1Y18B

Fab fragment of catalytic elimination antibody 34e4 e(h50)d mutant in complex with hapten
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
226
structure length
226
Chain Sequence
EVKLLESGGGLAQPGGSLKLSCAASGFDFRRYWMTWVRQAPGKGLEWIGDINPDSRTINYMPSLKDKFIISRDNAKNSLYLQLSRLRSEDSALYYCVRLDFDVYNHYYVLDYWGQGTSVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural origins of efficient proton abstraction from carbon by a catalytic antibody
pubmed doi rcsb
source organism Mus musculus, homo sapiens
molecule tags Immune system
molecule keywords Catalytic antibody 34E4 light chain
total genus 43
structure length 226
sequence length 226
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2004-11-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1y18B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1y18B01
3QG7L 5C0AA 2IH1B 2VL5A 1ZVSB 1ZXQA 4K2UL 4R2GD 4NKMB 1IGFH 4MJ5B 3DX6B 1WZ1H 5JDSA 4FP8L 2P43B 1PVHA 2CH8A 4LSSH 1G0XA 1T7ZA 1WWWX 1J1XL 4NNPL 3UO1L 5D5MB 3DIFB 5CEZH 5J13C 5DS8B 3BDYH 1RFDH 1WIUA 4LF3A 2PNDA 4HGWB 1JHLH 2B0SH 5TJWK 1K3IA 4JAMA 4P2RA 4PGDA 3WDHA 3O2WH 5GGUB 5E95B 4YHLH 1CFTB 4K7FA 5DJDB 1MVFA 3PWUB 2V5SA 4U1IA 3ZE0F 3LQAC 3FT4A 2HFEB 4Y0GA 3KPOA 4WNQA 1KLGA 4XNZB 1D9KD 4F7CB 1DQLH 3M17B 4YFLF 5E9DB 4X6BB 1FORH 2AK4A 1S7XA 4KZDH 3BN9C 5DMKA 3W39B 2EXYC 3G6JE 3P30H 4HWUA 2BFVH 3EOBB 5LAXA 1BGXH 4JPWH 3HAEG 4HMCA 3FFCE 3T0XA 4X9HA 5B39B 4DQOH 2GTZA 5H37H 1LDPH 2DYPA 4Z0XA 1YMME 1FFNA 4JY4B 4NJ9L 2H3NB 3UZEA 4Q9RL 4BZ1H 3B5TA 1NBYA 4Z7UE 4WI4A 1OAKL 3VXUA 1LO5A 5AD0B 1IEBA 4E41A 1AD9A 4F9LC 1CICD 2H9GB 2DIJA 4HZLA 1IAMA 3MRPA 3T1FA 4TUJA 1JZ5A 2RB8A 4S2SB 5MHSD 1NCNA 2ICES 1ZS8A 2AJSL 3OSKA 4XPFL 3SGJA 4TPRL 1YY8B 4LLVA 1ADQL 1RD6A 1R24B 5LBSL 3BGFC 3VWJA 2H45A 3PHOA 4JFDE 5CEYB 1I1AA 4WUUE 4JFYB 5HVHB 3EOAB 5F3HA 5FGCE 4QCIA 4X80L 1UENA 3TIEA 5JQHC 5KTEH 3DO3A 3ARPA 1J8HA 4JFXA 4Z9KB 1DQMH 4YUEH 1LK3L 4Z5RA 3U9UA 3QJHA 2EIZB 4KVCL 4XHJC 4JRYE 1YN6A 3CSBA 4FFVC 1M7DA 2YRLA 5E5MA 4JKLA 4NHUA 4GRWH 4JQVA 1G7LA 5C2UB 1RVFL 4JPKL 4HMEA 3ZTNH 3GMRA 2GAZB 3C60A 4QEGA 3JUYA 4OFPA 3KAAA 4ONOA 4AEHL 4CMMA 1NMBH 5CJOL 2GUOA 2DMCA 4JGJA 5D72H 1HSAB 1WUNT 3O3UN 4QGYA 3MLUL 3DTXA 1NBYB 1NLDL 4AEEA 2HKHH 1SEQH 3QDJD 4I0PA 4G7VH 4JO2H 3KPTA 5DR5L 1UKQA 3G9AB 1YPZB 5JUEL 3QWOA 2YBRA 5ICYB 4K8RD 3KPLB 1F58H 3LCYA 3X17A 3TT1H 2WSKA 3RDTD 3GSUA 1KV3A 3VXTB 4UNUA 5ITBL 4A2LA 4KROB 4MDJA 5E03A 5EO1A 4NM4L 1TCRA 3PL6A 4TVPE 2XT1B 2Y06L 4OTXL 2Y07H 1MI5D 1N7ML 2APFA 3BGMB 2NXZB 3ZTJG 5EIIB 3QDGD 1U3HB 2CIIA 2PW2B 1G7LB 4F80A 5BXFB 3GB7A 1T0PB 2VKWA 3RJDA 5J1TC 3KLAA 3SPVB 3ROOA 3BQUB 1FO0A 5HYIA 1MQKL 1WBZB 4GKNB 5ICXA 4XHJD 5ICXB 2Z0BA 4D9RD 4PJFB 4JFPB 5F8RC 2B1AL 1LD9A 1X5HA 1H3UA 3G5ZB 4MDIB 4RMQA 5GJSH 3SOBH 3X3FL 1SY6A 2J5LC 4OCMC 4Q6IA 4F7MB 1CDCA 4OCWL 1T5XB 2EDYA 3SE8L 1X5FA 2BNRB 1RZGA 3LZFH 3ULUC 1QFWL 1KGCE 5KSVA 1A7NH 3IFPA 4KVNL 5EZJB 2GJZB 4PRDA 4MCYB 3U46B 4PRDB 3S35L 3TBVA 2D03L 5I8EA 2HJFB 2NXYC 4R7DB 4G7YL 1GC1C 3BKCH 2IANE 1RZ8A 1TNMA 1A9BA 5DYOA 4P9MH 2IAMD 5D1ZA 3C6LB 3F7VA 2CLZB 1KCRH 4PJHB 5KSBA 5MEOB 2YPLD 2AEPH 4OUUA 3O6KL 3D3VB 1PAMA 3ZSTA 4GRLB 4LDOB 1CVRA 3RDTC 1N5YH 2Z8SA 3MFGB 4PV8B 1YNKH 3BD5A 1XCQA 3O11B 2VXSL 2FEEI 2E7BA 4Y2DA 4DGVL 4LAQL 4N0UE 3V7AE 4LLYB 5K9KB 2YMXH 3GSRA 5F72S 2HTLD 5GJTH 4WI5A 2A9NH 2GJ6A 4RDQG 2OR9H 5JXAL 3UBXA 4U6XB 1BQHA 3D2UA 4FHBD 4D9QD 3TWCH 5DJDA 2UZIH 4YHIB 3EYVB 4XPGL 4YHIA 2ARJQ 1CXFA 5CZVH 4TRPH 3P4OB 4MXVE 2IPUK 3WDJA 1MF2H 3P73A 1D9KB 5GGSY 2YC1A 3W39A 3D6GA 2BVQB 2YSSA 4K9EL 4NRYA 3GMNA 1RZJC 3QFJB 5CILL 2OTWA 1A7OL 1XGYL 1CDBA 2LAAA 4KI5F 2F74B 3QQ9D 5E00B 3WNKA 1AGCA 2NXYD 5C09B 1IGMH 4KRPC 4JR9H 5F89A 2EDWA 4UIMA 3Q2CA 3FO1B 1ZT1B 3BO8A 1KCKA 1S9XB 1JJUA 5T1KD 1ONQB 3P77A 5HYFA 1AHWA 5E1HB 1CLCA 1F2XK 4XXDA 2IAMC 3MRRA 1JHKH 4F9LA 1PJ9A 4DKEH 4YIQB 3MXVH 1WF5A 2JJTC 5HHMB 2UZYB 1CFSA 4S0SD 1CL7I 4FXKB 3KPRD 4QHNB 5I66B 1MIEH 3C09C 3VWJB 1TLKA 5AWNH 3FOLB 5I76B 2JB5H 1A4JB 1QFUH 3I84A 4C59B 5B4MD 2HTLC 3MUJA 1OW0C 2EE6A 4H0HB 4TRPL 5MENB 5JPMB 4Z77B 3OR6A 4MWFB 4U3HA 5EN2B 1UCBL 1YN6B 3HCVB 4TOYH 5D1QB 5E99H 1JPFB 3JV6A 3LEYH 3AREC 4EUPA 3C9NB 1BIIB 2FHFA 2VLMD 3Q3GA 3MJGX 4IRSA 6FABH 5JW4R 4XMLL 4KTYA 4JQVC 5FUOH 4APQD 1MPAH 2FGWL 2YZ1A 1DBAH 5ETUA 5GGRY 3MRFB 3VD3A 4LSSL 4X5XA 4XBGA 4I0KA 5DURB 3GBNL 4UIKH 3T08A 3AU1B 5MP6H 4OZ4B 4O9HL 3PXJA 4NUGH 1J8HE 1S9WB 4XWGL 5HHOB 2KZ1B 3HMWL 1DUZB 3MA7B 4FQCH 1P9MC 5I1GL 1VADA 5BO1H 4LBEA 4LSVL 3F7YA 4PJCF 3QUXA 1DQQB 1K2DB 1DQQA 4KRPD 1EZVY 1JZ4A 3A6BL 4GRWF 1VENA 3DVNA 2DWEB 4HXBH 1A4KA 5C0NC 3P4LA 3BKCL 4JFZH 5E1AB 3KPMB 1NBVL 3QRFM 2NLJA 4I77H 1X5IA 1QRNA 3IXTA 2IPKA 4G8FB 4DOHE 3BZEA 1MFAH 3PP4L 3DWTA 4EBQH 2ZUQB 2XWBA 3BSZH 5F9JA 3MOBH 3EAKA 5D1QA 5F7KC 2FEDC 4QHKI 1P4LA 4DK6A 1E4JA 4HUXB 4PLNC 1CFNB 3BPNC 5C08E 5L2KD 3HUJB 2FATL 2NZ9C 4GG8B 5LCVH 5F9DC 5DGRA 2GKIA 2ATPB 3ZKNC 1MJUH 5TQ2L 4CAGA 3ARED 2AS5M 5FM8A 4MNHB 4OLXL 1BWWA 5HJ3B 4NQUA 1M05B 1WFTA 1B0GB 4APQC 1PKQE 3EW3B 5C92A 4QTHB 5C86A 1XF5B 3RWHB 5HHPB 3CFJA 4GW5A 1MRCL 1XH3B 2HWZH 