GJ6E 4XCCL 4ZXBC 3SO3C 4OZIA 3DYPA 4DGYH 1T22B 2WINB 4JRXE 3D69A 3RTQA 1U9KA 1KIQB 4RRPG 12E8L 1AGBA 1QPPA 3TH2T 4C56A 2APTA 5C86A 1BM3L 2CQVA 5D1XC 1NC4A 2KDGA 4YEFA 1S9YB 5J6GB 1EO8H 4MJ6B 2NY7H 1F58H 2D3VA 3CZFB 5IFAH 3FO2A 3LKNB 2GJ6B 1G7QA 4PJEE 3QQ3A 5HYJA 3E2HB 3GIVB 4JRXB 1JNLH 4FQCL 5DI8B 3QCUL 3HNTL 4L3ED 2HFFA 5D96B 3PWJB 3RIFF 1JUFA 3QQ9D 1KJ2B 4OF8A 3HA0A 4CGTA 1MFEL 2XRAL 4XPFL 3MFFA 1BX2B 2VUYA 2PYED 3ZKQD 5I1GH 1I8MB 1MWAL 2X4TB 3NIFE 2QADD 4OM1H 5C0CE 4FMFA 3C6LB 4OD3L 5MEND 1M1SA 3RA7L 4R4BB 1KPVA 3MV8A 4LSTL 4CMMA 2R1XA 3MACL 4PJEB 5IB3B 5C0GB 1FO0A 4P2OC 5DD0H 5ITFB 4HKBA 5D7IA 4WU5B 3P9MB 3T65A 3H2WA 4PJDB 4NP4L 4JHWL 3MYZA 1NL0H 5L88L 5EUKA 1S5HB 4LU5H 1AGFB 1PZ5A 4RFOH 2CDFA 1KCVL 5C92A 5C0CB 5HDLA 2X4NB 3H6JA 4GAYA 2ZKHL 4RA3A 2W0PA 5MEOA 3DX9A 5C3LD 2CDGB 5GS0C 4K55A 3B3IA 4MZ2A 4XNMA 1WZMA 2IANE 1I8KA 5F1IA 1MRCH 1SYSA 3OPZH 4OZFG 1X5JA 2RGSA 5C2BL 5B3NA 5I75B 1YEGH 1CFVL 3MV9E 2NYYD 4Y4HB 4Q7DA 2P5ED 3RZCA 4OLYH 1RIVL 1MJ8L 4JVWA 4PJ8B 4QRRD 3C60C 4YC2B 5LBSH 3CPLB 5I0ZA 4EDWL 1JNHA 4CDGC 5E8OB 2QJDA 2NR6C 3MBEA 4TNWF 1N5YL 4HWEH 4ZOCA 1FO0H 4LPCA 1YEIH 2IANB 4N0YL 2NY6C 3IJSB 5GS1A 4KI5E 4J3VA 5JUEL 2HLFD 2OR8A 1REIA 1QUNA 3HRPA 2Q76A 3MV9B 2EE9A 4PJAF 2VMFA 4GKNA 2W9LA 1CXLA 1UVQB 5KSBF 1Q8MA 4PRPE 4J8RA 2HKHH 1IVLA 4GSDH 4LCYA 5IMOA 3S7GA 3ZYJA 3JTSB 4LLYA 3PP4L 4WUUA 5M7QA 2R2BB 4IRJB 1DP0A 3MLVH 4GG6F 3GRWA 3RHWF 2O5XH 2A73B 1LVEA 2XTJD 2V2WA 2Z35A 3GBML 1A1OB 2CK2A 4L8BB 4MB4A 2NCMA 5KTEH 4PRPB 1FZOB 3NFNA 4JN1H 2CLVB 2BCKA 1JGUL 2R9HC 4PR5A 3GSWB 5K59F 1DQMH 4MNGE 4QO1A 4PJ5E 1UQSA 3OXRA 1JTPA 1U3YA 4S1SL 3OQ3B 4TOYL 3PUCA 3MRHB 4X98B 2NY0C 1BD2E 4F3FB 1TTUA 1ZHKB 3ZTJG 1JV5A 3VFSB 4L9LB 1LK2B 4OLZL 3VD3A 4UU9B 3NCYP 1MI5E 4YUEH 3A6BL 4LHUA 1TCRA 1CG9A 3IDNB 2HFEA 1W72B 4DFIA 2EEBA 1WITA 4PJBF 3Q5YA 3RWHA 1KCKA 2BXZA 1ZHBB 1WVZA 4MNGB 3IFNL 4PJ5B 4Z78B 4ZS6D 4QHNA 1N6UA 3OKMB 1FV1B 3GI9H 1BD2B 3WNPA 4P4KB 3PNWB 4RX4A 4XMLH 4DK6A 1MI5B 3VWJB 5FK9B 1IKFH 4O51B 4JFFE 4XAWL 5FUCC 1I3RA 4DN3H 4XVTL 5EULV 2BSSB 3G9VA 1XGQA 2DBLH 1RD6A 3LDBC 3F6LA 4X4XA 1UB5B 2IQAA 2M8XA 2Y5EA 4I18C 4L4TD 4KXZH 4A6YL 3N1MC 1SEBA 1CE6B 1FYTD 5IVXE 3FN0L 1E6JH 3ARFB 3LKRB 1FG2A 1GPOH 4YBLB 1TZGH 4NRXB 4ODTH 4ZFOB 4UAOC 3CNKA 1KELL 3SDDA 5ENWA 1IGMH 4HLZH 1D5ZA 2Y23A 3S97C 3SE9H 3TBSB 4CW1B 2Y7QB 5GGVY 1KACB 3KPLB 3PV6A 3TWCL 4UDTB 2DDQH 2OL3A 3TIDB 3QEHB 5GZOC 4E5XA 1C8PA 3P4MB 4Z7NE 3WNLA 1CS6A 1B0RB 2PYEB 2AK1H 1ZMYA 1QA9B 5T1KD 1ZANL 4P0DA 5GSRA 4JQXA 5IVXB 3UJJL 5E08H 4XBGA 3VD7A 4OTXH 1UJ3A 1YNKL 1NQBA 2KZWA 3MOBH 1LQSR 4WFGE 2GSGB 2Z9TA 4PY8I 4TUJB 1S7WB 4Z7WA 1CZ8H 4AM0A 3S9DB 1QEWB 2P45B 4NQED 1INQA 5DJ8A 3G5ZB 4CN6A 3RWJB 2NW3A 4LAQH 2J5LC 1LP9E 2LABA 3CLFH 1LILA 4QKXB 1M71A 2B4CH 4LRIC 4LCIL 1KXQE 4G9FE 3U4EA 5EIIB 4XGZA 3VA2C 2R1WB 4PRDB 5HDBE 5I2IB 4DN4L 5F6IB 4Y4KB 3I6LE 1RJLA 4ZOAA 5DK2B 5FGBC 1MF2H 1WTLA 1XGYH 3GSRA 1I1AD 1FFNB 1KCUL 2OL3H 2RR3A 3EDEA 3MSPA 1T1WB 3L5IA 3V6FB 2A6IB 2P5EB 1KTDA 1BPVA 2AEWA 4KU1A 1MPAL 4JM2D 3NIDF 2HKFH 5E2TH 4FQHA 5HBBA 1LP9B 1OSZB 2VXUH 3HE6D 2VXVH 4HMEA 1JZ8A 3WHXA 4NC0B 5CAYB 3IFOB 4KZEH 4G9FB 4WWID 1XH3A 5DC4B 5DUBA 4HAFA 2DQCL 2JIXB 4IHOB 2WINA 5F7MC 2VDRH 4PP1D 4HIIB 4MB5A 3O41A 4M6MH 1WFTA 4QRPA 4HKJA 1A0QH 4NJ9H 2IPUK 1XGPB 2AJXL 5ANMA 1S3KL 3SKJL 2HTLC 5IEKB 2YKLL 1BBJB 1JYNA 1ZVSB 1G9MH 3EOAB 4QRTA 1Q9LA 4F58H 3T0EE 2EDFA 3K1KC 4FFZH 4IJ3C 3FFCE 5EZJA 5C2UB 3U9PL 4WENB 5T33L 4MXQD 3VFUA 3AM8A 5DQDH 1E4XL 1IGFH 1VFOA 3MRQA 1VESA 5T1LD 1HHGB 3MUHL 4FFVD 1FNEB 4NKOB 3CXHK 5CJOL 5JLZA 3SCMB 1IC7H 4RBPK 1IAIM 2CIKA 3QIWB 5ALCL 3U0PB 1QKZH 3HZMB 5FF6B 3T0EB 4ODHH 1P9MA 2A6KA 3LEVH 4PJ7F 3FFCB 3V6OC 35C8H 3Q6FA 4PG9B 2YOCA 5GJSH 3R1GH 5DJ0B 3O45B 3PJSB 4Q2ZA 1OAYH 3UXFA 4W6XB 5JTWA 3VH8G 5IMMA 4LGSB 3P11L 5LGJB 4F15B 3WD5L 1ZGLM 4XBEH 4BFGA 3PWUA 1RZJL 2B1AL 3X12A 1CFTA 4GO6B 4PJGF 3VFPB 4X99B 5CIPA 3TIEA 4XAKD 2X4NA 4U1HB 2EZ0C 5IBLD 4NQXA 4JDTH 1RIHL 3DIFB 5IOPA 2ICEA 4IMLA 4OGAD 3VRJB 3ULUL 5JW3L 1JK8B 5DZNA 3G6JF 2XA3A 2DLFL 3ULVE 2Q20A 4Y4HA 1CI5A 3O6LL 2AI0H 3CDCA 5BVPH 5HPMB 1XIWC 1J05B 4NRYB 4QYOB 4S11A 5E9DE 2ZNXA 4B5EA 2WK2A 1KCSH 3RWDA 1I1FB 1MCSA 3IDGA 