1Y1LA

Crystal structure of arsenate reductase from archaeoglobus fulgidus dsm 4304, structural genomics
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
124
structure length
124
Chain Sequence
b'KVLFVCIHNTARSVMAEALFNAMAKSWKAESAGVEKAERVDETVKRLLAERGLKAKEKPRTVDEVNLDDFDLIVTVCEESSCVVLPTDKPVTRWHIENPAGKDEGTYRRVLAEIEERVKKLVGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords arsenate reductase (arsC)
molecule tags Transferase
source organism Archaeoglobus fulgidus
publication title Crystal structure of arsenate reductase from Archaeoglobus fulgidus
rcsb
total genus 33
structure length 124
sequence length 124
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1y1lA00
1AB6A 4PYRA 5ABPA 3CRNA 4YV7A 3CLKA 1D1QA 1Z15A 3EQ2A 1QO0D 1EWKA 5GOTA 1JFTA 3ILYA 3CG4A 2A9OA 3R0JA 1RZRA 4S05A 2WB4A 3H5WA 4N0PA 5T7BA 1ABEA 4QYMA 1U2PA 2IPNA 1W25A 4OTZA 3CG0A 2FW0A 4RY9A 5TE9A 1RXEA 1D2AA 2FMFA 3JVIA 6ABPA 1JHZA 2HQRA 3H1GA 3SQNA 5I4CA 2MSKA 8ABPA 1JYFA 1D4ZA 2WMYA 3QX9A 1M5UA 5IUNC 4EY3A 3HEBA 3C3KA 3T38A 1VRVA 3HSYA 4N47A 2LIVA 2GI4A 3CZ5A 4EUKA 4JA2A 4XASA 2N9UA 5CNJA 1JX6A 1JYEA 4MS1B 1ZY2A 3HUTA 3HUUA 3OO1A 4XFKA 3EGCA 3HM9A 2FQYA 2PUDA 4N41A 2RDMA 1ZHHA 1YIOA 2A9PA 2MSLA 4MPTA 4MLDA 1VLZA 3LUDA 1M5TA 3OLWA 5DKFA 4D74A 1KGSA 1F51E 5FBHA 4FE4A 1YVUA 3FGZA 1NXTA 4KV7A 5DCLA 3VNBA 1A04A 3L6UA 3HVRA 1QNLA 3QLVA 1K66A 3SAJA 4GNRA 4KMRA 4Q6WA 3IP5A 3ILHA 1Z18A 3GBVA 5BQ3A 4W5QA 5IX8A 1JBEA 3LUHA 3UUGA 3IP6A 4HNQA 5EWJB 4Z9BA 3N53A 3HDGA 2QVGA 3DGEC 1YS6A 2JBAB 4MR7B 4Z0NA 5FBKA 5EWLB 4MS4A 2RJNA 3HS3A 3OMWA 3Q15C 4RK6A 1MB0A 5BRAA 3C3WA 4RS3A 4CBVA 1DCMA 2IPAB 4OLAA 4RZSA 5D2CA 2JBAA 3P9YA 3N6VA 3DGFC 5KC9A 3IPAA 4IRXA 3H5TA 4MS3A 1BDJA 3FFWA 3LKVA 1HEYA 5JNWA 2PUFA 2QVCA 1QQAA 3KG2A 3C3MA 4OATA 4PEVA 3A3KA 2XDYA 4G0XA 3LMKA 4YGXB 5IUKC 2V0NA 4XLTA 1C0EA 4MQFB 1PHRA 1Z2DA 3GA5A 5KI6A 1DZ3A 4NQRA 5DLEA 1IIBA 1APBA 2FEWB 2FMIA 2VUIB 5F64A 