4R7NA 2DJSA 2A6KA 2B4CH 4LRIC 5F7MC 4N8VB 3WFBL 3BKJH 3GGWB 5GPRA 2VERN 4N0CD 4ZUSB 3H7LA 2DM7A 2Y9RT 3WS3A 4Y19E 5I17A 3MJ7A 1P7QB 5F96L 4HJJH 4EDXA 1A9EA 3RWEA 1JZ7A 2HFEA 4G6ML 1G7IA 4Z7VE 5KSAC 1RURH 5KVDL 4GKSA 3QXDB 1XCTB 3D69B 1EO7A 4G6AD 2R69L 4TUKH 4Z7NE 1LO3L 2C3GA 2FATH 4KDTA 4BSJA 1YMMD 1KYOJ 1L9MA 4Y2DC 4DEPC 4PGEA 3HB3C 4EOWH 5GS0H 1MFDH 4WHYH 4FFZH 1NMBL 4N1HB 4NKOA 5CJOH 2AERT 5EULV 3O3DA 4UQ2B 5EOCJ 5MHSE 3I6KB 4GAYB 5DD3L 1S7UB 3PWVB 3VXNA 4BSWA 3AS3A 3VXOB 1FV1B 3K8MA 4D3CH 4R7NB 5DHXB 4QY8A 2J2ZA 4TULL 1EXUB 2LTQC 3PHQB 4JM2D 4ODXA 1O7SA 1XF4B 1TDQA 4ZUSA 5LWYH 5K93A 5GQBA 1MLCA 4OB5L 4H8WH 4PG9B 3SGEH 1EGJA 1AD0B 1BQUA 2DLEA 4NHCL 1G9MC 1A1NA 5DT1L 1FZJB 2VLJA 4LCWA 3HMWH 3HAEA 4EN3A 1T6WA 3EYUL 4QCIB 2NW2A 4G6JL 2AV1A 5DJZA 2GK2A 1FYTE 4N0CC 3IDYB 3TCLB 1QNZL 3MBXL 2DLGA 1D5BA 3MROA 4JFED 5DMGD 2R1YA 2C4XA 3WIHL 2EC8A 4X6DE 4HK0A 4HULB 1D3CA 2VC2L 3BRFA 3VI3F 2D0HA 3D39B 3R1GL 4CKVX 5I71C 1GYAA 1Q1JL 2E9WA 1WIOA 1PW3A 1X4XA 4MA8L 2P5WB 2SEBA 4LPWA 4UMGA 4YGVB 4G6AC 5KW9H 3AAZB 1J0KA 32C2B 3MOQA 2UZXB 1I3UA 32C2A 3QRGH 4Y2DD 3D9AH 2ADIA 5EU4B 2NMSA 4ODVH 4UB0L 4ZO9A 5JDSB 2R29L 3JWDH 3CMOL 3LKPA 1F13A 4HK3J 1FV1A 3SDYH 2O5XH 4MQSB 2Z35B 2J8UA 4J2XA 4KTEH 2R29H 4FS0A 3SKMB 1RMFH 4DKEL 2E6QA 3VFVA 4C83B 4R96B 4QRQA 5DLMH 3WO4B 2H32H 4K07A 3V5KB 4P46C 3VXTA 3RVVD 2FLBT 4GBXA 3PWUA 3CFKB 3ARYA 5EA0L 4JM2C 1FFOB 1LE9A 5GGVL 1MCKA 1NCBL 3BZ4B 1JGDB 2FIKB 3FQRA 4GRMA 1K4DA 4RGND 5C0IB 3B9DA 3U83A 3WKMH 4MA3B 1X7QB 2BP3A 3ZDXE 5B3JF 4OZHF 4K3DH 1WWBX 3FRPA 4CDHA 3EO1A 1B4RA 4KGLA 2WWKT 1ZVHA 3NFPA 3L3GA 2BY1A 2P5WA 2SEBB 3C87A 2F8OA 5ESAB 4R26H 3NVQA 2YKLL 5IR1B 3KLSA 4XP5H 4LEXH 2Q76B 4PJCE 4OI8A 1B6DA 3S36X 5CZVL 3KWWA 2CJUH 3BGFB 4PJEE 4RQQB 2J1KA 5FHAH 3JV0A 4IHOB 4P23A 4RBPH 1CD1B 3VA6A 3VFOB 2YOCA 2E7MA 1JPTH 2P7TB 3SE9H 2IFFH 2ORBL 1GC1H 1CGUA 1S5IL 3IFNL 3MNVA 4BFIB 1BQSA 2E8ZA 2R69H 4V2CB 4NSKB 4PJ8C 5EO9A 4P2OC 5GS0L 3S3PA 2D31A 3TC9A 2A77H 1BAFH 4RISL 4BK5A 5DJAA 1X3DA 2ZCHH 1OTUC 5HHNB 1NMAH 1IGTA 5HHNA 3OJDA 2QR0B 1B0RA 4HBCL 1QSZA 3JWNC 4FQJL 1E6JH 3C5JA 3VRLE 4XNYL 5FKAA 1F4XL 3MLSH 1WISA 5IVOA 2BSTB 5BJTA 1YYMH 2WBWB 5ERWA 3L3GB 1RHHB 1KJ2B 2OL3H 2CO6B 3FTGA 4Z7WE 3P3YA 1MVUA 3LKOA 2ERJB 3MNZB 4HJJL 4LRIA 5AYUL 5IMKB 4JFHE 3THMH 5GS2H 1Z6JT 1UKSA 3KYOA 4XNUL 2J88L 3ARGA 4HC1L 4Q7DA 5AYUH 1QYGH 3N9GH 1U8LB 3C08H 4R4FL 3AY4C 3QXWA 4JO4L 1QR1A 1S7VB 4W68A 1YNTB 4MJ6A 5GRWA 5HDQL 2P5EA 1J05A 2AK4B 4FQXB 3VXPA 1ORQB 2EH7L 4PJAA 3BJ91 3Q5TA 1S9KC 3HNSL 2NXZD 5JORA 1X4ZA 3JV5A 4JGUA 4ELMA 1TZHB 1FG9C 5BRZD 2AW2A 4IDJH 5SWZD 1KIPB 1JHTB 3QIBB 1PDKA 4K3EH 4NKOB 5D7LB 3C5ZA 4LDLB 1ADQA 4OFYA 4FQQB 5D7LA 3QI9B 3G6DH 3KPSA 3T4YA 1ZVSA 2Y5EA 4PJ8D 1NBVH 1YC8A 4P2OD 3WFCH 5HYQB 1CXKA 1UA6H 1G9NH 4X6EB 3IT8D 3TNMB 2BC4B 4OSUH 3O6ML 1OTUD 3WE6B 4HHAA 3IDIB 5AAWA 4Q2ZA 1SEBB 3WFZA 5CUSL 1YZZA 3U9PL 1KCLA 1V7ML 2FCBA 1RZ7H 3T04D 4APQA 1N2RA 5I75C 1IM3B 5IHUL 1QVOB 3DRQA 5J12B 4M3KB 1I3RA 1FZJA 2VLJB 3VXMB 2OCFD 1JRHL 3SDDA 2JKXA 5DQJB 4BH7A 5FFLA 3V6ZA 3SHSA 5KSVB 4AMKL 2BMKA 4HWBA 5IVXE 4JRYB 4JB9L 1D9KA 1P7HL 1TPXB 4XB8A 1E27B 5EO0B 1E6OH 2PW1B 1ITBB 2IMNA 4KROD 4NUGL 2K1MA 4HC1A 2IBZY 3WLBA 1XGPB 4Y1AA 5D7JB 3QZWG 1IMHC 5DD1L 1JL8A 2X41A 4NQXA 2ZUWA 4CL7A 3RTQA 4DKAA 2ATKA 5E6YA 3P0GB 4I2XE 3NCCB 3MUY1 1C08B 4IOFD 4TVPD 4Y2DB 3LS4L 4ONFH 2D7OA 3RWGB 4U3XA 5ESVB 5EBWB 5GRVK 4HFWB 3CSYA 3JV4B 3VDBA 3BP5A 2UYLA 3BP5B 5HGHB 2VXUL 4YGAB 3QRGL 2AEWA 2VAJA 4IRZL 1BQHB 3D2UB 3N1PC 3X3GH 2DI7A 4WI2A 5DUPH 4RMSA 2C7UB 3ULUH 2P5WD 4HK3N 3IFOB 4I13B 5IIEA 2EH8L 4PLKC 1KCSH 3T65A 4BELD 1WVZA 3T0EA 1LDPL 1KGCD 2IQ9H 4HH9A 3CAFA 4OQTH 1CFQB 3MJ9A 2XZAL 5GRZA 2IANB 3T4AB 1FLRH 3OL2A 3O3AA 5HDLA 3GUTA 4U1JA 2IG2H 5T1LA 5EOQH 1P2CB 5GS1B 1T4KB 3MRFA 5IB4A 4KZDL 1J1OH 1E4XL 2WMPA 4F15B 5B3NA 3MLVL 1NLBH 3B83A 4GRLC 2QQKL 3ALXA 3RL1A 4QF1A 1IGYA 1GH7A 2JK5A 1Z0MA 1BM3L 4OB5H 4PY8I 4C4KO 1RJZA 4HKBA 4WGWB 1XF2A 2ZUUA 3WUWG 4LHJB 3TVMB 3HAEH 3MLXH 1EHAA 4MD4A 4KK8D 5D1XA 5DK2B 1MF2L 1TQBC 3RZCA 1Q9KB 3VFOA 5I1LB 3U4BH 3TBWA 1IGJA 1KFAH 1OAXL 4OLWL 3RKPA 3QDME 3KYKL 3LV3A 1MIML 2OR9L 4Y1AE 5CZXC 3P4NB 3VFTA 2ADGB 1F00I 3WFHB 3ET9F 4PJHA 3GNML 1L0XA 2B7DT 1CDJA 4LASL 4P2OA 4W6YB 4LSRH 2DQTL 3P9MA 4QHMA 3OZ9L 1A6UL 2X4TB 4LDEB 1RZJH 3UPCA 4QWWD 4A6YL 1RIHH 1ACYL 3IU4L 1I1AC 5T5NG 3VD4A 4PLKD 5CINL 3SGKA 2QHRL 1CFVH 3MRLB 3NZHH 5FYKL 2R4RL 1VFAA 3FN0H 1ETZB 3OKDB 5ECJE 2M2DA 3BKMH 3JTSA 4K55A 4P9ML 3RBSA 3VFWA 4LSUH 2FO4A 1BFSA 3LZFL 5I15H 4ZNEA 4UU9B 3D0VA 3NAAH 1IAKB 4PFEA 5T1MB 4CVZA 4U1KA 3F5WA 4IDJL 2R1XA 4YR6B 4YK4C 2OMBA 3LMJH 1F6LL 3V5DB 1OCWH 1J1PL 4JHWH 1S5HA 3L5WA 3CZJA 1NDMA 1C1EL 2AK4D 5DDHA 4KJQD 3IDJB 3FT2A 5D7JD 5T3XD 2R0KL 2W38A 3BD4A 3VH8B 4BK4A 4RA3A 5I17B 4KK8C 4PJDB 3N85L 4R0LA 3V6BR 1HH6B 2B1AH 3S97C 3VFTB 1G9MH 3D18B 1IBGH 3T77A 5F1KC 2J88H 4XNUH 1NC4D 5LCVL 3P4MA 5JXED 5CGMA 5CKGA 5CZXD 1P4LB 4YNYB 1FNEB 5MERA 4G8GD 4F9PA 5EUOF 5GGVY 2ARWA 2AJ3A 1I8LC 4HD9A 4N90D 2CK0L 1FFPB 4HC1H 4P5TA 3H9YA 5ADPH 2VDQL 1CFSB 5E6ID 1CU4L 5KOVC 1DQDH 5M95B 1F02I 