1UA6L 1MFAH 4YO0B 4DGIL 4FNLL 5D8JH 2YPLA 1KENH 4CVWA 3KJ4C 1JI2A 4P2QA 1HHJA 5DF0A 2Y07H 4GXVH 4I8DA 2EXYD 2R4RH 2FCBA 5GQBA 3PWVB 3PHQB 1OL0A 2W0FA 2FGWL 1CDCA 2VR4A 3GMNB 4APQD 4LK4A 4S1RL 1TVDA 3HG1D 4JRYA 4GW4B 4ZPVB 5E6YA 3BPNB 5J0BA 4NZJA 4LCWA 2FSEB 3FQUA 5JOPD 2WBJC 4OFIA 4XCEB 5AYUL 2P24B 5DMIL 1JNNL 1ODAA 3QUXB 3TFKC 3JUZA 1FRGL 2OI9B 1WT5C 4N0UE 4MQXC 4FS0A 2EH7L 3TO2A 2GITB 2HH0H 2PO6C 4LRNH 5FGSA 2XZQH 4NHUA 1AXTL 3A67L 5BJTB 3ZKXB 3WJJC 4MAYC 1SBBA 3GJFK 1UADC 4MQSB 4WNQB 2E27H 3STZA 4BFIA 1NC2A 2UYLA 4WO4C 4LEXH 3BXNB 3F5WA 3KPNB 4OLXL 3FQWB 4J23A 1TLKA 1I3UA 2BHYA 1T0PB 4N0UB 2R8SL 3VXSA 1SJEB 1RZKC 2FJGB 4I9WD 4Y5XB 4D94A 4NZTL 3U83A 3L3IB 3W39A 4ESKA 2KZ1B 4X9HA 3TA3B 1KLUB 3B5HA 1HQRB 1IGCL 2GHWB 2P8PB 5SWQA 4U1NB 3RTQD 4OZHF 3S88L 2IMMA 2VO5A 2D4DA 3WKNA 1MCPH 4N5UA 3MGTA 4C56D 4IMKA 4U1LB 1DTUA 1NC4D 2NY4D 4MXVE 2M26A 1CF8L 1CGUA 1RK0A 4LSSL 5H35B 3U2SB 5JXEC 2NY3C 4PLNC 1XGTB 3H9SE 3SGEI 3V4VH 2Z0BA 1BJ8A 2VLKA 4Q0XL 2P1YA 5LWYH 1KGCD 4YHLH 3KLDA 4K3EH 3W2DL 2HWZH 4J3TA 1QZ1A 1R5IA 4ODWB 1AE6H 3WNMA 5B38B 3K74B 3V79C 1PX3A 3AAZA 2VZVA 3CD4A 1CGSH 1V3KA 1EVTC 3QUKA 1LEGA 1A3QA 1UB5A 1Y6NR 3VFWA 4ZTPH 2EC9T 1ZTXH 1DVFC 2OQJA 2JTDA 3L1OH 3GB7B 4NO0B 3H9SB 4MHHI 3ZTNH 1Q0YL 3ARFA 3MV8D 4H26B 3CFJB 4IOIA 5IK3B 4X6DA 5GS3A 1KCLA 1CD1B 3GZKA 2L0DA 2ADJA 4JFFA 4K8RC 5I74B 3CFBA 5EC2A 1ZKAA 3Q5OA 4JKPH 4UI2A 1UM6L 1LE5A 3P4MA 1EEYB 4M1DH 5JDSB 5ALBL 2X2YA 4G6AC 2HVJB 1ZS8B 1NJ9A 1NMBL 3H3PL 4XCYB 2CD0A 5TE6H 1UXSA 1V3MA 3SGKC 1CICA 1S7QB 3C8DA 3WXVH 5C6PB 2GSGA 3KWWB 1N64L 3IAGC 1PW3A 3B9KC 4B41A 5IQ9B 4Z8FL 3ZYOA 3RZCD 1TJGL 4DQOL 1XEDA 2HRPH 4IIQB 4OJFL 3VD4A 3RWJA 2OR9L 1U3HC 4XX1G 1FNSL 1NGQH 2ZCHH 5DYOB 4U6XB 4PJFA 4Y2DA 1OP5H 4H20H 3MBED 4ZDHB 1D5XB 1WK0A 3DRTB 4OCYH 1JWUB 3HB3C 2ZUUA 4N9GA 2C3VB 5DK2A 4ORGB 3C2AL 2DLIA 5DJXB 5E94A 4PLJC 1G7LB 4B0MM 5AG8A 5CFHA 4KDTC 1JPFA 1OAXH 1X3DA 2W0LA 3GSXA 2W0KA 5DD1L 3MLUL 4KQ4L 1B2WH 4OB5L 3PDGA 3QUMB 1A6ZA 1U2HA 4HGMA 2LTQB 5I6XB 1C7TA 2IALA 2K3TA 5EOTA 3TVMC 5A2JH 5E6IC 5KSVB 5BV7B 1HCVA 5F7HA 1UH2A 5DTFA 2ZWLT 2YEZB 5DQ9A 3KYOA 3REWA 1T03H 1K4DB 2VNCA 2XKSA 5F3BB 4Q9BA 5FM8A 3WFHA 4MSWA 5JDJA 4XBPA 4YXHL 3Q3GB 1JGVL 1IKNA 4I13B 4F33A 4HUWB 3E0GA 4KJQC 4LOUD 5HD8D 2Z31B 5EO9B 3TO4A 4XPGL 4S1QL 3D18B 1MJJB 1B4RA 5HDQH 2AABL 3VRIB 1EEUA 3TZVA 3M45A 3MODL 4F7EB 5IW1A 2NY5H 3C2SA 1T04B 4AEHL 4KJPD 4WFEE 2NY1B 5LGHL 1NAMB 3ZDYF 1IAKB 4Y5VA 1X6LA 1CK0L 4OCSH 4NKOA 3MMEB 3RL2A 1OTUC 1I1YB 1A14L 4OM0L 1F4XH 5DVKA 5IMKA 4X5LA 4BSVB 3HI6L 1F6FB 1ZT4B 1PG7H 1QOKA 3CC5B 1NCBH 4Q58C 3T0EA 4NN5B 4PP2A 4NQDE 5JO5B 1NANH 3U7YL 3I75A 1H5BA 1KCRH 4KJWC 3BIKB 3UC0L 4BH7B 1T7YA 2J12B 4ODVL 1UCBL 1S7RB 3RWCB 3D0VB 4RX4D 3PF2A 2YC1A 3EBAA 2QQNH 4AMKH 4XVUC 4XP1L 2Q6WB 3GMOB 4M7ZB 2APXA 2YD5A 3MROA 3BKMH 1T7XA 1X5XA 2R15A 4H0IA 1NEUA 2ATKB 5JMRA 3VFPA 2AJUH 3D2UA 4M43H 3C5JB 5J06A 3WIHH 1RK1A 4O4YL 4U1HA 2J6EL 4NQDB 4TSBL 5JW4R 4M1GH 2BNQE 4DTGH 2O93L 2DB8A 1JK8A 1JYVA 5CJ5A 5EOCL 4D3CH 2KBGA 3HAEG 5HJ3A 1NDGA 4OQTL 4LLWB 4BKLB 4XZUB 3SDDD 4ONFL 5SX4I 4FFWD 5KVMC 3VFVA 5MHSE 5GGUA 4FHBD 5D5MA 1VEPA 5GRUL 4DKEH 1MCLA 2I60H 3DOSA 4P5KB 3JTTB 2OTUA 2ZSVB 3RGVA 4PJAE 2BNQB 4PJXA 3D39E 1ORQB 4JFZH 4YHYB 4PGEA 1MCDA 1OTSD 5EU6A 4HGWA 4K23H 4KMLB 5TF1L 3EOTH 4M8QB 2Q7YB 5E2WL 1OGAA 2VC2L 5CUSL 4P23B 5E9DA 5DRXB 3GMLA 5E4IA 4GG6E 4K94L 4W70A 3BWAB 3QUXA 4NNYA 2D7NA 4I3SH 4ZS7L 4XPHL 2O61B 4ZUWA 1PLGL 1Z9OA 2Q1EA 1IT9H 1HXMA 4PJAB 2OXHA 5D2NE 3B83A 2I27N 3D39B 5IV2B 2GITA 5KSBB 1P5UA 5DQJA 3LEXA 5FB8B 3QA3A 1AJ7H 1NFDA 4H1LB 5D7SL 1L6XA 5BJTA 1TVHB 5K59E 4L4JA 1F90H 2BMKA 3CH1A 4K3JL 5BW7C 2X4SA 1DFBH 1NGXA 3AREB 4FMKA 4KK9C 2Y1VA 2DQFA 2WSKA 3QUYB 4GG6B 4JG0H 5IWLC 2AP2A 3QXAA 5CZXD 2HJFA 4G6KL 1Q9KB 3VXOA 4G6JH 1AGCA 1L7IL 5DWUL 3L95B 4XNYH 25C8L 1CQKA 4K71B 1MRDL 5JIKA 5KS9F 4AQOA 1JHLH 3QEUB 3NZHL 1KJMA 5D2NB 3ARZA 4YGVA 1R3KA 2FATH 4JY5H 3DJ9A 3QHZH 4LCCC 4KVCL 1MCWM 4UV7H 3RVTC 5MI0C 3KG5A 4PJBE 4G6MH 2X5PA 1SMAA 5EZOH 3IFLL 4M5YH 3BMVA 5KAQG 5EU5A 2OR7A 4JFDA 4QRPD 1A5FH 1U8MA 1H3TA 4MD5B 1MHPH 2P49B 3KLHD 1VEOA 3V0WH 5CCKL 1UB6B 3K3QA 2X70A 3QEQD 5DT1H 1JIBA 2V5SA 1EVUA 4JO2H 4UTBH 4PJBB 