4L85A 1DCFA 2PUGA 3OLZA 2VYCA 3M6MD 3F7NA 3LTEA 5TQ2A 3URMA 4HNSA 2QU7A 1URPA 1JLKA 3I45A 4UHJA 1EFAA 2IPMA 3CHYA 2A9RA 4D6XA 3TX6A 3LUCA 1YK0A 5EWLA 1NATA 6CHYA 1OXBB 1LJLA 2IDMA 4JB2A 4RXMA 1FFSA 3FFXA 3W9SA 1KRXA 5HKOA 2GBPA 2GKGA 1RPJA 3VNAA 4G0YA 1PEYA 3KJXA 4EVRA 1DC8A 3HCWA 3JTEA 2HQBA 4LRQA 4MAAA 1PUXA 2R47A 3CZCA 5ED4A 1BVHA 5CHYA 1B00A 4G97A 4WZZA 5CNMA 1FSPA 3NBMA 3CFYA 1FQWA 3G1WA 1JDPA 3O2JA 5T3YA 5E3JA 5IUJC 2ZAYA 1E6KA 4ZMRA 3NHMA 3MQ4A 2B4AA 4N0QA 3TO5A 4EVQA 4ZYLA 4OG2A 3K4HA 3HJFA 4LE2A 1BAPA 2E4UA 4RXTA 3T95A 1JH9A 2IPLA 2LP4Y 3RVSA 3HO1A 1Z16A 2WJAA 1U0SY 5GQSA 5FWYB 3QLUC 2O20A 4WWHA 2AYZA 4G0OA 5JNVA 1M2FA 4PE5B 1I3CA 4F06A 1DRJA 1YS7A 3H1EA 5TQ2B 3O74A 3RVOA 2VUHB 4RU1A 4N76A 4H60A 1AB5A 3RVNA 2HPHA 4QPJC 3T6KA 3Q7SA 4LDAA 5JNRA 4RV5A 2FQXA 1P6UA 1U2QA 4DQDA 4RWEA 4KREA 1TM2A 5JS1A 4P98A 4RK4A 1D5WA 4IMJB 1TJYA 1S8NA 3JS5A 3D02A 4LX8A 4G0QA 4O1HA 5FWXB 2E4VA 1BA2A 1K68A 1SXIA 1Z25A 4EYGA 4F11A 2QSJA 5CNIA 1SXHA 2R25B 3GT7A 2QXYA 5EWMA 1L5YA 1XHFA 1Z13A 4NCAA 2CHEA 2QZJA 1TLFA 1L5ZA 3H5OA 3ROFA 5DGCA 3SNKA 4TLLB 3KLNA 4KNYA 4MR8B 4G0PA 3H6HA 4DADA 4KQ9A 1NXOA 1BDHA 1MIHA 3BRQA 4WUTA 3GL9A 4MRMA 1F4VA 1ZITA 3EJWA 1DBWA 2J48A 1XWWA 2YHBA 3ROTA 5C5CA 1GLGA 4P1ZA 4LDZA 3OM0A 1U04A 4EYKA 3O2SB 1FFGA 2QW1A 9ABPA 4YP9A 1QP4A 2F8TA 2CD7A 4Z4IA 1QO0A 2FN9A 2FVYA 3DZDA 5KC8A 4KFCA 1USIA 3H6GA 4ZJPA 2JRLA 4MQEA 3O2QB 1P6QA 3H5IA 3OQMA 1RZRD 5TPWB 4G0ZA 1GUDA 3CTPA 1SRRA 2FSPA 1SD5A 4KQCA 3A10A 4WT7A 4EVSA 2I6FA 3T8YA 4Z99A 5TPZA 3NNDA 1CYEA 3NNNA 4RK5A 1U8TA 4WXEA 2PMCA 4MS1A 4RK1A 4WXMA 3RVPA 3F73A 2B1JA 3LUKA 3LUJA 4JP1A 4O1IA 1ZVVA 1PNRA 3UK0A 1XHEA 2ID9A 4HYEA 4MLCA 3MYYA 3K9CA 4RKQA 3H5VA 4YCSA 2JB9A 2WRZA 3MIZA 5FWYA 5TPZD 1W9HA 2E4WA 2PJUA 1Z17A 3C97A 3O21A 1WETA 5HSGA 2GWRA 2QV0A 3RVRA 2A9QA 3OQOA 1SXGA 2FMHA 3LKBA 4LE0A 1GCGA 5JS2A 2VK2A 2HJ9A 2PUEA 1DRKA 3LUAA 3HK2A 3RVKA 4ETIA 2RJOA 3OO0A 3RH0A 4B09A 