2FB4H 4L4VB 1V3KA 2HN7A 5IBLD 1R0AL 4JFDB 2WQ8A 4OAWB 3FN0L 3NIDF 2Z31B 5HI3C 3F62A 1QRNE 5E8EA 5GZNC 2AABH 2EE3A 1PY9A 1OP3K 3QB7C 3VFMB 5K9QI 3KYMA 1C12B 2A6DA 2XKSA 3UJTL 3TO4C 4C56D 3ZT7A 4NQVA 4DGIL 2EYTB 1FZMA 4WI7A 3FT2B 4OZIF 1QKZH 3ARGC 3VFVB 5IBUB 4NJAH 1C8PA 2EIEA 2PYFB 2J7LA 4P5KB 4RGNE 3ZKXB 2XA8H 1FHGA 3X14B 3VW3H 4OGYH 3U7YL 4JPKH 2I24N 3AUVA 1KENL 1N64L 5DXWA 1X6NA 4GRMB 3UTSB 3SDAA 1ZHLB 3AC0A 5M94B 3AS1A 4HPOL 5F97E 3BWUC 1X9QA 4NO2A 2YPVH 1CWVA 5EOCH 4ONGH 4TPRH 2CDGA 2OJZL 4QRRE 2F19H 5EBGA 2QHLA 1MRFL 1NC2A 5IR1A 1I1YA 3BIBX 2DQJH 3TT3L 4FFWD 1WTLA 4PP2B 5E8EB 1JN6B 4DTGH 4JHAL 3T1WA 3D3VD 4PJ5E 3RUGA 3DXAA 5IBLC 4OQTL 4HV8A 4XB7A 4YBHA 1QBLL 3G04A 3CLEL 1CGSL 1U8PA 3ZHDA 4G8EA 1MI5A 1FZMB 3F65A 3Q3GB 1FC2D 1KTRL 1NJ9B 5BRZE 1K6QL 1BEYL 4PG9A 3HA0A 1HN1A 2X1QA 1U93A 5GS1A 4ELKB 3ULVE 4MJ4A 2ESVA 1NFIA 4FQ2L 3RNQA 1EDQA 4ENEC 3HG1D 5JPNB 1WICA 3RKDD 3CSGA 1F90H 1HOCB 1V3LA 3NH7L 4OZFB 3ARGD 1QSEB 4UNTA 5IMMA 1SM3H 4PG2C 2FL5B 3BEVA 4MD4B 4RRPA 4M5ZL 4J6RL 5EORL 2JF1A 4AIZB 3IGAA 4H0GA 3KPPA 2UWEE 3ALWA 4RIRB 1H15A 3MXWL 1GGUA 3SDCC 3CDYA 5H8DA 1KCUH 1R3IH 3GM0A 3ARFC 4HAGA 4GXVH 4KAQH 4HWBL 1MCQA 3MUGB 1R3JA 1LWRA 3K3QA 2IAMA 4RMTA 2VITB 3OAZK 1B2WL 1KUMA 2A6JA 1L6XA 5I1JH 1KOAA 4K23L 2WAHA 4Z7NF 3M45A 4RAVB 4NZRL 1LEGB 3BUTA 4UQ3B 4JB9H 2X2YA 3QNZB 3VXSA 4M1GH 1U93B 4YHYB 1W0YT 4IJ3B 3UTZB 4H25A 5K59E 1ETZA 4FG6C 4C57C 3QT2A 4YHPB 5IHZB 1T66C 2XQYG 4YXKH 4PTUA 1M7XA 2PYEB 4NO0D 5F7DB 4IRSC 3F5WB 1DR9A 4ORGA 4PYGA 4KK6D 4PRIA 3BI9X 4X9GA 3PJSB 2GAZA 3C60B 1RJYB 2NTFA 3SKOA 1ZVYA 3B9KB 1A7RL 5IW6A 3BW9A 3H9ZA 1HWGB 1MFDL 4Q6IB 5F7EH 3N1MC 1BZ7B 1XR9A 2VDML 4GG6E 5IBTL 3X3FH 4LCCA 2BNRA 1LK2B 3NFSH 1G6RL 3HLAA 4G42A 3V0VB 2NR6D 4AQ1B 4F7PB 3S37H 3LEVL 5EBLA 3V0VA 15C8L 2AGJH 1UWXK 5DA0B 5HGAA 4X8XA 4CUCA 4R8WL 1G6VK 3IAGC 2GFBA 1NAMA 1L4IA 3KXFE 4PUBL 1UQSA 4Q6YA 5MI0B 1UVQB 1UQSB 2EICA 3B2UD 3OTTA 2D31B 3NIGE 3VGAC 1FSKB 2A1WH 3D3VA 1VFOA 4MJ2A 3ZYIA 5KS9A 1C5BH 1LO5B 2BOCB 4FG6D 4N8CL 3UZVB 4XBPB 2ZUVA 3RIFK 4BM7A 5FO7A 3B4NA 4IM8A 3VXRE 3NFSL 5C0EA 3FHAA 2MTPA 3D85A 3LKOB 4IRSD 4YC2C 3AROA 2C5DC 5IV2A 4YPGB 1LEKB 1MCOL 4AEFA 4HFUL 4ZMAT 4J3SA 4HIEA 1XMWA 3WN5A 1YN7A 4HIEB 4XBEH 1QACA 4F57H 4WCYL 2FRGP 1YNTA 3ZTNL 2VDRH 4ERSL 4ZUWA 3O8XB 1RIUL 1MWAL 4XVUC 2BVQA 1BBJB 4FFYH 4N9GB 4P49A 3EFDL 2QHRH 4M43L 2VLKB 4PV9A 5I30L 3SCMB 5C0BA 5HGGS 4DVRL 1XGPA 4Y1AB 5KSAA 1XZ0B 3RL2B 5KSBB 5MEOA 4UT7L 3AFLA 1F3JB 3MCKA 4GQPH 4PJEB 4XWGH 3O8XD 1FGVL 3TNNB 1NBZA 5EUOE 4DOHB 1HNGA 3VXSD 1YYLH 4OKDA 1EBPA 1IAIH 3GSOA 4JY5L 1DBKH 5BZWA 3VE0A 3VFSB 2QBWA 4DZBB 4ODWA 4FNLH 2DKSA 2QEJA 3HMXL 5DWUL 3NN8B 3HUJE 4UAOC 1HCVA 1OAKH 1G7PB 2MPAH 3GBNH 3GSUB 3BT2H 3MNWB 5GSRA 1WFOA 4YDLB 2DTMH 5KVEL 1VB9A 4J3TA 1FNFA 1I3GL 3BD3A 3GI8H 5E0QA 3MXWH 1MCBA 1WCBB 1K4DB 3FB7B 3ARSA 5IESH 1JPFA 3GKWH 4N9GA 2BSRB 1IKFH 5H37G 1HYSD 2HFFA 3NFPB 3WO3B 2YRPA 1XF3A 1V3MA 5T3XH 5EU7E 1KBGH 4XVUD 5T1KB 4GW4A 4MNQB 3C8KB 3SDCA 2WWKO 5FV2A 2IQAA 2IAMB 3UJJL 5AAMA 4HJGA 2XTLA 3RWFB 2VC2H 1OT1A 1BHGA 3PQYB 4DVBB 1ZANL 2AK4E 1W72A 2G75B 4WI3A 5EZLA 2K7QA 2JJSA 2ZUQC 2ZSVB 3CUPB 2N7AA 1UWGL 3O8XC 2OM5A 43CAB 1Y6NR 1FRGH 3TT3H 4XNXH 4ZG1A 3VMOA 3DBXA 1U42A 3SJVB 1BWMA 1TZHA 1IT9H 3SN6N 3SJVA 4A6YA 1LQSR 2P8LB 1YQVH 5IWLC 5HBBA 4LQ1A 3REVA 3BIAX 4XPGH 3L7FB 1MFEL 2RAMA 2VTFA 1MOEA 4N8PA 3NCEB 3O41B 4UT9L 2ZCLL 1MCSA 5KVGH 5F7UA 1EPFA 3QEQB 5GGTH 4E42A 3DLQR 5FUCE 3WLWC 4QYOB 5T3ZE 3BHBA 4GBXC 4PJGB 1MJJA 5FHBH 2R0LL 1FVDB 1Y6MR 5C0CD 2NY4C 1QFWM 1TQBB 4XBGB 2X4OA 1N0XL 2R0ZH 4NZUH 2R8SH 3UBXB 2G5RA 2A73B 2H1PL 1O7VA 1W0VA 1XR9B 5HJ3A 5EZOL 5BV7L 3O6KH 4HPYH 4GXUN 2EXWD 2V2XB 2N7BA 2NZIA 2VXTH 1PYWA 4MLIA 1DVFB 3LKQB 1MHHA 3U7AA 4X6DB 3WYRA 1BJ1H 2FBJL 3K74B 3WUWA 5BS0B 5C0GB 4DW2L 4NC2B 2DD8L 5IQ9B 2OQJB 1U36A 3LKSB 3G6DL 3IETB 4OLEA 1H0DA 4KWUA 5IW3A 5HGBB 3WFBH 2P5EE 3QAZC 4PY7B 3SE3C 3GJFB 1KIRB 1WAAA 4HIJA 3WHXA 2O5ZH 4I48B 2QKIA 1QFHA 2NX5E 2VDNH 3MUZ1 1MQKH 4KDVA 1KEGL 2E9BA 3QUYC 3HI6L 5J1AB 2NNAB 1MAML 3GSQB 3B5GA 4M43H 5H2BB 1W0WB 3JTSB 1Q8MA 3O81A 4F7TB 3ILPB 3WLWD 4HWZA 2BVEA 1IQDA 3HG1A 1YJDC 2YA2A 3ZKQD 3LB6C 1EO8H 4WEBH 5JHLH 1KACB 1KELH 4K7PY 4YR6A 2Q8AH 2XXMB 3TIDB 3C2AH 3P73B 1ITCA 4ZUWB 4G5ZH 5AZ2H 4XPAH 4YZFE 5FK9B 4HS8L 5D5MA 4DKDC 3MOBL 4QOKD 1KJ3H 3SO3C 3C9NA 1MFBL 2VDKL 3GHEH 2EXWC 3QDMB 3KHQA 5F9AC 1UWEL 1YEGL 2IJ0C 1RV6X 3L3KA 5FIEA 1IC5L 2KQMA 1LE5B 1PQZB 4YDVA 5IVNA 2EIBA 3VFRA 4PJCB 4F15C 1MEXL 2DAVA 2JK5B 4PRBB 4L4VD 5E4IA 3U4EA 2ITDB 3EFFA 4G6KH 5JUEH 1AC6A 4XP4L 2Z93A 4M9PA 3LN5B 1R5WA 1A6UH 3OKEA 2EEDA 4ETYA 3SJVD 1FVCB 3NPSC 5BRZA 4Y5YC 2AKRB 1A7BA 1JGEB 1FH5L 2XPGB 3OGCA 1AQKH 3FB5B 3C5ZD 5IB3B 3LQMA 2C3VB 1JGLL 1KTLA 1TNNA 4LSTH 5IIEB 2NY6B 2ZUTA 3WIFA 3BZEB 1RZFL 3QIWA 1I4FA 4NO5A 4F8TA 4S2SA 3UXFA 5A2KH 2YA0A 4UT9H 3BMVA 1C7TA 1U3JA 1ADQH 2CQVA 5EC2B 1NGXA 4NRYB 3OKLA 1I1CA 2IGFH 2H2SD 1GIGL 2YEZA 2LU7A 5DVOA 2C1OA 4WO4C 5KSUA 2OYPA 3V52L 5IB4B 1IC1A 4H25B 3OKKB 1YEFL 3AU1A 5FYLE 4GW4B 4MNQA 1FFOA 4G3YH 3HI5H 4PJCA 3BRDA 1LE9B 3DMMD 1WT5A 3DX8B 4LPYA 