3FO1B 1H3UA 2DQTL 5DUML 1Z5LB 5BQ7B 1YJDL 4Y5YC 4ZG1A 2GJZB 4G8FA 1J1XH 4ONHB 1D5BA 3BSZL 4LNRA 4NQCE 4YK4C 4Z5RB 4NM4H 2IAMC 1EBAA 5DMJB 5IBUB 2LVCA 4MNHA 5KSAC 4WWKC 3VE0B 4YDKL 5DFVD 2WWMD 4D9LL 5HVWA 3PQYA 4M7JH 4X6CE 1SJHB 1KV3A 4GW5B 2G60H 2FIKA 1A7RL 2JK5A 1G0DA 1TDQA 4PYGA 5DJDB 4H26A 3VMPA 5F7EL 3F65A 4HDIA 4DEPB 1KLGA 5DD6B 4GUPB 1A6UH 4LQFH 1OQXA 3PL6A 4M93C 2DAVA 3HI1A 5HGAA 5C0RL 2DTML 1OB1B 4YXLL 2CSPA 2R69H 1DCLA 1ZWIB 2WZPD 1WC7B 4X4YA 4XMKH 2JELL 5IVNA 2AXGB 2ZUWA 2UWEE 2R29L 4YDVB 4LSDA 3P73B 5GRXG 2JJVA 4JHAH 5BZWA 3O6FB 4Q9QH 3W81A 1I1RA 5DR5L 2JB6B 1TENA 1R5WA 3O6KH 1BZ9A 1GC1H 3JWDH 2QBWA 2QSVA 1IGYA 1QVOB 3PXJA 5D1ZA 3HLAA 4I0PB 4XI5D 1ETZA 3RBSA 5FUOL 4L8SA 3SGDH 4P46B 1X44A 1A22B 5TPWL 3C9NB 1ND0B 3S3PA 1V7ML 1MJUL 1MIEH 4FXKA 3TT1H 5A2FA 4YQXH 2ESVA 4IIQA 4JQVA 5J3HD 1YYLH 4V2CB 2YPLD 3NCYS 2XN9E 1PVHA 1YNTA 4P2QD 5C08A 1P84K 1ZHNA 5TH2A 3RVUD 1FPTH 1AI1H 1D5XA 3MGOA 1UKTA 4FABL 1RZKL 3LSOB 4JRYD 2CLRB 2NTSP 3SDCC 3BO8B 5HYFA 2XKNA 4JFEA 3MRKA 3AU1A 4LCWD 4KC3B 4MQTB 3SKUD 1CTOA 5I1KH 3KNBA 1F11B 1NGWA 4NUJA 4PB0L 1J0IA 1QLFB 2XN9B 3OKDB 1CLOL 2VZ1A 5GGTL 1OD9A 1KFAH 1AQKH 3C09C 5ELIA 1KTLA 5GGRB 2A9NH 1TVBA 1RJZB 1YEKH 5AZEH 4QHUA 4QTIH 5F7NC 1BQHG 5H37G 4HV8A 5MEPA 1A1MB 2YPKB 3DVGB 3QISA 3Q3GA 4BZ2H 4UILH 4HUWA 3GMQB 5TE4L 3PWNB 4XC1H 1D9KB 3UAJD 1LGVA 2GW5A 3NIGF 2XY2A 4NWTH 43C9A 3ES6B 1UWGL 3V0VA 1QG3A 1UCTA 1RU9L 3GHBL 5A43C 4G8EA 3VXSD 4BSWA 2APFA 4U1GB 5T5NG 2VXQL 1NPUA 1DBAH 1RULH 1U8OB 2X89A 4DCQA 1IAKA 3NOIA 1Q9WA 3UJIL 4LDOB 4K8RL 5BV7H 1UC6A 4PJ7E 4N1EA 1H15A 3ZDZF 4NKMA 4P3CL 1IFHH 1F6LL 1N3NB 1NCCL 1ZGLA 5J1AB 1KBGH 4BFBD 4QXTB 3GMPA 4O2CA 2IH3A 4BH7A 1YMME 3QUZA 2VLKD 3GSNB 5FHAH 1CLYL 5F89B 3BWUC 3N1FC 3QG7H 3RWCA 4PJGE 2A1WL 2XT1B 3H9HB 2BVOB 4MS8D 2GY5A 5L2KD 4CADB 4PJ7B 5J89A 5E8NA 2EO9A 3QXWA 4ZFFB 3AMLA 4ODXB 4X6EA 1P69B 4ZPTB 3X11A 1JGEA 3C5JA 3G6JE 1XF4A 3EFFB 3QDME 1W8OA 4MJ5B 3ZT7A 3ZYZA 1W0WA 1YUHB 1P4BH 4PPTA 1NAMH 2YA2A 1YEFH 3GI8H 1JWSB 2ICWB 4BFEA 1YMMB 3BYTA 2DQJL 4P9HH 1DBBH 3QJFB 4HT1L 4PJGB 2L7JA 4OD1L 1E4KC 3PWPE 5F72S 4GRLA 4QXGL 4JFFD 5GISL 3QDGA 5FOBA 4GBXC 3TCLB 1ZLSH 3U0TA 4U7KA 3U7WL 2RIKA 2E7CA 3L3HB 3ARPA 5HYQA 1BFSA 3TBVB 4ZFGL 1GGIH 3EYVA 1X5YA 1VA9A 3HE7D 3G6JB 4QWWC 2IQ9L 3QDMB 3LQAH 4J4PC 4PV9A 1NMAH 3L6FB 1C12A 3WL9B 3I6GA 5DO2D 2ZSVA 2VKXA 4QRUB 1K4CA 1MREH 4WVRA 3O3AA 1WIUA 3SPVA 1DLFH 3QIBD 3JV6A 2EDKA 1CICD 4QY8A 1HKFA 4XC3H 3PWPB 3HNVH 3O11B 3C08H 1ZLVK 3BN3B 5DJYB 3UTOA 3FN9A 4JO1H 3KR3H 3MR9B 2FWOA 5E5MA 3LPFA 4S1DD 2VITA 3ARSA 1QLEH 3X3GL 2O5ZL 3FZUC 2BVQB 1A9BA 1YC7A 2VXSL 4OZGF 5ID0B 2X9XA 4EXKA 1YN6B 3O8XB 3MLZH 1IARB 2B4CC 2NLJA 1FH5L 4X80H 1Q0XH 3I6KA 2DIBA 3MCLL 1MCFA 1OP3H 3QIUA 4BZ1H 5IVOA 2EO1A 5EOCJ 4QTHB 5ADPH 1W0VA 5HVHC 3REVB 3MCKA 4KY1H 2OP4H 4L3CA 5GRJH 1KB9K 4LVOC 2WQRA 3NAAL 4EN3A 1BOYA 1WZKA 5FYLE 2IBBA 3VU2A 1R3HB 1KPUB 1X4YA 4R3SA 5AUMA 3QRGL 1K8DA 4FRWA 1AC0A 5CSGA 2ARJQ 1DZBA 5JR1H 4OZHE 5IJKA 3MRNA 4DZBA 1TTGA 5I8EA 5ILTH 1EJOL 5HHOA 2DYPA 1I7RB 3BGMB 2NZ9D 4KROD 4NPYB 5FECA 2VDPL 3WN5C 1JF1B 3WS6A 3OR7A 1MFDH 3KYMA 5GJTH 1UENA 3TN0C 3VXQA 4MWFB 3IB4A 3D0LA 3L3KA 5HY9B 3M1BB 4OUUA 3TO4D 1RAMA 2NXZC 4BYHA 2J7LA 3BKJL 2DLEA 4NKIL 4H1LH 1G9MC 5D72L 3TZVD 3WFEH 3BKYH 1RHHA 4OZHB 5DRZB 4GJTB 3FOLA 4TSAH 4JGJA 3OB8A 4RMSA 1MCOH 3FT4A 5FFLA 3GK8L 5FO9A 4C54A 1IQDA 2IPTH 2QR0B 3IXAA 1HILA 3AGVA 3KYKH 1ZOXA 3OR6B 4N1HB 1EHLL 2QHLA 3DUSA 1U95B 4IOFC 4NO5A 2FZ3B 2MSPA 3TV3H 1QO3A 3EFDH 5F8RC 1NANI 4ZMAT 1II4E 4HIHA 1M7IA 1CQYA 5H94B 1UEYA 3P9LA 3MREB 4MDJA 3TBWA 4Z18A 3I2CH 5CBEB 1G9NC 3WLWC 1HOCB 1SM3H 1A6AA 1OSPL 3NACH 5GGQL 2PR4L 3CDFA 1JGLL 3ARBB 3VGAB 4ZNEA 4HFWA 5C0NC 3U0WH 4NQCA 4I48B 3CCHA 1AD9A 3RWEA 2LAAA 3T8XB 2V2XB 3T09A 3B6SB 4YDVA 3U4BH 5LQBL 1J0ZA 3MO1A 4W4OA 3D2UD 4HWNA 1H3WM 2HA1A 3LN5B 3VGFA 1BLNB 4NQSB 4X6CA 2X6MA 1YZZA 3MRFB 2ZSWB 4YDJA 4P5TB 3RNQA 5EBMA 5C6TH 5GGSB 4Z7UA 1NUGA 3V6ZA 2P7TB 5IEHA 1H8SA 3AM8C 3OKKA 2AK4A 5E2UH 4DAGL 2GK2A 1GZQB 1FJ1A 3E2HC 1OF2B 3QO1B 4TNVF 5D96C 4X9FA 2V2TA 4G8GD 1JVKA 2UWEA 5L2KB 1YC8A 4FQPA 4S2SA 2G5RA 3O6ML 1MH5A 5I1AA 3ZE2F 5E99L 4M48L 4XCNB 3C6LC 3RGVD 2FD6H 1UM4L 3BRFA 