3BRSA 3DLBA 5EWJA 4RK7A 2IKSA 4YRZA 2W42A 1A2OA 1DP4A 3SY8A 1NXVA 2CHFA 4IGAA 5KQPA 1DCKA 2H3HA 1NXSA 1RNLA 1QPZA 3CU5A 4Z4HA 4LZLA 3H5LA 1NXWA 7ABPA 3FDFA 4YWHA 1YTUA 3BILA 3CNBA 4TLMB 2KYRA 2E4ZA 3GRCA 1ZH2A 4KK4A 3FMVA 3KTOA 4UHKA 2M98A 3G85A 3KYIB 4FE7A 1Y1LA 2E4YA 4TN5A 4XXHA 3QEMA 2MYUA 4O5AA 5IULC 2MYTA 4DN6A 1ZGZA 5CNKA 3O1IC 4RXUA 3N0XA 3Q7TA 4Z4EA 3N0WA 2E4XA 4Q7EA 5BRJA 3OLXA 2PAFA 3EDCA 2R48A 5HM6A 1P8AA 1E2BA 4MR9A 1H9CA 3FFTA 2JK1A 5TPWA 4JASB 1Z2EA 1DBQA 2WJWA 3BBLA 2M1ZA 4NV3A 5IEBA 3RVQA 2JVKA 5JNTA 4EGSA 1UDRA 4RY8A 3SG0A 1JFVA 4F8JA 2PL1A 4OLBA 3GYBA 5KWSA 3F6PA 4MR8A 5JNUA 4W5TA 2BGGA 2DRIA 5B3JC 2GX6A 2OENG 4NCBA 2IOYA 3QEKA 4KK3A 4LE1A 3NHZA 4MRMB 4E7OA 4EYQA 2MYPA 4Z4CA 2LUOA 2LPMA 4G86A 3KKEA 1A0OA 2NZUG 2Q5CA 4EYOA 4MR9B 3QLVC 3LOPA 1M2EA 2PKXA 4XARA 3Q41A 1ABFA 4H3HB 3OLVA 5JNSA 3OMXA 2FN8A 4MQFA 3M9WA 5C5EA 1J56A 2WY2D 2PUCA 3KSMA 3Q7RA 3HXMA 2FEKA 3D8UA 3O1JC 1QP7A 2TMYA 3KLOA 1JF8A 3MMNA 3JPWA 2PUAA 3RQIA 3KYJB 3OLYA 4S04A 3KCNA 4IF4A 1Z12A 5IC5A 3QLTA 1ZGGA 4MQEB 1MAVA 1C4WA 3OM1A 4XAQA 1NXPA 1P2FA 2R4QA 3JVDA 4JOQA 4N03A 3NNSA 3LUFA 3TB6A 4MS4B 3OQNA 4QYWA 1QQBA 1ZH4A 4IILA 4L4UA 3I09A 3MA0A 1RXIA 3SM9A 1LBIA 2MSWA 4ZMSA 1JL3A 3BREA 4MS3B 4D6YA 4RDCA 1TMYA 4KRFA 4E7PA 4RKRA 2OQRA 2L19A 4JB0A 1E6MA 5B3JA 3MM4A 1DG9A 4IMIB 3LUGA 3CS3A 4F12A 3C6QA 1MVOA 2NT3A 2X7XA 3DBIA 3QK7A 4Z9AA 4Z4FA 1ZAYA 1EWTA 1NY5A 4Q6BA 4YLEA 4ETMA 3A0UA 3EQZA 3H75A 2FEPA 4M88A 2RGYA 2H0AA 2FXIA 1T34A 3O1HB 4NICA 4YO7A 2AYXA 1JFSA 1ZESA 3E61A 1FFWA 3JY6A 3N8IA 4W5OA 4TMYA 1LJUA 3RVMA 3O75A 5IBQA 1GUBA 4MGEA 1NXXA 4RY0A 1GCAA 2YHAA 4ETNA 1QKKA 4RSMA 3IP9A 3QELB 3IP7A 4H3KB 3UKJA 3EAFA 2ID7A 1VKRA 2P9HA 4W5RA 4KPYA 5PNTA 1ZDMA 1E6LA 4OBBA 3Q9SA 4YS6A 3S99A 5TQ0A 4PICA 1Z26A 4Y9TA 3TD9A 1VPWA 3M9XA 5IEJA 3EODA 2L18A 2L2QA 3GBPA 3I42A 1NTRA 3GWGA 3H1FA 2NZVG 1YK1A 2PLNA 3JPYA 3QLUA 4QICA 2FLKA 4JAVC 1QP0A 2LBPA 1D1PA 3IPCA 