1JNLH 1H3VA 2PTVA 4KV5E 4B53A 2UVEA 2R1YB 4NP4L 2Z8WC 1HDMA 5HDOA 4MS8D 5FYJU 3BUYA 4HUWA 3PUCA 4WWID 4DQOL 2X10A 1K9TA 5GGSA 1Q9KA 3SDXE 2YK1H 3GSXA 2GK0A 2J12B 2EH8H 1NGQH 5D1XC 1JGVL 1HWHB 2WWMD 4PGCB 3BPCB 3FOLA 5I76A 3Q6FB 5DSCB 3TVMD 1JN6A 1MHPH 5FA3B 5IT2L 3MGTA 1EFXB 4N0YL 4Z77A 3CVIL 3QIWB 2VL4A 1YPZA 2V5RA 3MJ8A 4P3CL 1BQLL 3CNKA 1I9IH 1V5JA 3ORJA 4GG8A 4QXUH 5HHXL 4C56E 4R2GC 5MEQA 4HUVB 1NBQA 2EC9U 1R6VA 4ZPTA 3RNQB 3RU8H 4X4MA 2R15A 1I8MA 1ZTXH 4JFOB 1A6WL 4G9FD 3GSNH 4G6JH 1IGTB 3H3PL 1M05A 2YMXL 4M6ML 3IDXL 5MEPB 4LLAA 3DXAE 1NCUA 1VGEL 5E2UL 2PXYA 2DM2A 3E8UH 3ROOB 3LPFA 4PRIB 1Z9SA 1T5WA 3LKQA 3QDAA 1G6RA 2FJFA 3E3QC 3V8CA 5CKAA 2VZUA 2ZWLT 3O3EA 4D3CL 3BW9B 4HS6B 4KRNA 4WV1B 4MS8C 3BN9D 4PJ9D 1AI1H 2FEEL 3VI4E 4U1SB 4EN3B 2D7PA 4OGXL 4ZPVB 5TPWH 4NNYB 5JA8B 5D1XD 3OG4B 1DP0A 5F1IA 3ARDB 4N9OB 3MLYL 2LTQB 3G5XB 3Q6GH 4PY7A 3K2UL 1JUFA 3M1BA 4G6FB 3IVKA 4JO1H 4AG4L 5I16B 1ZHBA 4AM0B 4LCIL 4X9BA 5JIKA 5IOPB 3UTQA 1YEDA 4YHKL 5LGKA 2YUWA 4EIGB 1HNFA 1FFPA 4RX4D 4K3EL 2A2QT 4IRJD 1UJ3C 1RURL 1Y18B 5I6XB 2FJGB 5KS9B 3QHFL 4D0CB 4F58H 4OIIL 3PABA 1P4BL 1LVEA 1FH5H 1U9KA 2AQ3A 1CXIA 1FJ1A 3Q5OA 3WE6A 2EYRB 3LDBC 3SY0A 3QJFB 2B2XL 4JKMA 5HVFB 3TJHD 4P59H 5SWSA 3GHBL 5SWSB 1XEDA 2X42A 5GGTA 5SV3A 5AEAA 3DPBA 5DQJA 3LSOB 2F58L 4WW2A 5JPNA 1A3LH 4NO3A 4AIOA 15C8H 2YPLB 4PJ9C 3HS0A 1RK0A 2FB4L 1CG9B 3F6IA 3HE7A 1YEGH 1PG7W 4JZOA 5INCB 5SX4I 1VKXA 1BX2B 5ADPL 5GSVB 3ZZ1A 3EUUA 4KRPB 3QEHA 1J11A 2HKHL 1U8IB 3U0TA 4ZQKB 4X4YA 1JGEA 2XPGA 1YNLH 4UILH 4EI5B 5BW7C 5GISL 5D7IA 3VI3E 3U0PB 2PYEE 3IFNH 2B2XH 2ADJA 4IRJC 3QEQE 8FABA 4QY8B 3LD8C 4UQ3A 4Y7MA 4ONHB 2GSIA 5FHAL 1A02N 4X0KB 2J5LB 4LEOB 2IBGA 2FR4A 3QHFH 4JVWA 4L8BA 1JTOA 2EO9A 2O5ZL 1Q9WB 4KJYA 2WK2A 3IDNB 3FT4B 4WO4A 3CH1A 5HYJB 4OM1L 4FZEH 3CLFL 3MGOA 3TJHC 1MCEA 3F8UB 3MGOB 1KN2H 3S35X 2DB8A 2PR4L 5C07D 2APWA 2ARJA 2NX5D 2I07B 1WT5C 3CDCA 5IEKA 5DZOA 1OT2A 2FL5A 3BEVB 2I5YL 4PV9B 2VE6A 2ADFH 2GHWB 2Q7YB 3GUTB 3UMTA 2NY7L 3NZHL 3GMRB 1QR4A 4LCYB 3KXFB 1CDHA 3M07A 5EUKB 4QT5A 3VFPB 3ZE1F 4GXVL 4Q9RH 3TBSA 1B0WA 3VMPA 4BA8A 5DLML 5JIPA 2XN9B 1QUNA 1EVTC 2V2WA 2J6EL 5J9PA 2A6IA 3P0VL 5FOBB 2B1HL 4M5ZH 1I8KB 1QR1B 2IEPA 4B7LA 3WXWL 2DKUA 3QUMH 4KFZC 1IC7H 3IJHB 1W72B 1EFXD 1A6AB 4P2QB 5HY9A 3VXRA 5I9QB 2R0LH 4Y19D 1TVBA 2VO5A 2VDLL 4JZNA 2AI0L 5MEQB 4HUVA 3EO9L 3KR3L 5JW4N 1E4XI 4JREB 4YHLL 4OKVB 1KIPA 4YDKH 4OCYH 2VKXA 3WFHA 2NYYD 1BLNB 2OL3B 1TCRB 3BDYL 1BZ9B 2Q86A 1LP9A 1FE8L 3BZFA 5FCUL 1NUGA 1K85A 4OT1L 4DTGL 1A3RL 2VLKE 5JMOC 1WBZA 3DRTB 1MRDH 2OLDA 4L3AA 5ESQA 5ANME 4PBVC 2OMNA 1AGFA 4CN1A 4E5XA 1U2HA 2JCCB 1D6VL 3ALPA 3VFNA 2WBJB 3L5XL 3DSFH 2A6IB 1UM6H 1IQDB 3HG1B 3KG5A 4QOKE 2DM4A 5EZJA 5IW1B 3BKYL 3WV0A 3QQ9C 4YFDB 2NW3B 3LHPH 3QHTC 4F7EA 3MRJB 1PG7X 5F88A 4JJ5A 4Z7WA 4PJIA 5T5NF 5HDBF 3UEZA 1JE6A 4CNIA 2YD5A 4RWYL 4CNIB 1U6AH 4JG0L 3KPQA 2GFBB 5E94A 1A5FH 5KJRH 4N0RA 4YX2L 3V6FA 4MNGE 3TJEL 1XZ0A 2Y5TA 3Q0HA 1XGRB 4L3EE 1BPVA 5J56B 2OP4H 3GSNA 1UYWH 1LO3H 4NKMA 4KGJA 3D69A 2DLTA 4ZAKC 5C71A 3VH8G 2IGFL 5DI8A 2LU4A 3TESA 1ULVA 1FNSL 5IMOA 4RGMB 2NYYC 3NMEA 2XTJB 2F5AH 1X5AA 3NN8A 2QSVA 4JY5H 5C09E 3GMMB 5C6TH 5E7FA 3B5HA 1HXMB 3H9HB 4ODTH 2KPNA 2W92A 5E8NB 1BBDL 4HW6A 3JXAA 5DHVH 1F4YL 4LMQE 4GAJL 4UT7H 2CPCA 5C2BH 5FB8A 4X7TA 4I18C 3BVNB 4NO0B 4P3DB 4ZO7A 5B3JE 1QP1A 2I9TB 4KTDH 2C1PB 3GBMH 3O6LH 2VH5L 1EXUA 4XX1G 4X6DA 5LGHL 5ITFA 3FFCA 1IGCH 1RQ5A 3SCMA 3O6MH 2X44D 1YMMB 2DYPB 4Z0XB 5JR1H 4I3SL 3WFCL 1KC5L 2GTWB 3T8XA 2CR3A 4QNPF 1BMGA 3DVFA 2UWEF 3T3PE 4JFFD 1S9XA 1J0YA 2X4SA 3NCJL 4FXGB 3UYRL 3AXLB 1BVZA 1HHJA 4BSVB 4HZLB 5IMOB 4GAGL 5C0ND 1ZAGA 4ZTOL 5CWSB 1MLBB 4TVPL 2XZZA 2ZSVA 1RUQH 5FM4A 2ZZUT 5CEXB 2YD8A 4QLRA 1W0WA 4PD4J 2DLIA 5DRWA 1Q72H 4LLMB 5HGHA 1M4KA 1A4KB 2HN7B 5C0CE 4U1NA 1CD0A 2FEDD 2XY1A 2QQNH 3IDNA 1MCWM 1A2YA 5I74B 2Q3ZA 1OSZA 3N9GL 1PD6A 3C6LC 4ZDHB 3STBA 2E6JA 3THML 5FM5M 5ID0B 3B9VA 4J1UB 4XVJH 4PJGE 1IAOA 3MRLA 3WN5C 4G9FE 2ESVB 3NTCH 3MRNB 1TZIB 5MP6L 5E2WL 3OKKA 4N0FA 5J6HA 4KVCH 3ILQC 1DBAL 3A6CL 1CI5A 1KEMH 2GSGB 1RZKC 4R4ND 5EBMA 2ZOKA 2IBBA 1RULL 2R2HA 3MRRB 3QUYB 1CTOA 2NX5B 3F7PC 3RWJB 1FVCA 4Y5VA 5DJ6A 3S9DB 4UUJA 5I66A 4LVHB 3FN9A 2AJYL 5IHBA 5I9QC 1JVKA 3Q6GL 1U41A 1JGUH 2IADA 3DGGB 1A5FL 3EYOA 4M7ZB 4D0BA 5IFHL 3I6GA 4NZUL 4W81A 3WO4C 2HG5B 5TPWL 3U79A 4KKCD 2MMXA 1OD7A 3WSQL 2XWBB 5HGBA 3P9LA 1U8JB 4Z78A 1X4YA 1AXSB 4JN1H 4JM2B 2IQ9L 2X4TA 4U0QB 4OLVH 5D71L 5BXFA 4XI5C 3QEUB 4PJ8B 3WD5H 5HVWA 5SWSE 1V7NH 1LDSA 3ABZA 2M1KA 4F2MA 4Y5XB 1D6VH 1D6EA 2P1YA 3UTTA 2WIIA 3EZ8A 4GRWB 4L5FH 5C3TA 1UB5B 4FQLH 3O0RH 1MAKA 4NQDE 2VN4A 3P11H 5DFVC 3ILQD 1FE8H 1ZHNB 2CGRH 3KR3H 4HT1L 1OB1B 3CDGB 3MV7E 5D1QD 3MNZA 5DRZB 5DMGC 2IADB 3KYOB 1P7QA 4JY6B 3V7AG 5IFAL 3ULSA 4ZOCA 3QG7H 3TM6A 4QHLA 1DVFC 3ZL4H 1NL0H 1L7IL 4KUCF 3RFZC 5A16A 4PV8A 5EU5B 4WUKL 1P84K 1EFQA 1UC6A 4DK3A 1YDPB 4KI1A 1AFVH 4KKCC 4HUMB 1G7QB 1ZHKB 2FIRT 3FQUB 2W9EL 4PRPB 3DYMA 2GEEA 3GI8L 4JFQB 1W72H 2FBOJ 2PTTA 4ZQKA 4XCNB 4MNHA 4Y16C 1P9MA 1HXMA 3QCUH 1I7RB 4PS4L 3O9WC 1J8KA 1UADC 4RMWA 5D7IF 3D25A 