4AIZA 1RZFL 4JZJA 1S7UA 3EZ8A 5EU6D 1U8LA 3S98A 2CLRA 2FJFA 2R2EB 3IU4H 4CN1A 4EVNB 2ZCKH 3SOBH 4KRPB 4GKOA 2AJ3A 3SY0A 3PHSA 1OGAD 3RKDC 5E9DD 2F5BH 5EC1B 4QCIA 4DGYL 4KKNA 5HHXH 3E8UH 2WBKA 4R0LA 4ETQA 2NW2B 2MCPH 4KKBD 5IW6B 2JCCF 4LHUG 3ROLB 4WCYH 1E28A 3BN9D 4G9DA 1XR8B 1IZKA 1EO8L 4HLZG 3QIBB 4MX7A 2NY7L 1CT8B 5I75C 3H42H 1F58L 3WSQH 4J6RH 1MLBA 3K8LA 4Y4HC 5SX5H 3OB0K 1DUZA 3U46A 5IFAL 3OV6A 5I71B 4H25A 4PJ8C 4EQ3A 4YC2C 1JNLL 4L4VA 1EFQA 3KPSA 5FO7B 2NX5A 2A83B 4HIXH 1FN4B 1R3JB 3ZDYE 1N8ZB 5ID1A 1DBKH 2Z4QA 3DO3A 3DTXB 3QNYB 4OCLC 5I1GL 1EGJH 5EH1A 4OM1L 3O9WA 3SBWA 4QHLA 3CH8A 4MNQD 4RMVA 3F7PC 4TSCH 5HI4D 4O00A 4YHKH 2X41A 1D3CA 2B1HH 4JFOB 4JFDD 4WV1B 4X6BB 5E95B 2VLJE 4UNUA 3GUTB 2X4OA 1NGYB 5DD0L 3VFMA 1PEWA 3NN8A 4IRJC 1ZEAH 4Y4FB 3WMSA 4IOSD 4U4BA 3BD4A 4JY6A 3FO9A 3P2TA 5FA3B 1UJTA 1NL0L 4H88H 4WJ5B 5E5UB 4LU5L 3WJLA 4RFOL 3MRCB 3TNNB 4KI5C 2GFBB 1O5DT 1X5HA 5FM4A 1QRNE 4LGPB 4X4ME 2VQ1A 3TBTB 2BVOA 4WFHE 4E42A 5EIVA 5INDB 1MRCL 3OPZL 2VLJB 3F12B 3SJVA 4L1DA 2Z92B 2EECA 4F9LA 1YEGL 3FRPA 2K7QA 4M61A 1DR9A 4YAQB 1A4JA 5LGKA 3PQYD 4OLYL 3ARDA 3P4NA 5EDXA 3FB5A 1EEZB 4L9LC 1MHCA 5LBSL 1BVZA 3UTPD 3WKMH 2PTTB 1QRNB 3DHMA 3T0VA 3PL6D 3QWRA 3AVEA 1JMZA 4HWEL 2ZOLB 5ESAB 1FO0L 3FQTA 2I9TB 1YEIL 5K9OB 3V5DB 1GAFH 5EA0H 1NCAH 1FVCB 4IRSB 5FYJH 1JYXA 1XR9B 2QHRH 1KEMH 2QV2A 1ZT1B 4CVZA 5BZDB 5EU4B 1R3IH 5A2LH 2HKHL 3PP3H 4GSDL 5HHPA 3QXVA 3BDXA 4PGJA 3BP4B 5D1ZD 3G6DH 3VRLF 3IDIB 3PHOA 3VWJC 2OX5A 3MLVL 5EO0B 3T77A 4ZAKB 4EDXB 3JVGC 3R06B 1DN0B 5B21A 2O5XL 3VXMA 4N8VB 3DI2B 1N4XH 2VSCA 3KLAA 2ESVD 5DC9B 3UTSA 4BQBA 1U8KA 5KTEL 4TULH 4JN1L 2DKUA 1J87A 1K3ZA 5C08D 3LY6A 1PEZA 5I1JH 2P5WE 3FTGA 1EA9C 4OFDA 1DQML 3ARFC 2R0LH 4YBLC 2YK1H 3B8YA 4ZTOH 2D7MA 3K4DA 4LAJH 3L5JA 2VL5B 1QR4A 4KKLD 2AEPH 2GIYA 4JAMB 4LLQB 4RZCB 3GSVB 4PY8J 4JFED 5KS9E 3OJDA 1KOAA 4HUNB 2MMXA 3C5SB 4KRLB 5JW4Q 4G8GB 5BOZG 4YUEL 2F58H 1NCDH 3RWIA 1JN6B 1VPOH 1WAAF 3SDAA 4JFQB 5I17A 3CAFA 4JJ5B 3BZ4A 3KPRA 2EC8A 2G9HB 4M6AA 2AKRB 5F9WB 3O3BA 5T1MB 4NBXB 3S37H 2P5WB 3BIAX 3BDYH 3VFGH 3GI9L 3O3DA 4NFDA 1URLA 3L7EB 2LE9A 2V9RA 5HGHA 5KS9B 5IHLB 3MX0A 4KRNA 3ZKNC 5I18H 2VN4A 3LKPA 1ZA6A 1IAOB 4XMLL 1IKFL 4WTXA 4HZAA 3LIZH 1QQDA 4DN3L 3KPMB 5J6HB 1WCQA 4YNYB 1I8LA 1BOGA 2DBLL 1RUKH 1DDHA 4FQXB 5E2JA 3KGRA 3MTRA 4KDWA 2L4OA 3FB8A 3U6RA 1Z9LA 4Y4KC 5F6IC 4AJ0A 4PTUA 2BNRE 2NZIA 1ACYH 2X89D 4F57H 3OR6A 1E6JL 1GPOL 2C3GA 1TZGL 4ODTL 1G7PA 2FZ3A 1A2YA 1FVDB 4KK6D 1IGML 1SQ2N 2J8UA 3SE9L 1S9VB 5DVOA 4QEGA 3ELAT 4NSKB 2RQ8A 1HH9A 2EICA 1B6UA 4HJGB 5JA8B 1LO5B 1R3LB 4LLMA 3QUZD 2F74B 2D0GA 3IDMB 5DHYA 2F8VA 2AK1L 2BNRB 2QTEA 1WBZA 3HC3H 3F7YA 5E08L 3H0TA 4OTXL 5EO1A 2QSQA 2X4PA 4HK3N 3BP5B 5AD0A 3CGTA 3H8NA 3MOBL 2DQHH 4G80B 2MKLC 2BK8A 1CZ8L 2PW1B 4HLJA 5IW3A 2W91A 5F3HA 3VWKA 4LAQL 3DMMA 3FRUB 3UZEA 1YEDB 2R0ZH 1W2KT 2BHZA 4XH2A 3CLFL 2B4CL 4GRLD 1F45A 3SCMC 3QDGD 1CN4A 2BOBA 3JWOC 5IHUH 1WIPA 2K9UA 3QIWC 1MF2L 1XGYL 2OL3L 4N0RA 4PGBB 3QO0B 5L8JB 4YHPB 1I4FB 3T0EC 1BHGA 2VDOH 5JXAH 5IJVA 3G9AB 1OAZH 4GRMA 1OGTB 3BT2H 1H5BC 4NJAH 3UTTE 5FIEA 1AQDB 2DS4A 1JZ6A 2HKFL 5E2TL 1HHIB 1BZ7B 1P7KB 2VXUL 3BZFA 2VXVL 4ONGH 4LVNB 1MNUH 4KZEL 3NBNA 4F15C 3W9DA 1U92B 1NCUA 4IM8A 1PZUB 4QRSB 3L7FB 5EG6C 5B39B 2VDRL 4YZFE 5IIEB 3PWLB 4M6ML 2QSTA 2V5MA 3ZKSD 3O0RH 1NEZA 2XWTA 1MHEA 1A0QL 5CEYB 4RGND 4NJ9L 3MRDA 3N85H 3UTTB 1G7HA 3IU3B 4NNXB 3RJQB 4YGAB 4HWBH 4UT6H 1G9ML 2XIDA 3LHPH 1FORH 4F58L 1Y18B 1YYMH 1Y0LB 3DBXA 3NIGE 4FFZL 4W6YB 4FTVA 4HXAH 1UYWH 1EAPA 1GHFH 2ZUQB 3QIUD 3U30B 4MA1B 1T3FA 1U36A 5DQDL 3RL1B 1IGFL 1UFUA 4Y16A 1KB9J 3V7AE 1UWEH 3MNZA 4EN3D 3BZEA 1A21A 5I1DB 2H26B 2J8HA 2COQA 1IC7L 3OKLA 2WIIA 2XY1A 5TDNA 4HS3A 4P57A 4UUJB 3CFDB 3RIAF 1QKZL 3ULVC 4Q6IB 3BPNC 4ODHL 5HHOD 3UX9B 3ZDZE 2DYPD 3LEVL 4LASH 2GUOB 3VDAA 35C8L 5CEZE 3QFDB 2VDQH 5GJSL 3R1GL 1FSKB 1OAYL 4HK0B 2PYFB 3MV7A 1QSZA 3DX7A 4OKVA 3QUXC 1DUYA 4QHKJ 3MJGX 3CUPB 5J9PA 2OI9C 5FV1L 3VFTA 4MDIA 2H3NB 3RGHA 4YLQT 4JKWA 3ARGD 4OGXH 4XBEL 1U93A 3CVIH 1F6AB 2V17H 1J1OH 4KTEH 4JPIA 4MA3A 4K7PH 4U7MA 5ICYB 1WISA 1FZKB 3BPOB 3MA7B 5CWSB 2BY1A 3ZKXC 1OARH 5JIPA 3TYGH 2ITCB 4XB7A 3RDTA 5ISZE 3WYRA 3O2VH 2V7NB 