5DTEA 3HDVA 1YMVA 3IDOA 1USKA 5EWMB 1JDNA 1EHCA 2FTKE 3QX8A 3L49A 5KQMA 2JVJA 3KS9A 2IYNA 2WWVD 3RVLA 4PZ0A 3MF4A 3F6CA 3A0RB 1TVMA 2MYNA 3B2NA 2F8SA 3KHTA 1ZN2A 1KRWA 4KVFA 3LFTA 4ZPJA 5TQJA 1EAYA 3EULA 3N0RA 1CHNA 3RVJA 2CWDA 2L17A 2PE5A 2QR3A 3N75A 5FWXA 2HQOA 3QEMB 2FKAA 5HQJA 1QMPA 1JWLA 3QELA 2HSGA 4G0MA 3TMYA 2PUBA 2P4UA 3I5AA 1PNTA 3DLHA 3HV2A 1KMIY 4FB4A 4KZKA 5KQGA 1ISSA 1BDIA 4MYRA 4HNRA 5TQ0B 2ZWMA 1ISRA 1MB3A 4W5NA 1OXKB 1USGA 3CKMA 3E3MA 1LBHA 1EWVA 2FLWA 2JVIA 3GV0A 4F3TA 2NT4A 5BR1A 4MR7A 4YR7A 2JCGA 1YMUA 2NUBA 4Z4GA 1CEYA 1LK0A 2PL9A 5KQLA 4RK0A 1R8JA 1DBPA 4GPAA 2FQWA 1PEAA 2FMKA 3HZHA 1DJMA 4ML3A 1DC7A
chains in the Genus database with same CATH superfamily
1YKFA 4JNCA 1PT6A 4BJ1A 2XCQA 3OY7A 4QA9A 1NG1A 4PYJA 2WF8A 2IYTA 5G0WA 4GFDA 2UYCA 3L7LA 1U3FA 3N2GA 2P0AA 2QG6A 1KAGA 2G1UA 3HXLA 5EJ2A 2YINC 2CXRA 3TKLA 5FR2A 3VR6A 4RQBA 4B7XA 2DTXA 3V4LA 2B35A 2CN1A 3NKLA 4Q24A 4V02A 3D8SA 4J7UA 1IOLA 4QVGA 2WB4A 5HK9A 1CF4A 1H4TA 1DQNA 4E30A 3DLIA 1T2EA 1YZYA 2YWBA 1C3OA 3LRPA 4LUCA 2BMJA 3WLOA 2G0AA 4DRYA 1GGMA 1FJGB 3H17A 3H1GA 5D6OA 1N8TA 2W2KB 3UV3A 3WRWA 5I7UA 4M0LA 2WMYA 3A2KA 3MJSA 4BKOA 2BP7B 4UMFA 4ZOEA 2OV2A 3IVMA 2WAOA 3CX3A 1NU8A 3U80A 4D41A 3EZ6A 3H4VA 3TCKA 3U31A 1TU4A 4MICA 1N0UA 3PNMA 5JALA 5FTWA 3TNLA 1PHPA 3SE7A 3BH0A 3UMSA 4C2AA 4FHEA 4B4VA 3R24A 3FCOA 4XB6B 4LF7B 1QLJA 4NDNE 1JEQA 2FPPA 1Q7RA 2BI4A 1H9AA 1ZA2A 3ORSA 4UHCA 5MF6A 2VT7A 3I9MA 4Q9NA 3ABQB 4DAEA 5AP9A 4FZ5A 1ZOOA 3DYVA 3F3MA 2GCOB 2R87A 4TMKA 1IFXA 1JR6A 2DUUA 4CIBA 2I1VB 1JA0A 3K70B 2BEJA 3JWIA 5DNAA 3HCBA 4EGCB 5E3HA 4PYKA 3NKVA 3RFTA 4Q01A 4X44A 3WJ1A 4B1FA 4DRXB 4P4SA 2YY5A 2AGVA 1J06A 1EM8A 5BN3A 3KOMA 1XYGA 2ZTHA 3INGA 5CYOA 3HMKA 1K2VN 2IELA 4I1SA 3LQRA 4KGXA 1OX5A 2XCOA 3JASA 4OXIA 2OK8A 4QJBA 5G0SA 1DI0A 1XQXA 3VM6A 2FJPA 4CM8B 4DVJA 3A36A 4IFTA 3VKGA 5GTDA 3TLZA 2AF4C 2XQGA 2H08A 5HG0A 3N53A 1ECJA 2C5GA 4HWGA 4MWBA 