1JZ2A 4ODSH 4TUOA 1NCTA 1S7QB 3EJZC 3OKMB 4JFFA 3X13B 4P46D 3IJSA 4GSDL 1YYLL 1JRHI 4I18A 1DZBA 4RAUB 5TDOB 3GGWA 1DBJL 4BH8B 1FGVH 2P5WE 3L7EB 3FFCB 4U1HB 3VGFA 3ZE0E 1ZLUH 4X6FB 2CIKB 5TDNB 5FYLH 4ZSOA 3KJ4C 5HYSB 1U95B 5D8JH 3UTTE 3VFRB 5D1QC 2YWZA 1OAYL 4KKBC 3T0DA 5GRVL 2ITDA 1VFBB 2PTUA 3MV9A 4MLSA 4WHTB 5KN5B 4NJAL 2FYYA 1SY6L 4JM4L 1TJHH 3HPLB 3L6FB 4JANA 5GSVA 4IS6A 4LLUB 1EJOH 4WCYH 4S11A 5EUKA 5HHOD 5C6PB 2OK0H 5J13B 3V7MA 1ZEAH 4GW1B 1HQ4B 4G9DA 3SBWA 5IB3A 5ALBH 1J88A 1IM9D 1A2YB 5JA9A 1NBZB 5HTSA 2VZTA 4C4KT 2BHUA 1I3VA 2J8OA 2VLJD 4M1CD 4Y16D 4NKDA 4FQJH 3TV3L 2EE2A 4U6HA 4PRIE 3QIWC 5EC2A 5ANMB 3O9WD 4QRRA 4WWKA 1ZWIB 4URTB 2B4CL 5K9OB 1I1AB 3EJZD 4G5ZL 4P5KA 5HHQB 1NFIB 3WMSA 4P0DA 4MSWB 1HHGA 3CPLA 4BYHA 4DEPB 4OD1H 2EDDA 4KQ3L 1G7HA 3MO1A 1INEH 3K7UA 1G1YA 4OLXH 4HX1A 4Z7OF 5FDYA 2Z9TA 1P5VA 4HK0B 1SYSA 2R23A 2MFNA 3FMGH 5B39A 5SWZB 4LRNH 2DLHA 4YK4B 3KXFA 5ESQB 4ZFOA 3OJVC 1ZA3B 3W11D 1NC2B 4Q97A 5JHDA 2ESVD 4NNXA 3CK0H 1F4YH 2EDEA 4PP2A 1EMTL 4KY1L 3MOAL 1MFAL 1KYOK 3PP4H 4EBQL 4NNYA 2HJKA 4M7LT 1A0QL 2G9HB 4Z8FL 2HA1A 2YD7A 1J05B 1FDLH 4OZFH 1EAJA 4OZGF 1ND0A 2GSIB 4M03A 1YMHB 5F6HJ 3MLYH 5E2VH 5J12C 1MY7A 4S1SL 5F88B 4MA7H 4OI7A 1IZJA 4M1CC 1DQJA 2A83B 4JHBA 1VA9A 5E2UH 1SQ2N 4DFIA 3FONB 4OKVA 1JFQL 5CMAA 3QIWD 3OZ9H 4LSRL 4M6MH 5ELIA 2P48B 1JGDA 1JCKA 2VL5B 1PX4A 1EA9C 2WBKA 5ENWA 5F3BB 4HS3B 3HMXA 1F5WA 3BH8B 4WUKH 3U48A 4UTAH 3JWDL 5I1KL 4YFLI 4PJ7A 4NZRH 4Z0BL 1SYVB 2FGWH 2OTPA 3G6AA 1FNLA 1L9NA 3V6OA 1JZ6A 1J18A 1T3FA 5I1AA 4UOJA 1TJIL 2HT3C 3UTOA 2ZJSL 1CL7L 5JHDB 5DD0L 1ZT7B 3LDBB 4JAMB 3V95A 1E4KC 4Y19B 1EHLL 3MLTA 3ARGB 4ZOAA 3AGVA 3MZTA 5TH2B 3Q5YA 3QNXA 5IT2H 1EEYA 5TE7H 4HT1H 3WNOA 1JBJA 5L88H 2O26U 1AXTL 4KROC 4NNPH 3WIHH 4J6RH 4X7TB 5D93B 5EORH 5ISZB 3P11L 1DVFA 5CP7B 3O0RL 2FGZA 3HE7B 4Z6AT 1VACA 1JGVH 1R3HA 3Q48A 2ICEA 3KJ4B 3HHRB 3NH7H 4IOFC 1Q94B 2F74A 3BMWA 1IM9A 5DFTA 1S8DB 1IM9B 4H8WL 3O4LB 3HE6A 4NP4H 3T77B 3TGXA 3WUZA 1JNLL 4AH2A 1I7RA 3NCFB 4K94H 1TENA 5D71H 4XXDB 2DQIH 5F9OH 2JELH 4JN1L 3ULVC 1WITA 3V4UL 2NTFB 5E08L 5I6XC 4O58H 4ODXB 5LXGH 1KB9K 4G3YL 4U6XA 1BZ7A 3NACH 3C2SA 3ILPA 3MLTB 3FL7A 4JHZA 2AJYH 3REWB 4NQSA 2X89D 4WFFD 2XN9E 5KOMC 5C9KA 1MHCA 1B4JH 1NGZA 1LP9F 1OD9A 4QTIH 5HYJE 3CH1B 3BXNA 3UROR 5CZKA 3NZ8B 1TVHA 5I8CB 2YPVL 4L3CB 4XVTL 3HS0B 4L4JA 2BSRA 2VLKA 5H94A 1URLA 1OWRM 1AGDB 2HTKC 3MRBA 4P2RE 2GTZB 1JK8A 4YO0B 1ES0B 4LLWA 5E5RB 4YGVA 5IROC 3BDXA 4NYLA 2CLVB 1HSAA 5MEND 3C8KA 3SDCB 4YHOL 1KB5A 5TE6H 2VYRE 3MV8D 4NC1E 1JRHH 3RVTD 1U8MB 5E6ZA 3TBYB 4YWGL 4RFOH 1ROWA 1I9JL 2V9QA 3CCHB 4TQEH 3SBWC 3H0TA 2Q7NA 4I48A 4CVUA 3H0TB 4Y8DC 3TVMA 1CD9B 2DL2A 4IRJA 1NGWB 5A1AA 1QBBA 2G2RA 3FO0L 4G6KL 1MELA 4DZBA 2ICWB 4RX4A 4LIQH 5I1LA 1NEZA 3OV6A 4PREB 4UT6H 4WI9A 5EDXA 4ZFZB 4UNVA 2QQNL 4C56B 1ZWIA 1T20B 4ZO6A 4M6OL 1HILB 3FB6A 2JLLA 5E4EC 7FABL 1KXTB 4K3GA 4EQ3A 2OK0L 3HRZB 1I1AD 5ID1B 1J8HB 3ESUF 5DD6A 4OIBA 1FPTH 3L7FA 5IM7B 4P5MA 1MCPL 1HH9A 4M7LL 4YHNA 5DJ0A 3PWJA 4H8WC 3F7QA 2AJVH 1DEDA 1FPTL 3MBEC 2ZKHH 2IANA 3T4AA 4LPXA 1CE6A 3Q1SL 4RAHA 4WW2C 1T7YA 4LK4A 3BN3B 2MCPH 4LKXB 5EFIA 2LU3A 3QWRA 4GMSL 2JCCE 2Q76A 1CT8B 4PJ9A 2WBJA 5E8DH 4LIQL 1DUZA 3CC5B 3RX5A 2ZPKH 4KU1A 5D6DA 1F6AB 2X1PA 4KJQC 1MQ8A 2ED8A 1HYRC 2BNRD 2X09A 4PJXE 5C2BL 4ELMF 4K3JL 3TN0A 4JN2B 2VDOH 3RVTC 3GJEB 4PJIB 1GGIH 3PDDA 3HE6D 3KPNB 4Z95L 2HVKB 5C0GA 4KHTH 3CVHH 5JXEC 5KVFH 3HNTH 3V4VH 3JWDC 5C6TL 3CFCL 2C3VA 5C1MB 1SVCP 1NMAL 3HPJB 2APXA 3G5YA 1OGTB 5T33L 5EWIL 1ZGLA 1MY5A 4FABL 3P9MB 1HKLH 3G6JF 4TOYL 3WBDA 3PNWA 4NOFA 4YBLB 2EKSB 3EYQD 5D72L 4M4PA 3MCLH 4O2CB 1FZKA 5JLZA 1T83C 4TNWF 1B4JL 5HI3D 4RFNB 5GZND 1UH4A 1AO7B 4U6VL 2H1PH 3BX7C 1I8MB 4PRAA 5I8OH 3UTTB 2ZCLH 5DZNA 3RUGF 1H3GA 3K1DA 3BDBA 4Y4FA 4OLWH 1IAKA 1I7UB 3R4DA 1V05A 3PWNB 2LFGA 3X13A 1JYNA 3RWJA 5HHVH 4N8VA 4Z7VF 3HZYB 3RZWA 4IMKC 3LOWA 1FRGL 4WTZA 5ACZA 4U4BA 1KNOB 3A67H 1H3XA 1EAPB 5FECA 4BKLA 3WUWB 5C0CA 3KPMA 3E6HB 1MCHA 5C0CB 4PJDA 4AYFA 1M7IB 3CDFA 5BOPA 5CBEA 2GJ6D 4LCWB 5I1JL 1QRNB 3REVB 1EFXA 2XV6B 3MJ6A 3FOMB 3C5ZB 4Q0XL 4DZ8B 1YEKH 1UFUA 3HE6C 4PRBA 3QXDA 5C0DB 1WCQA 4KAQL 1WEJH 3O45B 2EKSA 1FNEA 5MERB 1CL7H 5JW3L 5L88L 2AI0H 4AT6B 1SJHB 5C0FB 5HGDB 4X8JB 4XNMB 4FFWC 1RMFL 4LLUA 1JF6A 3OXRB 4NQTA 4F2MB 4QNPE 2ESVE 5J1AA 2X4OB 3SKJL 3EYQC 4GH7B 4LLMA 3SDYL 1FN4B 4L9DA 3D0LB 1TJGH 1RZKH 2VLJE 1EERB 5GRXG 5TF1H 1FFRA 2MQ3A 3ZHLA 4JFHD 2DQGH 3BFOA 2X4PB 2J6EH 4QTHA 2AXJA 5EH1A 3OHXB 4G43A 4L8DB 2BMKB 1I3GH 3W0WE 4XBPA 3OKOA 5IQ7H 4NPYB 4S1DD 3S34L 4ZD3L 4S1SH 4NQVB 3RKDC 5C0JB 2WW8A 3HMXH 4FQHB 2PYFA 3QUZA 2VABA 1LEKA 2AV7A 3ARDC 1U8HA 4EVNA 5DD1H 5E00A 2DTML 5D96C 5KVFL 4ZNCD 5F7YC 4ZPVA 3KPOB 2BCKB 3MRIB 3DX9B 2VDOL 2DQJL 2RCSH 3SE4C 3ZLQC 4GUPB 4I2XB 1PKQA 3SDCD 5EBMB 1DDHB 3SDAB 3I3DA 1BFVH 1BVKB 4L8SA 4KI5E 2YUZA 4MVBD 3CLFH 1T7VA 3HR5B 1J0HA 4Z7QE 5CJ5A 4M8VA 2XOTA 3OPZL 2Z31A 4PLOB 1Q72L 5CP3A 1HQRB 4X7CC 3MREB 4MHHG 3KLHD 3QNYA 2DIBA 3OB0K 5GISH 4YEEA 4M7ZC 3TP4A 5I73B 3UX9B 3KJ6H 2PO6B 2J8HA 4XNQB 4I9WD 4TSCH 2GIYA 1J0IA 4GAFB 3K4DA 2OSLB 1UCTA 