3UYOD 3AY4A 4JDTL 4OQ1A 4YHOH 1L7TH 1QFHA 1K2DA 3FOMA 4PUBH 1E27B 1IEAA 5T3XE 3QP3A 5L2JB 1FFRA 5J4MA 1RZ8A 4G6FD 5FCSH 4YAQA 2AI0L 5BVPL 4GMSH 4I77H 4R8WH 2PKDA 4UQ3A 1B3JA 4YH6A 1KCSL 3IAPA 1MFAL 4Y5XC 2AEIT 2IBZY 5EUOF 2ZOKB 1QFPA 5D8JL 1KENL 1S7SA 2Y07L 4A2LA 4GXVL 4YHMH 3TA3C 5ISZB 3THMH 4U1IB 2QKIB 2R4RL 5I15H 5CHNB 5DEGB 4OLEA 4GAGH 3UYRH 2PTUA 4XWGH 1U8HA 4IRSA 3AFLA 2VXTH 3EYSH 4XVJH 4QF1B 2HT3D 3W9EB 4N9OB 5DMKB 1B90A 3QQ4A 4ISVA 5CEXA 4ZYKB 3TNMA 2ZPKH 1DLHA 2DL2A 2CRYA 4GXUM 5A3IC 1KB5B 5DMGD 3V52H 2AK4D 3JWDC 1K8IB 3DXAA 4ZXBA 1GYAA 5EORH 2Q86B 1YY9C 4XPAH 2E9IA 1W0YT 1PKQE 2HH0L 4RMUA 4LRNL 3IXTA 5IUSA 2XZQL 5C8JB 5HYSA 3ULUF 1I9RH 3DETD 2HN7B 3VJ6B 4WUKH 1WWCA 3K4ZA 2FL5B 1MQKH 5D1XA 3ARXA 3RWGA 1E6OH 4FQQB 2E27L 2FJHB 4KJYB 5A1AA 1B0WA 2WUCH 2MNUA 1NFIA 3KPOA 3FFDA 4LEXL 2G5BA 5DSCB 3DSNA 1KN4H 4F8TA 2FB4H 5DHXB 4F7CB 2AJYH 2DM7A 3D25B 4RZCA 1HYSC 5I74C 3GSVA 4EKXA 1CLZH 1PKQB 4NC1E 3WV0A 4WI5A 4HIEB 3MJ8A 1NH6A 1V3LA 3K8MA 2BSED 3PG2A 4EQ2A 4I5BB 1J18A 1OP9A 4OZGB 3IF1A 2WP3O 5J12B 4B7LA 2IF7A 1MCPL 5HHME 4JFXB 4XWOD 2XG5A 4FZEH 2FLBT 1HWGB 4PJ9B 3NFSH 4EZMA 4UT9H 2R0WH 3MBXH 4OV5B 4UQ2A 3L7EA 5GIRA 4PY7A 4BK4A 3V4VL 2P8LB 4P2OA 4CDHA 3KPQB 5LWYL 4LKCA 4YHLL 4K3EL 1UZ8B 4OCXH 2HWZL 4U1JB 1EH9A 4IIQC 1AE6L 5SWSE 3L3GA 4L4VD 1S5IH 5CD5D 3KPSD 2NX5D 4EIGB 4MAUH 1CGSL 5HHMB 4M7LT 1H8NA 4M1CC 3K0WA 1MCWW 5CGYD 3FL7A 4RBPH 1U6AH 4ZTPL 4NZRH 1ZTXL 2E7HA 3L1OL 3IDJA 1LE9B 4I0KA 4GG8B 3ZTNL 4QHMB 3V4UH 1C08A 1KIPB 3FT2B 4RNRA 4YHNA 1JZ5A 3DVNB 2JE8A 2LTQC 5I6XC 5KSUB 1J8KA 5SWSB 4LLDB 5BV7C 1BECA 3C60A 4WHCA 4Y7MA 1HINH 4O9HH 5FYJD 4JKPL 4XTRC 2CUMA 4NDMA 4ZNCD 4GRWE 3FQNB 5E00B 3BP6A 2OZ4H 4HKXA 4Z77A 3VG0H 2F74A 1U8IA 4K7FA 4M1DL 1FL3A 4AEEA 1P7QD 3CSGA 2BP3A 3FQXB 5A16B 3Q0HA 5TE6L 5F7DA 2NNAB 1CDHA 5D7KD 1XCTA 3ILQC 3BHBB 3WXVL 5EBLB 3SJVD 5E4EB 3LV3A 1YEHH 2Z31C 2Q87A 3PABB 5IG7B 3KAAA 4YHZH 2V5TA 3IAQA 5IHZA 3ARDD 5GS0H 3ARGB 4GRWB 3DUUB 3GJFA 1A6PA 2HRPL 5IB5B 1M4KA 3RWFA 3RY4A 2R23B 2NY1C 2FO4B 4PRIA 1NGQL 4TRPH 4GS7B 1CLCA 5CMAA 4ZFOL 3OXSA 4H20L 3QWRD 1WGOA 5HHQA 4RAUB 3SHSA 4XHJC 2DL9A 3ZE2E 4OCYL 4UDUA 4OV6F 1AIFB 2ADFH 1OAXL 1H3VA 3WXWH 3MRLB 2V7HA 3Q5TA 4NN5C 3C5ZB 1OAKH 1S7VA 1B2WL 3WEXA 1FIEA 3LQAC 4KHXH 4ODUA 5E56A 3GMRA 5LJYH 3QI9B 3VXRE 1OW0C 4UIKH 4X8JA 2WUBH 3O3EA 4HJ0C 1LNUB 4M7ZC 3SKMB 1T03L 3QJHA 1UXWA 2JCCE 3VXMD 2BC4B 1P1ZA 3MRMB 4LKXB 2Y6SC 2YN5A 3ZE1E 1AHWA 3UTSD 3PIQB 1A7BA 3UBXA 1RUMH 1CE1H 4WDIB 3FB6A 5INCA 3E3QE 1QLRA 4EOWH 3EJZD 2PXYB 1Q72H 3B9VA 3BVNB 3VXRB 5B4MC 1CDIA 5HDQL 4XNZB 4ZSOA 1F4YH 2NY5L 1CL7H 3ZDXF 2WM0A 3QZWB 1FC2D 2JCCB 4JY4A 3WUWA 1F3DH 1G0XA 5D7JB 3FONB 5I76A 5L9DH 3QYCA 5IR1B 4OCSL 4Z0XB 1MCKA 3AUVA 3SDAD 4CVXB 3QPXH 2A6DA 1NBYB 3G04A 3KPRD 1F4XL 5DUPH 3QFJA 4POZC 1NBVH 4I18A 3GM0A 3MJ7B 4YHYC 2PN5A 1AKJD 2OJZH 1WSST 3VD9A 1ONQB 3KJ6H 1PG7L 5E5RB 1NCBL 4EUPA 1F4WH 1U8NA 3WHE1 1IJ9A 5TJWK 3WFBH 4PGDB 1N5AA 4N5EC 5JOFA 1KCRL 5K9QI 4P4RB 4PRBB 4FXGB 4ELKB 4P23C 2V6HA 1FNGA 1N6VA 4S10A 4H8WC 4MMXC 2QQNL 4AMKL 3FO0H 2GTWB 2FR4B 3BKML 3EYFA 4HUXA 4OIAA 2DF3A 3GSOB 1ES0B 2AJUL 4IDLA 4O2FB 5CINH 3JXAA 3OHXB 4M43L 4NFBA 4EI5B 3WIHL 4R2GD 4F2MA 4LCUA 3W11D 4M1GL 4U1SB 4DTGL 1T5XA 5L8LB 3AREC 5FKAB 2ZUTA 3ECBA 3K4AA 3QUYC 1UH3A 1CDBA 4D3CL 3AC0A 4UBDC 3S5LA 4FFYH 1RI8A 4K71C 3VGGA 1K5NA 3GGWB 1MFCH 4O2EA 1NBZB 2G2RA 3NGBB 5D2NC 3AROA 4EUPH 5DK0B 3MZTA 2BERA 4DKEL 2C5DC 1HDMB 3HZVB 2I60L 2VLLA 4LRIA 1YY8A 3HZYB 2H2SD 3V5HA 4OQTA 2WIMA 2MHAB 3G5YA 4NGHH 2CPCA 4U6HB 1RJYB 1OWRM 2EKJA 1L0YA 1EUTA 4JFZL 5FGBA 1XF1A 4K23L 3EOBA 3L5WB 1Q1JH 3MRGB 4NFCA 3LKOB 2DLGA 4NT6B 3EOTL 2H8PB 5M95B 3VRLE 4ZODA 1MWAB 4HG4J 1MELA 1N59A 4I3SL 4XPTH 3DMMD 1CVRA 3T1FA 2XV6B 5E8DH 1IT9L 5C09A 1IC1A 3H7BA 1X5FA 3WLBA 2IPKB 4OCRH 3IKCB 1AJ7L 1SY6A 3VMNA 1KPRB 5DRWA 1S9KC 1A7OH 1F90L 1P4LB 5D7LE 3NABH 3SEPA 5F6HI 4I2XE 1DFBL 1VDGA 4KJYA 1CGYA 2W07A 2VUOA 5C0FA 4JG0L 4AH2A 1N6QH 1GGUA 4W68A 4G6JL 2FBJH 1MEXH 1IGIH 4DEPC 4XNYL 1A9EB 1U58A 4L8DB 1JHLL 3N1GC 5AG9A 4ZUTB 3NPSB 1WAAE 2FATL 3CFEB 2OM5A 5T3XH 4JY5L 3QHZL 3VI4F 4UV7L 4RFNB 3N9GH 4G6ML 1B0GB 2BNUA 1BFOB 5GGVH 2ADGA 5F9OH 5GSVA 3O6FC 5EZOL 2ITDB 