3PC4A 1UQTA 2WU1A 3COVA 1QPBA 1P2DA 4C14A 1AHIA 5DM1A 3VAAA 2AKEA 2QTCA 2OV1A 2CFSA 4EW6A 4PQFA 5LYYA 1ZM3A 1OV4A 2PZMA 3TW8B 2Z2KA 5D2CA 4EUHA 1CY2A 4Y1EA 2IUSA 3I23A 5F1KA 2WVAA 4JI3B 2DR3A 3NVKI 1MOPA 4KOEC 3KEQA 3EVNA 1CC1S 3WGJA 3LX8A 4AECA 2PUFA 3AM1A 3W2FA 1YC2A 2GEKA 5BSMA 1K06A 1X7HA 3B6EA 4K9SA 4LX0A 4V39A 3ZHVA 4D0SA 1A4IA 2R0QC 2BE7A 3PFFA 2XF2A 1Q0UA 1RYBA 2JJYA 3OQVA 3RJZA 3UHAA 3AIIA 5KTSA 4O59O 1NMEA 4XLTA 4PCAA 5FXMA 4LY9A 3G49A 4BFXA 4UVIA 2R6GA 1AUPA 3ECAA 2DP4E 2Z4SA 3Q7IA 4CV0A 1FVOA 3DD5A 3IDAA 1F7VA 1IZZA 1Y3HA 2P9EA 4EB0A 4CEJB 4INZA 5JJIA 3RASA 1Z3CA 4WE3A 1U7OA 4YMIA 3RSLA 4MA5A 3F7NA 3SJ7A 2GRAA 4PIMA 4XWAA 1R8XA 1SVWA 2IPMA 3CHYA 1GR1A 2HWXA 4PLTA 3VMMA 4KO1S 1NNSA 4EKGA 4M9UA 3D3JA 4F7DA 5I7SA 1XA0A 2H5IA 5LKRA 3TQRA 4BLRA 4MJ7A 1E4VA 1MA3A 2DHQA 3SR0A 1QZZA 1W5SA 2BSAA 3RT1A 1IEXA 2AG5A 2CUNA 2QRGA 3V1NA 4CV1A 2QUZA 3H1BA 1M54A 1WPXA 1HA3A 3JTEA 2HQBA 2XVYA 2Z8YM 1R2QA 4UE2A 2DPGA 3LT0A 4Y2XA 1IY1A 1XXHA 1LDBA 3DZFA 1ZJJA 3CRZA 1IB6A 3INNA 4W6ZA 4PZLA 4GF5A 2X8BA 5IT4A 1KEWA 2DSTA 2EFGA 2RAFA 4LMAA 4O29A 5AJXA 3UEOA 3DMFA 3HZRA 1N6KA 3ZH9B 2VPYA 4PTLA 2IUFA 1GPDG 1ECCA 3TO5A 1B8VA 4AMZA 3ZE6A 4N54A 1QP8A 2KM1A 2J9ZB 4NMMA 2PZ8A 2HGZA 2VC2B 1NRJB 1U8YA 2C7RA 4HNGA 2CV0A 5CXXA 3RVSA 1U99A 3H11A 3V97A 2NQTA 2XQIA 2YQZA 4ZAXA 2A86A 1HE5A 2AYZA 3TTSA 5AUOB 4OYRA 5EKTA 2PQ6A 2VIIA 2BHRA 4G8DA 3G17A 3K5IA 3BULA 3LL4A 3E35A 4X3PA 4HPWA 1ZU4A 2IW1A 4IIJA 4B8WA 2OFFA 1XAJA 3D1JA 3WFJA 4DQDA 1FRFS 2IXAA 3M1AA 4LDQA 4RWEA 3D4OA 1HSZA 2UV8A 5CLGA 2O4CA 1I0LA 3D02A 3T9DA 2OE2A 1I6LA 2LV8A 3D7LA 5IVPA 3E1SA 3JD0A 1QE5A 3QEJA 5CNIA 2QYSA 4J7CA 5JSKA 2FW1A 4B4OA 3ZCVA 2RHDA 2YFHA 4P4NA 4YCLA 3ZBUA 5JS7A 2YHIB 1SU7A 4ALLA 1TQHA 1PBNA 2RGRA 4JENA 2H2AA 3FNQA 3W0LB 4MQBA 1AD2A 2A8YA 3L3BA 3CUYA 1X39A 2ILVA 4AJIA 1R18A 2IRWA 2H2FA 1Q5PA 3EIHA 3BA6A 4KQ9A 2PS3A 1GL6A 3TINA 5AW3A 1C9MA 2F55A 3O4RA 3NIGB 1BWRA 1I8TA 