3H2WA 35C8H 4ZXBB 5HYSG 1T66D 2HMIC 3L3JA 3MV7A 1MLCB 1P1ZB 4MXWL 4QRSB 4G8GB 4PJBE 5FGRA 1WTGT 1A1NB 4O5LH 4S1DC 5KVDH 4KKLD 3EYFA 3HC0A 1MEXH 2X05A 3GO1H 1IAIM 1I75A 4KK6C 4PJ9B 4GRWE 4NDMA 1E28A 1OGAA 5FYJD 2HRLA 2ILLA 4WJ5A 3WHE0 1WFNA 1I8LA 5CBAA 3MRCB 5CBAB 3EOBA 1CU4H 1VHPA 2I27N 3LH2H 2ZCKH 3BUYB 4HUWB 3UYPA 4AENB 3TBWB 4LKCB 1AR1C 1H3PH 2C3HA 4GQ9H 1MRCH 1MVUB 2ZNWA 2D2OA 3CFEA 1QLFA 1QO3B 2NR6C 2A9ML 4ODTL 5L6YL 3GHBH 2R0WL 4MVBC 1LMKA 1EJOL 4I0PB 4YJZL 2DI9A 4L4TB 3RP1A 2K3TA 4HXAH 1I4FB 1KCVL 4LHUG 2IF7A 4AK1A 1F8TH 1ND0B 2FJHA 2O61A 3B2UC 5HSFA 1T22B 1ORSB 4QRPA 1YDPA 2QQLH 5HI4D 2VJXA 2H32A 2OP4L 1JI2A 2KUTA 2R1WB 4EN3C 1LEIA 4PRPE 3DO7A 1VFAB 4M5YH 1QOKA 3LEXB 4XP1H 5A2JH 1INQA 5C7XH 3TYGL 2BY3A 2HMID 4NDMB 3I6LE 4JLRA 3BPNB 1XR8B 1EHXA 3UTTD 4HIIB 1OF2B 1U3HA 2CIIB 2PW2A 3CXHJ 3QEQA 4MHHI 4KKLC 5TFSH 2DQIL 2LV4A 1MSPA 4OZIE 1FG2A 1SJEA 4WFFE 2XN9D 5DO2D 1NFDB 1UZ8A 3PXHA 3E8UL 3VDCA 1V8HA 4X5WA 1CS6A 1BD2E 3DMMB 3IDXH 1MUJB 3RBGA 4FQCL 5TF1L 5AG9A 1AR1D 3BIKA 3PGDB 4WRLA 4M1GL 3GI9H 2VISB 4GG6F 4RAVA 1QD0A 5JW5B 1UXSA 3LRSA 2BNUB 3VXPB 1PKOA 1XGUB 3RU8L 3T0AA 4P2RD 2WP3O 3VXRB 5L9DH 1Z9LA 1DQLL 1C16B 4HMDA 4NBXB 1I9IL 4PRID 2Q8BH 1DLFH 1TETH 2BJML 3EDJA 1H3WM 3UTZA 5GGVH 4KJWC 1II4E 3TPKA 5IFJB 3O2WL 3OXSB 4L4VE 4LL9A 1JHLL 1M6OB 2VZ3A 3FAWA 1SM3L 5J3HD 3L1OL 4AH2B 5HI4C 4L5FL 4XC1L 5HHXH 1X6LA 1DBML 4PY8J 2BOCA 4XHQA 3RX7A 1U3YA 3TEUA 5FKAB 4UTAL 4OZGA 3MRPB 3T1FB 5CJXC 3T3ME 3VFMA 3LY6A 3WXWH 3ECBA 3HNVL 5SX5H 3JZ7A 5DS8A 3F58L 1I1RA 3D85B 4YPJA 4G9FB 4M00A 5IB5A 5CEYA 4PJBF 5CP3H 3VFGL 2H6PA 5T3XE 4O4YH 4WO4B 3ARDA 2F9BT 3EDEA 5DO2C 2YK1L 3KYNB 3NIFE 4G42B 5EU3B 2FIKA 3FQRB 2R2EA 5I1DA 2CKNA 1YEFH 1FAIL 2DQDL 4I2XA 1IEAB 4XC3L 1IEAA 4HX1B 1BBJA 4O00A 3SE4A 1VACB 1M71A 4X9FA 1MCIA 5EO0A 2VLRA 3VJ6A 5JORB 4UV4L 4XZUA 3MV9D 5HVHC 5DVNA 1JK8B 3I9GH 3WLBB 1NCCH 2XWTA 4F33B 4WEMB 2YD6A 4GG6A 2JB6B 3L5HA 4ZS6C 4O02L 1ONQA 2I60L 2R2BB 4YLQT 1ERNA 2NCMA 5IJKA 4ONGL 4U1MA 3C8DA 4OZGB 1BF8A 4P23B 4GMTH 4P57B 4JZJB 3L95A 2YD2A 2EYSA 4K3JH 5FKPB 4DGIH 1I9EA 1UXWA 5D70L 3IS0X 4GJTB 4LCCC 3DBXB 4KZEL 4LSDA 1NMCC 3BISA 1N5YL 4WNQB 1JWSA 5DD6B 5CHNB 4S0TD 2NY4D 4K8RL 5EG6C 5DMYA 1QA9A 5FAAA 2X9WA 3DVIA 3RDTB 2J6EA 2CSPA 2HT2D 2BDNL 5EU6A 5F1NB 3HZMB 3SDXA 3DRTA 5DHVB 5ADOL 1MREH 3EJYD 1RIUH 1S9VB 1XF3B 1KJ2H 3CU1A 4MJIB 4UINL 2AXFA 3FRPG 4JDTL 1GGTA 4ZFGH 2HH0L 3QCVL 2BXYA 1PG7H 3QHZL 1KF9B 2R39A 1Z3GH 1DL7L 2DN7A 4HKBB 1XF2B 4U1MB 3QR2A 2MNUA 2G9HA 4WIQA 3OGOE 3BP7A 4RFEA 5D1XB 5DK2A 5ISZE 2NX5A 3RGVC 3B9KD 5GJSL 1WBYB 2Z91B 5JOFA 3GSVA 2DRUA 4Q6IC 3IJYA 4V1DD 5DK0A 1KJMB 1KJMA 5A43C 1KN4L 2M8XA 4L8CB 3MNWA 5AUMA 4B50A 5E6IB 5E94B 3DGGA 3LEXA 3TIEB 3O4LE 2Z92B 1A6ZB 1HIML 1DFBL 3L9RA 4X98B 3QIBA 2R0KH 3MSPA 1R5VB 1BBDH 1KEGH 4NM4H 5EZIL 3QUYD 4ZDHA 3O41A 5F9JB 2OZ4H 5F3BA 1B0RB 3MODH 4KQ4H 5ID0A 1EUTA 3GMPA 3V4PL 5IB2B 5HGDA 4X6EA 1SMOA 2OXGA 2R4RH 5JQ6L 5ADOH 4IOIB 3BYTA 4NQCB 3FAXA 3LB6D 5BS0E 1FVDA 4Q2ZB 1Q0XH 2OJEB 3IYLW 3OKDA 3E6FB 5CSZB 1AGBA 4JQIH 3L3IB 4EJ1C 4F7TA 5GGQL 1D5XB 3JTTB 3MLRH 2FX7H 2AEIT 3EYVA 5DD5L 3W0WD 4HBQA 3AM8A 3EJYC 1EGJL 2JIXB 5KS9F 5J1SC 2X4PA 3VD9A 3F7YB 1LNUB 3I75B 4I9WE 2E8YA 3DETC 2VISA 2WLYA 3QDJE 5EC1B 2VLME 2V9RA 2CUIA 2OR7A 4PJAB 1C12A 2A6DB 1U3ZA 4Y5VB 1RUAL 2FX9L 2NY5H 4LASH 5DJ6B 2JELL 4DAGL 4HS6A 5DRZA 1N6UA 2VAAB 5D7KD 1MCRA 4MD0A 3RGVD 4WFEE 5IQ9A 1RJLB 2CMRL 2JIXD 4HKZA 4YE4H 3X14A 1H0DB 4YXKL 3DSFL 5K9QG 4WU7B 4HKJA 2V17H 3KPSD 1JV5A 3NPZB 3B9EA 2AJXL 2AJ3B 1J1OL 1E4XH 1YJDL 5IVZA 4XNXL 3KS0J 2ICWA 1KPVA 3W9EA 4PB0L 3S4SG 2ZG1A 1T2JA 5GZOD 1T89A 4D9RE 3NCYS 4OQ1A 2XA3A 3BRGC 1HI6B 1WQVT 1V7NL 5LVEA 5DUBB 3D25B 5FYJH 4J7RA 4Y4KB 5IM7A 5EC1A 4WO4D 3MACL 2GI7A 3CFIC 5HHPA 3TIDA 3BAEL 4AQOA 1KXQE 4HV8B 4IIQC 3UBXG 3IKCB 2Y23A 4M9OA 3U30C 3QJFA 3UJJH 3DMMC 4YDKL 3KPQB 4LPVA 4J4PD 4EVNB 2X40A 1TZIA 5IESL 3K8KA 3X3GL 5KG9A 4NRZB 2X9YA 1UH3A 4F33A 1YUHA 4W6XB 3KXFD 3GK8H 3P0VH 3WJJA 2OR8A 3P4MB 3WXVL 5JIIA 2X5PA 1RHFA 4HIJB 5GGRB 4K9EH 1C08A 2WWMC 4ONFL 4HG4J 1C5DB 3GKWL 1K2DA 2FYYB 2CKBB 3DUSA 5BV7C 2BJMH 3TVMC 2ADFL 4HFWA 2EYSB 3QFDB 5SV4A 4OZHA 4PJIE 5D7SH 4MYWB 3KLDA 2DQFA 4I3RH 2FWOA 3O3DB 3I50H 4FZEL 1OAUL 3CXHK 5GJTL 2BHZA 3G5YB 5JPMA 4BZ2H 3VXNB 5DT1H 3FRUB 1F6FB 3GIVA 4NQEB 1JPSL 5GZOC 3QWQB 3HCVA 4HG4K 1NGXB 3O3BA 5ACMA 3UP1A 4X0KA 1TVDA 1KXVC 3NOIA 3MRHB 1P7KA 3QEUA 4YBLC 3W2DL 3HUJA 2I25N 3V79C 2OTWB 5EIVA 4OCSH 3GIZL 5HPMB 3KPRA 3FO9B 4TNWK 5HYEA 1YEJH 5JHDE 1KN4H 2H41A 2L0DA 1INQB 3SE3A 2WQRA 4OGYL 4M7JL 3U9PH 3VW3L 3S88L 3QWRD 2IQAB 3P77B 1K4CB 2ICWJ 3CC5A 1YEEH 2ZKHL 3EFFB 2ARJB 4FFZL 4LVOB 4JRXA 4J4PC 4LFHD 4OSUL 4FFYL 1DE4B 4ZTOH 4QO1A 3O9WB 1DLHB 2W9DH 3QZWB 4JDZA 1ZLVK 2W91A 3L3OB 3C2AL 4OJFH 2A6KB 4H1LG 2E3VA 4ZFGL 3LD8B 3VFPA 3SKOB 3SE8H 1U8OA 1FCGA 2L4OA 1ZLSH 1LILA 4X5WB 3PP3K 4LCWE 2XNAA 1NCAL 1GL4B 3MGTB 4EQ2A 2IFGA 2CKBL 5ICZA 4UBDC 1NAKH 3KDMB 4P2OB 5HPOA 5F96H 3DXAB 1HHKA 1DQDL 4Y4FD 1A6AA 3QH3A 4N8CH 3MV9E 4YNYA 5CJ8A 1F97A 4YWGH 1JYVA 3UDWC 4MAUL 1KB5H 3KVQA 1F3RB 3UTQB 2CDFB 4B5EA 1DEEA 