2DQEH 4I2XB 4M5YL 5DHVB 2CKBB 2F9BT 5JNYB 1ZAGA 1Z9SA 3UZQA 1A5FL 1J86A 3DHJA 1UWXH 3QDJE 4NCC2 2DWEB 1T1XB 1FL6A 4LHQB 1MHPL 1CFQA 3V0WL 5IQ7H 4HC1H 4ELMA 3V6OA 4PJ9A 3MRPB 4I0PC 2VR5A 2VWEE 2W60A 2VE6A 1FVEB 1SY6H 4P46C 5DT1L 3RRQA 3EGSA 2IMNA 4FTVD 4JO2L 1CFSB 2PF6A 4UTBL 3DUHA 3CX5J 1OM3H 43CAA 3ZE0F 3GSUA 3TYFA 3ZSSA 3RZWA 3UTZB 2DWDA 1J1XL 4Y16D 2XZZA 1VFBB 3V0AC 3RI5K 4NM4L 3QDJB 3ZMRA 3KXFA 4LIQH 1FDLH 5ESQB 1Z6JT 4XP9H 4GAJH 5EZIH 5CBAB 3T0DA 2ERJB 3EDKA 4HEME 4PJCA 4M7JL 2G60L 1MAKA 3MLTA 5KZCD 2F53D 1T0MA 3UTQA 4FQ2H 5T1DH 1QFWM 3DVNA 1A6UL 4LQFL 1XIWA 3MV7D 1A4KB 2DI9A 3S36H 1EXUA 2R69L 1JF6A 1EV2E 5E6ZA 4D9QD 1G6VK 4R4ND 1IAMA 4LLUA 2YD2A 4M6OH 3OKOB 1NGZB 4HK3J 2VDKH 4JHAL 2GT9B 1AKJB 4Q9QL 1EK3A 4YEEA 4UIMB 3O6KL 5LAXB 4WW1A 4KFZC 1GC1L 1KT2B 3JWDL 4EEEA 1AGDA 2F54E 4XMPH 3I02B 2BVPA 1GGYA 1D9KC 1ZHLA 1HIMH 2AQ3A 3ULSB 2OXGA 2WBJA 4TVPH 4ENED 2H45A 2H6PB 5CKAA 1MIEL 3TT1L 4X8XA 3KS0H 4YQXL 1WT5A 2KPNA 2PUQT 3BUYA 1EUUA 3ILPA 2XWBA 4U1GC 5ICXA 4PV8B 1YYLL 4JE4B 4HIJA 4CMHB 3CIQA 1DBMH 2PO6A 5EFIB 2NY2D 1FPTL 3QNXA 1AI1L 1LD9B 4LFHD 3L9RB 2F54B 3WJJA 4MAYA 1CD9B 1R5VA 5E8EA 3LKSA 1PDKA 4R9HA 1CR9H 4KKAD 1IRAY 2FRGP 1N7MH 4WO4A 3WO3B 4NRZA 5ADOH 3VFNA 3EYQC 2D7TH 3LD8B 4F7MB 3DV4B 3WIFB 1KYOJ 3B2UC 5JORA 2HAZA 5I1KL 1IEHA 1JZ4A 1KFAL 1AQKL 3CMGA 2AJZB 3DXAD 1DE4B 4QRQA 1X7QB 2A9NL 3DRQA 3V5KB 5AZEL 1YEKL 4C83A 1TZIB 4QTIL 5JHDE 5DVNA 5IB2A 2NXYB 4GRWH 2XNAA 4BZ2L 4UILL 5D1XD 1FHGA 2ENSA 3K46A 2H1PH 4XC1L 4LSQH 3BPCB 5ERWA 5KJRH 4RGMB 5JXEA 3HRZA 5MERA 4NWTL 4R7DA 1C16B 3BVNA 5L6YH 4MJ4A 4D0DA 5EPMA 5DD5H 1PKOA 4MGXA 3QZWA 3NCMA 4WI9A 5D1QB 4X7TB 2WP3T 2E9BA 5JHDB 1DBAL 1RULL 2GSIA 1YEEH 2EH8H 5C9JB 1NBYA 3SDXE 3OX8B 5E7FA 4N0CC 5BV7L 1DVFA 1JHKH 2OMNA 3MJ7A 1IFHL 3FMGH 4LSUH 4ODSH 3BZDA 3H3KA 4RQQB 3CFKB 1KBGL 1GRWA 3SDYH 1DANT 1EEQA 4GW1A 3EUUA 4X0KB 4P2OD 3G6AA 3GHEH 5FHAL 3QG7L 1HSAB 1PYWB 5CP7B 1Q38A 3DV6A 4QOKE 2G75A 2X4UB 2D31A 4MD0B 4WHYG 3IYLW 4OZFB 2HYMA 3M07A 2DD8H 1PD6A 1FLTX 3SKNB 4TNWK 4TUOB 3K2MC 1ORSB 1MCEA 3O8XC 5C0IA 4D8PB 3SGKA 5GS0D 3HZKA 1HQ4B 1P4BL 3TEUA 2I9LB 1NAML 1YEFL 1NCWH 3GI8L 3X14B 4D0BB 3LN4B 4P9HL 1Q9OB 4YR6A 1DBBL 1A7PH 2DLHA 3B9KA 3MUGB 4QOKB 5CP3H 2M1KA 1JHTA 3C60D 1TTFA 1ZLSL 5D9SB 1U3HA 3LCYA 1HNGA 1GGIL 1NAKH 4Z76A 3LB6D 2N7AA 2NR6D 2EE3A 4RFEA 3LQAL 1NMAL 3MJ6A 5E1HB 2HJLA 3LS4H 1MREL 1DANU 4LLVB 1ZT7A 1DLFL 2F53B 4KDTA 3OGCB 4QXUH 4GKZB 1X9QA 4HD9A 4RWHA 3HUJF 4OLVH 4XC3L 5EUOB 3HNVL 5L0QB 3C08L 4PB9H 4JFPA 4HUUA 4LSPH 3TVMA 4OD2B 3QHFH 1V05A 5IESH 4JO1L 3KR3L 4ORZC 3T2NH 2RCSH 4G43B 4AT6B 4PRID 1MLCB 4NYLB 3ULUE 1U8JA 3K2UH 3F7VB 3WS3A 2VISA 4DJMA 5DVLA 5KAQF 5C0AA 1RZ7H 1HH6A 3MLZL 4K07A 1GZPB 1RFDH 1RY7B 4X80L 1Q0XL 2Z8VC 3BUTA 2AV1A 1PBYA 3AMKA 2R9HD 3UJTH 4BZ1L 1KN2H 3TBYA 4JPVH 5ADPL 4PJIE 4NC2B 1X4XA 1CXIA 4KY1L 3WE6B 2OP4L 5GRJL 1BJ1H 5KG9B 2YBRA 5C0DA 4X6FA 2NY0D 1DJSA 2ORBH 4WU7B 2AXFB 3ARBC 3VGAC 4PRNA 1I7TA 3IETB 1Y6MR 5JR1L 5CSZA 4ZUVA 2BVYA 5CJXC 5CLWA 1B0GA 4JDVB 5ILTL 5D2LF 5D7LA 3MYJB 3N0PB 5DHVA 4P5TC 5KW9H 5EU3A 1MFDL 4PJIB 5GJTL 2WWKO 2ICES 1DQTA 1T4KB 2SEBA 4AENB 3LRSB 4JM4L 3VXUE 1CL7I 3MV01 1OT1A 2J1KA 2YD8A 4WGWB 3NZ8B 4K7PX 3WFEL 4PJHF 4NO2A 4XPBH 3BKYL 2X7LA 4TSAL 4AEFA 1X5IA 1MCOL 2FX8H 3RP1A 1G84A 4NKDA 5J56B 5BVJB 1TNNA 2IPTL 5F1NB 1IGTA 5ICZA 2D03H 3GEWB 1ZV5A 3KYKL 1DQQA 1RZIB 3FAWA 4HX1B 2OK0H 1T5WA 4JN2B 5KBNC 4F7TB 3QFJD 2X4RB 4UV4H 3TV3L 4MJIA 5HGDB 1FGNH 5SX5K 3EFDL 4OIIH 1UG9A 1I85C 3VXUB 3BQUB 4L5FH 1L4IA 3EO0A 3FRPG 1GIGH 4KRPC 3LKQA 1ACZA 5EWIH 3I2CL 4JM2F 4ZFZB 3UBXI 2BSRB 2XQYK 4O58H 2J88H 1J8HE 4JZNA 1IQWH 4OSUH 3NACL 5DHVH 3MNVA 2CKBH 5T3ZE 4WFFD 3F7RA 2FYYA 32C2A 3U0WL 4Y1AE 3QXTA 3D85B 5GZOD 2GJJA 3WBDA 3PDOA 4WW2F 1A3RH 2P44B 1RQ5A 3U4BL 3GDBA 3QAZB 1FNHA 5K93A 3QIBC 2XWJA 4ETYA 5K9JH 2W65B 5C6TL 3MCG1 2RJMA 3EDDA 1J8HB 4BH8B 5I71C 5E2UL 1FNFA 1QR1B 1MVUB 4DVBA 1CD0A 4PRHA 5E8PA 1S9WB 4Y1AB 4E41A 4S1DC 4K9EH 5C0BE 2L7UA 1T1ZB 5I1LA 4WHTA 4M9PA 5BRZA 5KN5B 3U9UB 1FZMB 3CSYA 4JJHA 4HWUA 3ZKMC 1LEIB 2GAZB 1EDQA 2FD6L 1ZE3C 5K9QG 1JWMA 1VGKA 4OLUH 5B3JF 4WV1C 5BW7A 1R6VA 3V2AR 4Y19A 3C8KB 3M17B 1ZVYA 3IU4L 2F19H 3Q6GH 2ZCKL 3SOBL 