4HDNB 4ZV7A 1ZRSA 3OTOB 2QYHA 3JATB 4DV7B 4EG6A 1JKFA 4ZCLA 2EZUA 3JQRA 4P1ZA 2P5UA 3STWA 4CTJA 4ZCIA 2J4DA 3F3KA 5FBQB 1VSTA 3LL7A 1X1CA 3ND8A 4O4JB 2Q99A 5JMPA 2UUBB 1G98A 5JWOA 1T6NA 4JJKA 4WA7A 5JPCA 2A6PA 1JIVA 2VCYA 3D2AA 2B82A 4D1YA 2R6FA 2O48X 2YIVX 3MT0A 1ZUWA 2F9FA 1XDWA 2ETXA 3AFNA 3PJFA 3RB8A 3SZ3A 5EXPA 4JXKA 3X2SA 3BGIA 1RACA 3KQQA 4IDBA 2O5RA 1MMFB 1ODIA 1P1JA 5B58T 1JUDA 2I6FA 2HV9A 3L7CA 4K46A 4IIUA 5FO0A 3UANA 4WTOA 2QY9A 1JDBB 4TLEA 4JSTA 1E2MA 4O4IA 4MZXA 3SHFA 5CDYA 4HH1A 1JAZA 1U6JA 4RQUA 4PGAA 1FE8A 5IABA 3O0DA 4K7JA 4AP9A 2AFVA 1A50B 2VUTA 1BS2A 4BV2A 1G16A 4YRPA 3TPCA 4F71A 1BKYA 5L7YA 1QU2A 1RR6A 3OZUA 3VKVA 1Z82A 2NUTA 3LDGA 3PD7A 1IDN1 2B4QA 2JFYA 3AVQA 3C14C 3MMPA 2WJGA 3HL0A 1N6RA 2Z2JA 3TJRA 1E7RA 1FXWF 1Y7PA 1CUYA 1K8YB 1TKRA 1ZUNB 2Q6VA 2XXJA 3NASA 4P53A 1CKEA 3AQIA 4L50A 1UPUA 5BWNA 3RVRA 3SBDA 4EM6A 3OQOA 1SXGA 1UWVA 2ACWA 2HSEA 4N5DA 3KYDA 1ONNA 1RP1A 2IHZA 1YFZA 4LZZA 3C39A 3ROXA 2YFYA 3JYNA 1VHWA 3M9LA 4WNYA 2FSVC 2PUEA 1W5TA 4MW1A 3UJPA 1KO5A 2IIPA 4MV9A 5B1YA 3MJTA 3WBJA 1UH5A 4UZFA 2AG6A 1IVYA 1XEXB 2UZAA 3RGWS 4MB0A 3K9FC 4QQ8A 4A5SA 3GCXA 3EGVA 2P4QA 3E22B 3P9ZA 3KDAA 4J1TA 4IV8A 1Y8CA 2WNHA 4X6YA 4FPXA 3KKKA 1G9XA 2DGDA 2FZ4A 4FQ7A 4S1WA 5AVXA 2C2WA 4PO9A 4PCVA 2ZJ7A 1RJFA 2O5VA 2RI0A 3IAM1 3PPXA 1Q21A 1FVXA 3PXUA 1E4EA 3AX6A 3NATA 4R16A 5EP4A 3GR6A 5TNXA 2GTPA 3I28A 2YV1A 3B7GA 2Q1XA 1QF7A 4V3BA 3WQRA 1LDNA 1P73A 2XNJA 5ALWA 3VPDA 4BWVA 4DM4A 2NP7A 3L8GA 4OXQA 5ALSA 5JG7A 4ZU1X 5DDIP 2Q6OA 1RXUA 3HCEA 3ZHCA 3O92A 2QWXA 1JG3A 4CMHA 4XXHA 1GUAA 4L4SA 3QEMA 3GLFE 5DRYA 4N9WA 1DJPA 1S3GA 1N8SA 2I4LA 5CNKA 1DJQA 3FOZA 2P11A 1R0SA 3O9VA 4L72A 4AM8A 1AT1A 2VDLB 2Q62A 1IBCA 5SZHB 4YFYA 3SC6A 3QVMA 2WJHA 4B4WA 4WUVA 1YWGO 5C3MA 2CJWA 3RC3A 3KYCB 3DOFA 2IHTA 5J2TB 3DJYA 1YQQA 5EMKA 4RH0A 4BVAA 4Z53A 5ECYA 4EEZA 3QVXA 4LNUA 2GYUA 5F12A 3MWKA 3HCOA 5FI3A 2OD2A 3HCCA 4FBGA 3RVQA 1ZOPA 2D2FA 4F8JA 