2BRRH 4OZIA 1YYML 3DURA 3QIUB 4L3ED 4HF5L 3B3IB 4GBXB 4LHUB 2WUBL 4PJIF 4IOSD 2VIRB 5D70H 2XZQH 3SDAD 1W0VB 1EO5A 2ERJC 1G7HB 3MO1B 4I5BA 3DX8A 1CE1H 2WUCH 1UACH 5F7DA 1XGQB 2BVPB 2JIXA 4JPIB 2CUHA 3T0BA 1NC4B 3W0WB 2X9XA 2X4UA 3O4OC 4PGJA 2W0FA 1CIDA 1ED3A 3ZKMC 1KTDA 4O2EA 2E27H 2DWEA 1FG2B 4HEME 1SJEB 3DIFA 1OVZA 5I8KL 4BH8A 3O2DH 1RUKH 2KDGA 2QQQA 4P2QD 3KPRE 5D6DC 1IQWH 1I7ZB 2F54E 5DJ2B 3EYOB 4D0BB 5KZCD 2R4SH 2XNAB 3BIKB 3RGVA 5E08H 3IFPB 4IIQB 2I9LB 4WHCA 1AKJB 1BREA 3ULSB 5FHBL 2P5EB 4PJ7F 4JO1L 2EDXA 3O6FC 4LSPL 2FJHB 1J5OH 5EU5A 1NQBA 1CG9A 1BVKA 5LGJB 3MNVB 1G9NC 5I2IB 1UM6L 5DRXB 4H5SA 1X5GA 4X6DF 4PJFE 1VGEH 4P4KB 4JFQA 2Y36H 1ZLUK 1JPSH 3ZL4L 5L2JB 5I1EL 5I1GH 1T21A 4G8IA 3MC0A 1GXEA 3H3PH 5D9SB 3G5VA 3RY5A 1UB5A 3OG6B 3I50L 3MREA 5DEFB 1F3DH 4PYHA 3FQXA 2W65A 4HIXL 3K0WA 4U33A 1ED3B 1FJ1B 3N50A 3K2MC 4K23H 4NN5B 3GSRB 1RJYA 2DBLH 4OIAA 4P4KD 2ENSA 4XCYA 4P3CH 4K3HA 3SKUD 3IU3B 4LP4A 3MJ9L 4HZAA 3QDHA 3O4LD 4TSBH 3S34H 4ZXBC 1UCBH 3GMOB 2HVJA 3CJJA 4U1IB 1KCUL 2BY2A 4CVWA 1A7PH 4J8RB 4Q9QL 3RPIA 4IMKA 3QJHB 1UXSB 4L3CA 5BS0D 2A38A 1U58B 3B8YA 5D2LA 4XXCC 3EHBD 3CLEH 5A2LH 3VRIA 3O6FD 3VI4F 4FTVA 3B2VH 2GUOB 3SKNA 3VU2A 2IH1A 1KLFA 3HC3L 1K6QH 2B0SL 1CXEA 3ULUL 3RIAF 2H9GA 3JSSA 1A1MA 2MCG1 5JOPE 3LKPB 1OY3B 4F37K 4NCDA 4YIQA 2EDRA 4U6HB 5ALCH 5IG7B 3T2NL 3WNNA 1T89C 5I75B 3QFJE 1OL0A 1IGFL 3IJYB 5BMFL 1YY8A 3K81A 1YJDH 3U82B 4XRCB 3LKNB 4C83A 2NY1D 3EOAA 5F3HB 4JFYA 1BD2B 3PWPA 1MRFH 1YN7B 1NUDA 2PKDA 4MSWA 1UG9A 4MNQE 2VDPH 4P4KC 1CGTA 1GOGA 1HXYB 2EDJA 5LWYL 2C3XA 3GMLA 3M17A 3KPSE 5I30H 5DJ0B 1K4CA 4ZXBD 2OX5A 1NCWL 1T2QH 1RZFH 4O2FA 4OM0H 3HZMA 3SDXB 2VE6B 3BQUA 1JGLH 3ZHKA 1RHHA 1LO2H 4YO0A 2ED7A 2G5BB 4XP4H 4CU6A 3E6FA 3I2CH 5CSZA 1YNLL 4UILL 3X11B 1ZT7A 3OB8A 3SJVE 1FBIL 1H8NA 1HQ4A 2C4FU 4NWTL 1EV2E 1QKZL 5J9PB 5DJCA 2LABA 1MCLA 2X4NA 1WFUA 2AEPL 3EHBC 4NGHH 3RHWF 1KCRL 1QSFA 5H35B 4W6WB 3CCHA 3UJTH 1WAAE 4IMLA 4XAKD 1OM3H 5I1CL 3NPSB 4FQXA 2NW3A 1A64A 1SBBA 4KUZH 3O2DA 2NY0C 3OX8A 5DVMA 4BFIA 1T1WB 4M8QA 3S35H 3FN3A 4PPTA 3C6SB 4ZAKD 2AJZA 1BFTA 1EUUA 1T03H 4RFNC 1RJLA 2P45B 3QQ4B 2CLZA 2HG5A 3F7VB 4M93C 1JWSB 4YHPA 3U9UB 5CCKH 3INUH 4IEFB 1SY6H 3HE7C 3OAZH 1MCWW 2Z8VC 1FYTD 5E70A 2J4WH 4LLQB 1OWWA 4HIHB 4O2FB 2ICWI 4GLRI 4JFEE 3E3QE 4C55A 4EI6A 4ORGB 4DN3L 4Y4HB 2HFFB 1W2KT 2FJFB 4JHWL 4U7SA 3PHSA 1WBXB 1QRKA 2P8PB 5BW7A 4MJIA 3DNKA 5F6HI 4APQB 4WV1A 4PTTA 5T3ZL 4YPGA 1ZLSL 2F53D 4QF1B 1T5XA 2IC2A 3HI6H 5L8KB 5I1HH 2YXMA 3STLA 3V0AC 4FN0A 1GGBH 1KPRB 5J57B 1JWMA 3NCYP 2P47B 4JRYA 3V5DA 3U2SB 1HE7A 3IDYC 2YUVA 3BWAB 3C09B 1R5IB 2VLRB 3VJ6B 4DN4H 1T1ZA 1UJTA 2NY2B 5DRXA 4A6YH 2LQRA 5I1CH 4WDIB 3TYFB 3TH3T 1RUPL 3BP4B 4ODBD 5D2NC 1YA5A 1YEJL 5M7QA 1LE5A 2CLVA 2VWEC 4DZ8A 2NY0D 1VESA 1T2XA 3VWKC 1FVEB 5EZOH 4PJEA 4NWTH 3UDWA 5ILTH 1KB5B 1YECL 2WNGA 4XCEB 3S4SB 4MAYB 1X44A 4L4TD 2P44B 4JQXC 2XKUA 1N0XH 2R0ZL 3B6SA 1U6AL 4JO3L 3KLAB 2APBA 4XT1C 3SPVA 5FYKD 2FZ3B 1S5IH 3QDMD 5BO1L 3RWGA 2EYRA 2NQCA 5BV7H 5ACLA 3LHPL 5H2BA 3RZCD 5KVGL 3C6LD 4CW1B 3VG0L 4E5XB 3FB6B 1MIMH 2HVJB 1MFEH 2DM3A 3WEXA 2VZSA 3D0VB 4XMLH 2AAVA 3QO0A 3BXNB 4Z7VB 2CGRL 2JB5L 2VOTA 5E9DA 3OR6B 3GIVB 1EEQA 3ARXA 3F6LA 3IJSB 3O8XA 3IDMA 1U8NA 3D39D 5CJBA 1GVIA 4XP9L 3MV11 5ITFB 2VZ1A 4OT1H 5BS0A 5IWLA 4R4NC 3ARWA 4ZSOB 2XXCB 2XIDA 4XXCA 1Q0YH 2HRPL 5F7HA 5KANI 3RL1B 3WL9B 2Q6WB 4L1HA 4FTVD 5T1DL 5I1IL 3U4EB 3OKNA 1WZLA 1HHJB 3O45A 4FXGA 4KKNA 1ZANH 2YS4A 4ESKA 2VDLH 3F12B 4P57A 3QZWA 3L3OA 4ODWB 3DHMA 1IGJB 4NFCA 4M6NL 4OCXL 4ELME 3FB5A 5DUPL 1MFCH 3UJIH 3AAZA 4YDJA 4NQSB 1RK1B 1DN0B 4IRZH 1DN0A 2HKFH 4Z7UA 5B21A 1Y6KR 4XI5D 4PP1C 1FYTB 1HHHA 4PB0H 3OAUH 5D6CB 1S7TA 2KH2B 1HHHB 1CGWA 3RZCC 2UY6A 3OMZA 4N90E 1U8NB 1CGYA 5I19L 3BE1H 1ZT4A 3MRHA 1TJIH 3QFJA 1DLFL 1TETL 2ZSWA 5CEZL 1IKNA 4ELKA 5HPMA 2F54B 3OWEA 4V1DA 1NKRA 4Q58C 1D6EB 4P48A 5DFVD 2XA8L 3WNMA 4XCFH 3G9VA 1OP5H 1E6OL 3T0WA 1VADB 3FT3B 2FX9H 2NY5L 3T3PF 2BVYA 4NHCH 2Z93B 2HLAA 1JFQH 2HLAB 2X4UB 3CFJB 4P2QE 4AENA 3DI2B 4NRXB 4Y16B 4L9LA 3OBAA 3TFKD 4M62H 1JI1A 1CR9L 1DVFD 1T1WA 2DJ4A 2FLRT 1OAQH 2KQNA 4XAWL 2WM0A 4KH2A 3NABH 4WTXA 5DD3H 2UUDK 4CU8A 2EDFA 4U3CA 1NGYB 4DFHA 4JQIL 1UWEH 1RUQL 1NFKA 4P46B 2ED9A 1CQKA 1R5VA 4DN4L 5JNYA 3ZO0A 5GRYA 3HN3A 2KKQA 1NEUA 3QIBC 4KXZH 2Q86B 3TBTA 1UB6B 5A2IH 5DK3A 3QI9C 4DKFL 4ZS7L 1BIIA 4K71C 2Q8AL 4JFEA 2DMKA 3QBTB 3MV7B 5IB1B 1QZ1A 4OF8A 4YH6A 5DFWH 4HCRL 1FO0B 1EO8L 4WEBL 1G7MB 2BOBB 1TCMA 2OI9C 4M3JA 5DUMH 1FAKT 1BVLB 5T3ZH 2EECA 4JFOA 3N85H 4Y8AA 3SOBL 4PJHE 4XX1E 1N7MH 2KZWA 3SEPA 2FD6H 5HD8C 1B0GA 5JOPD 2P49B 4K7PL 4MMXC 1LP9E 5DHYB 4DN3H 2DOCA 5DUBA 4NC0B 2DQUL 3T0EE 1MNUL 4AEIL 1CXHA 4M6AA 4Y5YB 5HDQH 4N0UB 1C5BL 4CBPA 3IXAB 3IFLL 1RUML 5C0JA 2AK1L 4KKBD 2Y7QB 3QXAB 1YQ2A 3VGHA 2VLRD 2VUOA 1PLGH 5JOEA 3TZVC 4PUBH 3H9SE 4R0LB 2ADGA 1UKTA 1G7JB 1I7TB 1N0LA 4A2MA 2BERA 1H8OA 2CKBH 4HKZB 1G1CA 4LOUC 2IPKB 4YDVB 4HKXA 4L3EB 1QQDB 1F58L 3RAJH 4TNVF 3FFDB 4P2YA 1OTSC 4WVRA 3GSNB 1GAFH 5CINH 1Z0NA 5DUML 5C9JB 1XCTA 1S9YA 5DEGB 1T22A 4P3WA 4JKWA 2CDGB 3GM8A 3QIBD 4M4RA 3DOSA 