5IWLA 5C0BB 5FDWA 4Y4FC 5K9KB 2EDOA 5DJCA 2F5BL 3ORJA 1MJ7H 5H2BB 1S8DA 5CSBA 1Q94A 1ZA3A 5HHXL 1X5AA 3E8UL 4UOJA 1YDPA 5C0EB 5IMLA 4M9OA 4JHBA 2MCPL 5T5NF 3X13B 2HP4A 4LCCA 5SWZA 5C09D 3FT3B 4WCYL 2NZ9C 3KYNB 3SGJC 3GM8A 3RUGF 1FLRH 1RUQH 2EKSA 4HS6B 1LDSA 4TTGA 2IADA 3HI5H 3H42L 3WSQL 3E6FB 4J6RL 5IFHH 2X09A 2HTLD 3VFRB 2I5YH 1NFKA 1VSCA 2B7DT 2LQRA 4E0RB 1WBYB 3CSBA 4OKDA 5K33A 1VFAA 2ED8A 4UT7H 2D0HA 4ZO7A 1T21A 4HIXL 3VG9B 5CLTA 2ZNWA 5TGBA 3HS0B 3MJ9A 3QCTH 1DBKL 2VH5H 4LMQE 4Y5YA 3I85A 4BELD 1LK3H 5GRYA 4AY0A 2DN7A 1EGJL 4IRSC 1O0VA 2D7PA 4I4WA 4KTYA 1EO5A 2IAMA 1FL5B 4U1MA 5KSAA 3ESVF 4WWKA 4TSCL 1HZHH 4YHKL 3BH8A 2B1HL 5ACZB 5J13B 2X9YA 5HHNA 3JV4B 1QSEA 3VH8B 1AGEA 3GMMB 3LRGA 3TJHC 2I24N 3S4SA 3TPUA 5MP6H 1ZEAL 3PE9A 1I8IB 1G6RA 3FHQA 4ZAKC 1M05B 4H88L 2BDNH 4X0KA 5IKCB 3MRJA 4EIZC 1AO7E 5DS8A 5FO8A 5E24E 3ETBF 5C07A 3FQRB 1KIRB 1AP2A 1I7ZA 3F8UB 2P43B 3SDXA 3OKYA 3KXFD 4TVPD 5I8CB 2XKUA 3MLPA 2EZ0D 4LP5A 3MJ9H 5B8CB 3MGAA 2BJMH 4L8CA 3SKOA 3VXNB 1ED3A 1T7VA 2EDQA 3HPJB 4UINH 1N2RA 1AO7B 1EFXA 3MUGA 3WKML 3HTLX 4R7NA 1TJHH 6FABH 3D3VE 1XIWD 1HK6A 1YPZF 4PJDE 5CJQH 3IJHB 2RFXA 2VAAA 4PGZA 3MLSH 2RAMA 1CXHA 1GAFL 1BVLA 4OZIF 3HPLB 5EA0L 5F9WC 1NCAL 2HMID 1CXKA 5FYJL 5E0QA 2ARJA 1G6RH 5GXBB 2QHRL 1KEML 3VD5A 5EN2A 5F9JB 3ZHKA 3CVHB 1ADQH 3IJYA 3ARYA 1R3IL 4M3KB 3WFDH 3QPQC 3SDCA 5FHBH 4G42A 3G6DL 4FQ1H 3D3VB 2HT4D 4MXWH 5JMOC 2WBJD 2P47B 2EE2A 3K8KA 3INUH 2ZG2A 1Z3GH 2DICA 4FQXC 1N4XL 2GCYA 1QSFE 4EBQH 3J7HA 1IM3A 1C5BH 1HHHB 5DJZB 4TULL 2OTPA 4PLOB 1JP5A 3LQMA 2PO6D 5IB1A 5I1JL 2AJVH 2XPGA 3VFOB 4HZLB 1NEZG 2R0LL 5ABDE 2YK1L 5TDPA 3LQZA 3PGCB 4MAYD 4X7CC 4ZTOL 4JZOB 2AEPL 3GFUA 1QYGH 1R24A 4WO4D 5JPNA 3MNWA 1E4WH 3W0WA 5EZLA 4PTTA 1BVKA 1QSFB 1YECH 2H9GB 2N1KA 2F58L 4JKMA 2EYRB 4ZQKA 5JQ6H 1NCDL 3BGAA 1VPOL 1SMOA 5D7IF 3VI4E 2X1QA 3HR5B 2P8MB 3S37L 4POUB 5J1TC 1NDMB 5CD3B 3VFGL 3BDYL 1FBIH 5TFSH 3BRDA 1TPXB 4YDLB 3C6SA 3A6OA 1PAMA 3QXDB 3ME0A 2ED9A 3KPTA 5ETUA 3AXLB 5EB9A 3OB0H 3B9EA 1WZLA 3VXTA 2CIIA 5I18L 4Z95H 3EO1A 1KUMA 5JXED 4AENA 5HSFA 1VGEH 2BVTA 3LIZL 2NY3D 2Z8WC 3DROB 3VA6A 4XNQA 1RUKL 4N90D 1VADB 4P3WA 2HLAB 4KUZH 1RZGA 4P2RE 3ZTJH 1PQZA 2FEEL 4U0QB 3PGDA 1ACYL 1FNAA 2JJSC 1XF3A 4F57L 1JNJA 1FFPB 1JTOA 2Z91A 4V1DA 1S78C 4TTDC 2XXCB 1J7VR 8FABA 1DVFD 2FEDC 4YX2H 4KAQH 5I19H 3FCTA 2HFGH 3OAZH 4IJ3B 4LVNC 2VABB 3RVXC 3D6GA 4OT1H 2D9CA 2A0LC 4P2RB 4JLRA 3IVKB 1E4KA 4K8RD 1GOHA 1LO4H 4GBXA 3V4PH 3DVIA 4MCYB 2CUIA 3T1WA 3HC3L 1AHWC 2AJSH 1XZ0A 5FKPA 4Z7VA 1ROWA 3WFCH 5EBWA 4P5MB 3KDMB 2H2PC 4J4PA 2I07B 2DLTA 4LFHG 3SQOH 4G6AD 5JPMA 2DQHL 4JDZA 5IP4A 1ZSDB 1TNMA 2JJUA 1A6TA 4M7LH 5SV4A 2ZUQC 1BFVH 1T6WA 1VHPA 4MA1C 3U30C 1KG0A 4YIQA 1MOEA 4DZ8B 1HXYB 1UH4A 2R0ZL 1AXSB 4HAGA 3B9KD 4L3EE 1QFWH 4B50A 2EYTA 1G9EA 2IPUG 5I66A 1MUJA 5KVDH 5IHUL 3HCVA 4OFVA 1U3HD 3OKEA 2PYEE 2CK0H 4OF5A 4XRCA 4V2BA 1YMHA 5D6CB 5HYSG 5MENE 2VDOL 4Q6IC 3UEZA 5JXAL 2VKWA 1IL1B 1OAZL 3HB3D 4NJAL 3BT2L 1DQJB 4HUKB 1FSKC 4PLJD 5FA4B 2HFTA 2BVUA 1G7IA 4ONGL 4L3EB 3ALXA 5IVZB 1MNUL 4PREB 3HC0A 2VDMH 3VW3H 2ATPB 2HVKA 4FQIH 5E1AB 3TVMD 5TDOA 3O81A 3AS0A 2PCPB 5E6ID 3QHTC 3CLEH 3DX8A 4IRZH 4OFYA 2QADB 3D87B 4WIQA 3BPOC 3O0RL 5MENB 4HS8H 1KNOB 4OF3A 5F9DC 1EX0A 3O4LA 5T3ZH 3N85L 4HWBL 4UT6L 3RFZC 4C4KO 3ALWA 3WN5A 3LHPL 1FORL 3R0MA 5C0AD 1YYML 1A1NA 3ROOB 3EYOB 2P5EE 4HXAL 1UYWL 1GHFL 3TN0A 5DJAA 1JGDB 4R96B 3KPPB 4KJQD 4QRRE 4RIRA 3MRIA 4C55A 2UUDH 4L29A 1D5IH 1UWEL 1VKXA 4J3SA 3DO7A 1D5MA 4NQVA 1TZHA 3UPRA 4L3AA 4BUGA 2BRRH 3E6HA 3STLA 1DEDA 4JFYB 2BSTA 2C7UB 5GRWA 1OTUD 3LAFA 1HEZB 3CDGA 5FEBA 4LASL 3DGGA 1J11A 3I3EA 3IGAB 3P77B 4NO3B 1NMCB 2VDQL 2ZZUT 2WWKT 1XF2A 3ARRA 4QRRB 2C1OB 3S36X 5M94B 3JZ7A 3UROR 4PGCB 2BY2A 2GQHA 3GJEB 2YHGA 2XFXA 5E70A 1IC4H 5AWNH 4Z7WF 1TQBB 4KJWD 4HWZA 4OGXL 5F88B 3CVIL 2V17L 2W92A 1T22A 1J1OL 4KTEL 5EBGA 4K7PL 4XVUD 2YZ8A 1P2CB 2AV7B 1KIQA 1OARL 3TYGL 1MFNA 1J1PH 2WW8A 3QR2A 1CTNA 5DJ6B 3V8OA 2VLRD 3O2VL 3T4AB 4I0CC 4YHOL 2OJEB 4RMQA 1S9YA 3HAEB 5J6GA 1L7TL 1QHPA 1G7MB 4MJ6A 4PUBL 4MJID 3CZFA 2VLMD 4HCRA 3LKNA 4GMSL 2GJ6A 4I77L 4R8WL 1GVIA 1N0XH 5D71H 3WUZA 3GIVA 4JRXA 3ZHLA 5DI8A 2XTJB 2EEAA 3PWJA 3R8QA 1KJ2A 4YHML 