1CZRA 1KL7A 3GDOA 3UGQA 4CLOA 1JHXA 2C1XA 3D4IA 4UCQA 4OLBA 3TRIA 5HOEA 2WMNB 4LSZA 1DKMA 1P1BA 1XG5A 1RKXA 3PS9A 2I87A 3II6X 3J81A 3FSGD 2BI8A 2QM8A 2YWEA 1ZZGA 2W2LA 4MDFA 1L4YA 3OX4A 1XEFA 2VSFA 3TL2A 2H1RA 1F3LA 1Z6PA 1JU4A 2ZSAA 3GRYA 5JZSA 1VYHA 3I64A 4HDMA 1Y7HA 1LBQA 3RO7A 4OUDA 1ZK1A 5DYNA 4BO4A 1FLDA 2LCIA 4JBXA 3Q41A 4C6HA 5K7SA 4Z3OA 1EXDA 4XD7A 1KPIA 2BP7A 4TVOA 1RRFA 4MQFA 3ENKA 3MS7A 2AV6A 1F38A 2RGUA 1A8UA 5EQFA 2PUCA 3M1YA 3UUWA 3AVVA 1QP7A 1J0XO 1XEWY 5B7NA 2R1UA 1OWLA 1VYTA 3OWOA 5K4HA 4QWMA 1YHYA 3GNSA 3KYJB 4INAA 1UPCA 4YPOA 1H2AS 4E4YA 5K0CA 1EKXA 2QVLA 2P4SA 1DQRA 1HKHA 1D4OA 1P39A 2ANCA 2R2AA 4II3A 4QLOA 2WUVA 3RRBA 5FAXA 4L5CA 5SZJA 3MMXA 2CCGA 3OC6A 3AU9A 4W7IA 3JVDA 3TR5A 3WAGA 3QENA 4C4OA 1U2RA 3LUFA 3SNHA 3HRKA 2JFXA 4PONA 4KGZA 4GHWA 3DTTA 2GK3A 3I9JA 2BR4A 2VXOA 1O5OA 2QE7D 1DRUA 2WTXA 4FLMA 2V7BA 5DSZA 4NRDA 5EZ6B 5CEFA 1OVGA 2PA0A 3O8QA 2O8CB 4J16C 4PU0A 5C4GB 2VQEB 2FSIA 1OAOA 1ECFA 4JEMA 4C08A 1LBIA 1U3VA 1O8BA 2C1EA 2CNKA 3PKIA 4X1YB 2IS6A 2CFTA 2ZJAA 1VGRA 4MYSA 3DNPA 4RDCA 5EJMA 5B5SA 3G6WA 2X13A 1XPOA 5ESRA 4F3CA 4DLWA 1TLLA 3RUIA 4GQIA 1IM5A 3P9IA 4BVGA 2BYTA 3VC3A 3OBBA 4X8OA 1ULHA 3U62A 1EVQA 1C1YA 2C82A 4LN1A 1PWEA 5F3RA 4AW9A 3DMTA 3ROKA 1ORVA 5BQOA 4Q1FA 5EIXA 2YBDA 1ZAYA 3FZNA 4CM3A 3P5BA 4M3NA 4KPFC 3D4NA 2QDXA 3WLHA 5BVGB 2ES4A 3LYAA 5K8IA 3ADCA 1V1JA 4X54A 2AB0A 1AK2A 1W5EA 2CNLA 5IKXA 1NKTA 5ER9A 3DT9A 5TT1A 2W6JD 4H1HA 5AHXA 1DO8A 3ZXXA 1ESCA 4YASA 4MAMA 5KDDA 2MU1A 1M8GA 4F04A 4ZRDA 4ID3A 1MC1A 3TK1A 1QKKA 3LKDA 5JISA 3ISVA 1ZK4A 2GN2A 5H80A 2XTNA 2CE7A 4YIKA 4WZBA 5EIOA 4DQXA 5HXAA 3HU1A 2YC4C 3MWEA 2XUGA 3NW9A 2Q3LA 3PDUA 3VHXB 1RMYA 4BQIA 5DCYA 4B8YA 4B3XA 3F3YA 2WD9A 2Y1WA 4C01A 1UPTA 5K3OA 2KI5A 4CN8A 3SC2A 3PRJA 4QGSA 2H1OA 2WLSA 1DAMA 1HL3A 2N1BA 1ZD9A 2OCPA 1UZUA 4PNPA 5BN5A 4FM9A 3T7KA 1L8AA 2O3JA 1NA5A 1YK1A 3ABZA 1NSFA 2G4VA 4JAVC 1ZLXA 3PCTA 3RUEA 2WVHA 1JPVA 