4RGOL 3QXTA 2FO4B 3MRQA 3KPSB 3T4YB 4M7JH 3ARFB 2GY7B 3LIZL 4ETQB 2K7PA 3S5LA 2V9TA 5F9OL 5IF0A 3OPZH 1NC4A 1XF5A 5GGTL 3W82A 1UM5L 3DARA 2AXGB 3OAYK 3NA9L 3K8LA 2I9TA 4N0UA 4EXKA 3MRKB 1WC7B 2Y72A 2RHEA 4ONHA 5HD8D 4WUUD 3BP6A 2BNQB 1A6TB 3L7EA 4U1HA 2EYTA 1UZ8B 2DJUA 3LPGA 4LGPB 2W0PA 1CCZA 2GT9B 3IDUA 4FQ1H 3WS3B 4YQXL 4RMVA 1TQCC 2VABB 3QUZB 3DMMA 1YMMA 5HHQA 2Y4SA 3JVGC 3RVWC 4YHYC 5BZDB 1G0YR 1R3LA 3FOMA 4IJ3C 1OAUH 4XCFL 1ZTXL 3SDXF 2IG2L 4KMQA 4WW2F 5L2KA 2FSEB 5JO5A 4N68A 4R3SA 3TZVD 1S7SB 3W11C 5JO5B 4C54A 2C3WA 4POUB 4R2GB 3L3DB 4LOUD 4O51A 4O51B 5I19H 4JVPA 4Q74A 1WK0A 2DQHL 4X4ME 3PV6A 4U7MA 4JRWA 1I1FB 4PG2A 3VXME 3CVHB 2W59A 3FHQA 1U8MA 3TBYA 2QLVB 3QP3A 1DSFH 5IFAH 4FQ2H 4ORZC 1EHNA 1AQDB 3MMEA 2J8UB 4NKDB 4XNZC 1AP2B 4MA8H 1DSFL 3SY0B 3BP6B 3G04B 3QULA 4KXZI 1RFDL 5A40E 3V0WH 4G9FA 5IB5B 1IKNC 3GSWB 3KPRB 4GOSA 4X5XB 2AJZB 3CFKA 4L29B 2BCKA 4LU5H 4JHAH 3EOTL 4PRNB 5CEZE 4FQLL 1ZSDB 5T1DH 1KLGB 1R3KA 3BZ4A 4K71B 3OAYH 1OARL 1S7XB 2BVPA 2VXVH 1AE6L 4JPIA 4M7KL 2HT3D 4HS3A 4LBEB 4PLJC 2XQBL 1CFQA 1XIWA 3QO1A 5C08B 1UM4H 1T7XA 1WZ1L 1T5WB 4JEGB 4PJBA 4Y16A 2F53E 1RI8A 3RVXC 1J0JA 5DJYA 4OLVL 4L9LC 1BJ8A 2ZNXA 1QLFB 1QO3A 4LSPH 4QRRD 4R4BA 4JKPH 2JB6A 4RRPG 2OJZH 2NPLX 4U1SA 3TPUB 2X7LB 2GITB 1EEYB 1K8IA 2YR3A 5KBNC 3EFDH 4XH2B 5DQ9A 3DYPA 4XNQA 1UB6A 5TFSL 1JPGB 1ZS8B 4RMUA 3MFFA 4OUOA 3IDGB 5J7CC 4LAQH 5D2LE 2ICEB 4UDTA 1UVQA 5C7XL 4FTVE 3STZA 5IJVB 43C9A 4PBWD 5I71B 4PR5A 5DTFA 3MTRA 3ULVD 2OL3A 1KLUB 1XGRA 3O2DL 1X5XA 1FYHB 3QA3A 3PF2A 3G5VB 2PYEA 5FYKE 3P9WB 2QQLL 3PNWB 2XZQL 3DX6A 1X7QA 3S3JA 1SJVA 1F11A 3QDJA 2CRIA 4PJFF 4Z95H 4E42B 2EO1A 2W0FB 3QIUC 4KV5F 1ZLWH 5BJTB 2AK1H 4G80A 1OB1A 1P69B 1T3FB 4G7YH 5I1AB 1M1SA 2B5IB 1WBXA 3CFEB 3KGRA 5GIRB 3MRGB 1DTUA 1VDGA 4J4PA 3S7GA 4Y19A 5L6YH 3MJ7B 2X4NB 2ZPKL 3DJ9A 4MNGB 5J0BA 3VD5A 1NAMH 3RVXD 4J8RA 4MJ6B 2HTKD 4BFEA 2JJUA 2HWZL 5IW1A 3K4ZA 4QXTA 1B9ZA 5EZLB 2FH8A 3S37L 1C16A 3VRJB 4ZUVB 2GQHA 3CXDL 3SDDD 3GO1L 2EDBA 2W9DL 3IS1X 3STZB 5IJVA 1J8HD 3TO2A 5T1LD 1FP5A 1JHTA 2Y07L 4BZYA 5SWSD 4O5LL 5TQ0H 3T8XB 5C0AB 5JTWA 1DBJH 3O2VH 3QA3B 1U2CA 5D2NE 3RTQB 2HH0H 4HDIB 5AD0A 3WIIL 1ACZA 4LSUL 3TH2T 1SBSL 4M1DL 3WHXB 3SE9L 1J7VR 3FQXB 4NQCD 4AT6A 1U91B 4JCMA 4NQEE 4EI6B 4G80B 4NCC2 5FO7B 3RWIA 4BJLA 4NQDD 1I85A 3P0YH 4LF3B 2VLLA 1RZJL 5FYKU 4NBYB 2AJUL 2NY3C 2Y25A 2P24B 3QIUD 1B3JA 3DV6A 1HI6A 3DV6B 1DBBH 5FYKH 3MBED 4OCSL 2FECI 3V6ZB 1E4WL 3W2DH 1N6QL 4F7CA 4QXTB 5C08D 3NZ8A 5HI5C 3IDMB 4I3RL 2YPLA 4R97B 4K3DL 2EEBA 4KMLB 4LSVH 1YEHL 2XQBH 3U4BL 3TZVB 3S6CA 2PCPB 1NSNL 5CLTA 1FIEA 2F5AL 2FHCA 3LEYL 2EDOA 5BV7B 5BCAA 5E99L 4QT5B 3BEWB 3B8SA 4HWBH 5J6HB 1M6OA 1KSRA 2Y5TB 1DQML 4YUEL 3RL2A 1MPAL 2X89A 4YXHL 3OAUL 1UYWL 3MX0A 1YQVL 3ARBA 4HJGB 3T0ED 4HKJB 3GK8L 5BOZG 5BVJA 4FOMA 1NLBL 1FIGH 3NACL 2HLFD 4DVBA 3TA3D 2CKBA 3DUSB 3I9GL 5TE4H 5BMFH 3QUMB 3QDGE 4JG0H 1EH9A 3V4UH 4ALAH 2XZAH 5IV2B 1JWUA 5TF0A 5I0ZA 2OS7A 3LV3B 5K9JL 4L8BB 4OQTA 2MJWA 4X6CF 1FAIH 5SWQA 5EOQL 4Y4KC 3L9RB 4X98A 1ZSDA 3PWPD 1CDYA 4P5MB 1LHZA 4KUCD 2FECL 3ZDYE 3CZFB 2WLZA 4GS7B 4PJXB 4ZO8A 4UZGA 4FRWA 4YDIL 5E2JA 2VXUH 4ODHL 5CIPA 3RIAK 3F58H 4KJPC 4ZXBA 4J1UA 1TQCB 2DS4A 3PIQA 1AHWC 1IKFL 3BHBB 5I1IH 4Z7WF 1QNZH 5SWZA 4LSQL 2CLRB 4IDLA 5E8OA 4N0FB 4Y4HC 3BQUC 3EZJB 4UIMB 2O5YH 1K8DB 1AR2A 1IL1A 1ZOXA 2XN9A 4F7MA 1Z9OA 2C9AA 4R9HA 3HZKB 4LGSB 4ODUB 1I8IB 1U8KA 4PJ5B 1FIGL 3N1GC 1K8IB 5HVGB 1NGWA 1CLOL 2ZJSH 2A9NL 2DBLL 3AB0C 3EGSA 3KPPB 5JOFB 4FNLL 1N64H 2VLRE 2MHAB 4YAQB 4LSTL 3T0EC 5BRZB 1YEHH 3HFMH 1J1XH 1C5CH 3VXRD 1RIVH 4W4NA 1TFHA 3AREA 4UDTB 5E1AA 2HLFC 4BKLB 1DQJB 2A83A 3Q6FA 4FA8A 3ARZA 3VG0H 1HHIA 4OCRH 3FQWB 1OGTA 2DMBA 2WBJD 3HPJA 1F4AA 4BQ6A 4QHLB 2Y36L 5LG1A 1O0VA 1IC4H 3H7BB 3GJFH 3MJ8B 2GJJA 2O61B 4NQDB 3BZFB 4Y4KD 1X5KA 1JV5B 1GZQB 3HZVB 1HKLL 2UWEB 1PGRB 1FZKB 3QUXC 5JLZB 1KPVB 4PJAF 3EDKA 3QIUA 5SX4H 3MRNA 2D7QA 4OF6A 3VXMD 3UAJC 1TIUA 4M1DH 5IMKA 1Q38A 4MX7A 3RX8A 1T7WA 1R0AH 1AJ7H 4KPHL 3MZGB 4X4ZA 4YC2B 4KHTL 2BX5A 3ARTA 2WV3A 1GGIL 3O2VL 3NIFF 2COQA 3FT3A 2BVOA 1F4HA 2CK0H 4HLZH 4Y4HD 4Z7VA 1Q9OB 2HFGH 4XPAL 1QSED 5FB8B 3RHWK 3K46A 1ZHNA 3ARDD 3MODL 3UYRH 5I8EB 2ZOLA 4D94A 5A3IC 3CXDH 3DVNB 2X1XR 2UUDH 3W5NA 3MRJA 3GMNB 4CJ0A 4HH8A 3VRJA 1U8OB 5JR1L 3KNBB 1PEZA 5FDWA 2J4WL 4WHYG 1JF1A 1A6ZA 3KYAA 4F3FB 1MJUL 5TQ2H 2EEAA 2XG5A 1D5IH 1VSCA 5D2NA 3P9LB 4N1CA 3N0PB 3G5XA 1PG7L 2CD0A 3GBML 3Q1SH 2A9MH 1J1PH 3UTSA 1K5NB 4ZFOL 4ZS7H 3GMPB 1GZQA 3QUKB 3L3DA 3RQ3A 4JQXA 1G7QA 3S5LG 2Q87A 5IEHA 5CS7A 2B8OT 1AGEA 2BDNH 3KLHC 2VXQL 3QCVH 5FGBA 5KZCB 2QTEA 1E6JL 5BQ7B 4QHNA 4HUUB 1AJ7L 5K59F 3OGCB 3BKML 3DUUB 2VNCA 3EYSH 3GEWB 1I1FA 4UAOB 4XAWH 4NWUH 3ZMRA 2E7CA 1VGKB 5C70A 4IBLT 3VXQA 1FYTA 4R0LC 1ZEAL 1ZMYA 3D48R 1JNNL 2ICCA 1OM3L 4KZEH 4NPYA 4CMHC 3HR6A 4JO2L 1LO2L 4EUPB 4WV1C 4LVNC 3MUHL 4EUPH 4D8PB 2C26A 1C7SA 1FCCA 4JM4H 1YEIL 1S7WB 4MD0B 1CGXA 1EEZB 2D4DA 3NA4A 1LO4L 4KDTC 3UZQA 3MA9H 1IFHH 4P4RB 5E8PA 5EU6D 3UPRA 3PE9A 1LK3H 1JZ3A 4TSAH 1JPTL 1OAXH 5C0DA 2X4SB 6FABL 1VFBA 1FQ9C 4QGTA 4R26L 3QSKB 5F44A 3ARBC 5GS1C