3THML 1RUPH 5DRNB 5I15L 3MRRB 5J12C 1BX2A 1K85A 3TT3H 4GAGL 3UYRL 2MOVA 2Y72A 3L3OB 3LZFH 1I8MA 4XWGL 3LEYH 2X4TA 2VXTL 1G9NH 3L5XH 3EYSL 3P4OB 3C6LA 4XVJL 4IS6B 3NFPB 4PJ9C 4R4BA 5F9JA 5MEQB 3HUJE 5DD3H 5F97E 1UGNA 4PJEA 5IB3A 3TESA 5C0GA 2ZPKL 4NC1C 5FYKH 3MLWH 1CFNB 2EYSB 5ITFA 4YBHA 3V52L 4WU5A 3VCLB 1F8TH 3P9MA 1GJIA 4PJDA 2R2HB 2YSSB 3D9AH 1FFOB 5EORL 2PETA 4PRHD 4XPAL 1S5HA 1G7JB 4E41D 1AGFA 1FYHB 1KJ3H 4HCRH 4JFHD 5C0CA 5BRZD 1I9RL 2EDXA 4GKSB 4LBEB 5C0JB 4L4TE 4WUKL 4PRAB 1HHHA 2CDGA 1MQKL 3QWOB 1F00I 4CBPA 1E6OL 1DQLH 3HUJB 1FYTE 4P3DB 2B8OT 5ESVB 3MRBB 2WUCL 2FX7H 1EHAA 5BS0D 1KJ2H 5CKGA 1SYVB 1I7UB 3PGCA 3UBXG 3QNZB 1RPQA 2E7LC 1KN4L 2UV3A 2FB4L 4Y19D 2AJYL 3B9AA 4KK9D 2YUWA 4PJ8A 1CLZL 1C5DB 3CPLA 1YQVH 1HSBB 5E8OA 5DMYA 3CVHH 5DJ2B 1XGUB 4JR9H 1SVZA 4L4TB 4D0CB 1SJVA 5DEFB 3WUWG 1FYTB 5D2LE 2IANA 5FYJU 3IJSA 3RVTD 2UVEA 5SWZD 1I9IH 4FZEL 3MLYH 3G5XB 3MV9A 4U7SA 3O3UN 4OCWH 3NFSL 3WHE0 1UVQA 1V8HA 3QXDA 4UT9L 2R0WL 3MBXL 5E4EC 4FP8H 4EUPG 1IM9D 3OBAA 4F7PB 4NQEE 3JTSA 3ARGC 4OCXL 2R2BA 4IRJA 1T0NB 4PJHE 5BXFB 1S5IL 3UMTA 1WICA 2CDEB 5T1KB 4GS7C 5D2LB 4MAUL 2A73A 1KJVB 3D48R 3BH9B 2YD4A 1A1OA 4GAFB 1U6AL 4N0FB 4NZRL 4L8BA 1S7TB 1UKQA 3K81A 4PRPA 1FZOA 2CLVA 4FZ8H 4ZUSB 3IFPB 2IAMD 2EDTA 3GSWA 4YHIB 5KSAD 2Y5TB 4WWKD 3C5ZC 2C3WA 3V4UL 4X5WB 4X9IA 4NQEB 1LEKB 4QHKI 4CU8A 4OAWB 4PJHB 2W59A 1T83C 4ZD3H 1QSED 3MRHA 4X98A 4O02H 4TUKH 4F3FA 1BF8A 3QI9C 1ZHKA 1HINL 2EIZB 4O9HL 1HI6B 3VFSA 3S5LG 2VZSA 4L9LA 1LK2A 4UU9A 4ZUUB 2OZ4L 1U91B 4LEOB 3VG0L 4YBQC 3IDNA 1W72A 4KUCD 1I1AB 5C07D 3RBGA 2VSDA 1ZHBA 4MNGA 4PJ5A 2YUVA 4Z78A 1CIUA 1C1EH 3G5VB 4DKAA 3OKMA 2BRQA 1INDH 1FV1A 1T66C 4JM2B 3QH3B 1OQOA 1JPGB 4U2ZA 2J8OA 1BD2A 1YEHL 1M7DB 1IC5H 2A74B 2PXYC 3HE6B 5FAAA 4HQQH 4P4KA 3PNWA 1TETH 4YHZL 4XNZC 3X17A 5FGRA 4AZ8A 5GS0L 1MI5A 3VWJA 5FK9A 5HYJD 5EIQA 2CR3A 4O51A 3JVGA 4WW2B 2VIRB 4TRPL 2MPAH 3RY6C 1EFXD 5D7JC 2BSSA 1E0OB 2ARWA 2X44D 4ZOBA 3DYOA 3DETC 3RVVC 1FZJB 2VLRB 2GKIA 3U36B 1DSFH 2ADFL 3E3QC 3EOYG 1CE6A 1FGVH 4HPYH 5D70H 3WXWL 3FHAA 4BK5A 2YUXA 1OAKL 3LKRA 4RAVB 4NRXA 5JIHA 4ZFOA 3BX7C 1W72H 4KHXL 3QG6B 3TGXA 4U1KB 3WDIA 3TBSA 4WEMB 3SDCD 4WHDA 1KEGH 4CW1A 2Y7QA 1DQDH 2GK0B 3OJMB 4UIKL 5T1LB 2WUBL 3KPLA 5D6DC 5IB4B 4UDTA 2WANA 3TIDA 3QEHA 3I50H 1BQHB 4TN9A 1B0RA 2PYEA 1MCQA 2H32B 2C9AA 2NTFB 1QA9A 3RUGE 3SN6N 1T1YB 3H7LA 4HH9B 4LF3B 4S0SD 4XAKE 4EI5C 5IVXA 3N1QC 1RUML 1CE1L 3PV7A 1LO2H 1YN7B 4EOWL 3MPCA 1Q72L 5HGBB 4KTDH 4TUJA 1F3JB 1S7WA 2EDRA 1F4YL 3IDYB 1RIUH 1QEWA 1CL7L 2EC9U 5IT2H 4R96A 3G5ZA 3DPBA 4X6DF 4WGVB 3NGBC 4CNIB 3W0WD 3RUGB 5L9DL 2D7QA 1L0QA 2BX5A 3BP7B 5DDHB 4Y2OA 3QT2A 2QSCH 2ADIB 3QPXL 5EIIA 1OLLA 1S7XB 2R1WA 4PRDA 4RMTA 5DUPL 5I2IA 4Y4KA 1NBVL 3ABZA 3CDYA 4KK8C 3WFZA 2OJZL 3HG1E 1FFNA 3KJ6L 4PG2C 3S8WA 2XG4A 1F4WL 2JJWA 1T1WA 4MQ7B 3V6FA 3WFBL 4OI8A 2A6IA 2IH1B 2P5EA 4FQJH 5F6HJ 5JOPE 3VXPB 2E9WA 3EDJA 5LG1A 3GSQB 1VACB 1LP9A 1OSZA 2Q8AH 4WUUD 3BW9B 4QT5B 3S96B 1PFCA 3FO0L 3IFOA 4G9FA 1IMHC 3K80A 1WCBB 5CZVH 3BEWB 2JIXA 2P4AB 4IHOA 4APQB 4HIIA 1RMFH 1RVFH 5CINL 3L3DB 3HG1B 4JANB 1CDJA 4U6YB 4PJFF 1UWXK 5DJ6A 1XGPA 4XXDB 1B4JH 5IEKA 1BBJA 1ZVSA 3EOAA 2VQUA 4V1DD 5KOMC 1IM9B 3G08B 4FFYL 1BIIB 2AERT 4OZ4B 1M6OB 3WIHA 4MA7H 4H5SB 1MFCL 2OMBA 4I9WE 1YPZE 1WFNA 4EI6B 2EXWC 3JV0A 4OZIE 1HHGA 4RFNC 4LHUD 3RNKB 1FNEA 1ULVA 4XCFH 5HYIA 4HUVB 3L3JB 3SCMA 4GBXD 4J1UB 4NGHL 5IBTH 3QIWA 3MRRA 5HDBF 3KVQA 2R4SH 1MFBH 4C56E 3U0PA 4KZDH 3HZMA 5FF6A 3DX6B 4QWWD 4X5XB 1Q1JL 2IG2H 4J4PD 1XCQB 4L9DA 3FFCA 2VDNH 2A6JB 3DURB 3OKNB 4PG9A 3EHBC 2CJUH 5DJ0A 3O45A 3PJSA 1YPZB 5AZ2H 1KGCE 2Q8BH 4OZIB 1QFWI 4HSQA 4XPTL 5LGJA 2HJKB 5E8DL 3HAEH 4G7VH 3D69B 3RTQB 4KXZI 1AGBB 4OCRL 4C56B 4X99A 1NC4B 2NY4B 4K9EC 1A7OL 2ERJC 3P9WB 3FZUD 3NABL 1KIUA 1I75A 3DIFA 2VWEC 1CGTA 3VRJA 3RX8A 3FO2B 1N6QL 3MV8E 4DKFH 2FBJL 3CMOH 1G7QB 1IGIL 1MEXL 2B5IB 3JWOH 3QQ3B 1OTTC 5HYJB 4AG4H 5HPMA 1J05A 4NRYA 4QYOA 2HFFB 2P42B 4WTWA 1JUFB 4JB9H 1I1FA 5DZOA 5T3XL 4NUGH 4YO0A 3N9GL 2KQNA 2YPVH 3MFFB 5GGVL 5F9OL 3QZWG 4HJJH 4OFYD 2DQEL 3PWVA 3PHQA 5KSBE 3GMNA 3VGHA 1D6EB 1FE8H 1KPVB 3MV8B 4CMMB 4GW4A 3O4LD 4ZPVA 2R1XB 2PTVA 3GBNH 5IQ7L 4HC1L 1FO0B 4Z7OF