2ZPUA 2OAP1 3SEQA 4TMTA 1IG0A 4B5KA 2CFIA 3QU2A 5ALIA 2EKDA 3NWOA 4KXXA 4JYBA 2XRFA 1JVNA 5EKDA 3SS9X 3ES9A 4F3KA 3SICE 4OH7A 1CR2A 1QOPB 1JVBA 1WABA 1T0HB 2XTMA 3L6CA 3M8KA 2O8FB 3NGLA 2ZEJA 5E1OA 4XIJA 5E6UA 5TQJA 1C3JA 3DBRA 3N59A 2AS0A 4D45A 2FEAA 1K3UB 3Q1KA 3L0PA 1W0KA 3GZNA 4LA4A 1HFKA 3PDIB 4NCXA 4BV9A 4GAEA 3DHWC 4LWPA 3U7QA 3ZWQA 5HZKA 1XMPA 1MORA 1SBYA 3KPUA 3HPQA 4G1FA 3RG8A 3T0IA 1PNTA 4IIBA 1X7XA 1E5DA 1POWA 2ZAMA 1U4OA 3MUFA 4CMEA 3NORA 3FIUA 2X0FA 1NLFA 5LLTA 3PL1A 4ER6A 3LK7A 1GL9B 1UBLS 1HKUA 2CMHA 2ZWMA 1ISRA 4L51A 1SRQA 1USGA 2V55B 3R5KA 4LGVA 3Q5DA 4RJJA 3NALA 5TJ9A 2FLWA 4C43A 1O0BA 1W52X 2NT4A 3AHFA 1Z7WA 1I9GA 4CE6A 4KTTE 2GLXA 5U9CA 3V4VB 4E3ZA 1HMPA 1Z33A 2ORVA 1K2WA 3WYCA 1T8WA 2ZJ5A 1QHEA 2C92A 5TX7A 1DT5A 2ZB2A 2WP0A 1YRHA 1KJZA 1CVLA 4B2PA 3HLKA 4ML3A 5F1YA 2WR8A 2O1WA 1GG2A 1WBJB 3NBFA 1AB6A 1LI4A 4QHTA 4C05A 2QRPA 1J8DA 4QBTA 4OM8A 5GJCA 1FFXA 1II8B 1A8IA 2HYDA 2OILA 5KNDA 1A7JA 1QK4A 1M2JA 1QQ7A 2WUFA 1A88A 3KSUA 4J0JA 2H5EA 3K0CA 4ARBA 1SUPA 2J46A 3OESA 2HMYB 1VKZA 1NI4B 2HUPA 2OCIA 4WLEA 5ALPA 5TE9A 4R7GA 2I80A 5C31A 4UU8A 1HUQA 1QZTA 3IHKA 2I78A 3QHQA 3M33A 4GYJA 4KR7A 4DCPA 2VK1A 4E5SA 4A73A 1G8JA 4FWTA 2IXDA 1EE2A 4EY5A 2KQUA 1EYZA 2N9UA 3D1LA 2QKYA 2I1QA 1CUIA 4KXLA 4KYTA 5LD2B 2GZDA 5C80A 1Y4DE 3PE6A 3OJXA 4RF4A 3AYXB 2V6MA 4FVTA 1DX6A 1KIMA 2XA9A 4XFKA 3SBEA 3RAPR 2XLCA 2NSLA 3IUEA 3L7OA 2VBCA 3L43A 5KJFA 3HNOA 2R6R1 2VWHA 3PB3A 1UXJA 4LXUA 4QYIB 4GVXA 1J1ZA 4I4TA 3C5WP 1M5TA 3MD0A 1DRVA 2JRCA 1UDWA 2CFRA 3LY8A 5L6MB 1RHJA 4MEBA 2GXQA 2R1VA 3AV0B 1UK8A 2IH2A 3A27A 2AXPA 3GRRA 1VBFA 3NRCA 1KJ8A 2R8XA 2BM9A 4L0QA 5TY0A 6REQA 1PT5A 3W8DA 3L8ZA 4YAKA 3J80A 4LGCA 2CMGA 3AHIA 4A0HA 4YAEA 3STUA 1K66A 2OGUA 1L1EA 5G0TA 4CMIA 5JVDA 3ZVMA 2Y2VA 3U9SA 1ND5A 4B6GA 3X1MA 1IN4A 6REQB 4UUAA 4H9GA 2HN9A 3NS7A 5A03A 1WPGA 2DZDA 4NBWA 4MR7B 3TSWA 1YS6A 4KPUA 1XK7A 3B2EA 3QMMA 4YQZA 4LSWA 4TGLA 2J3JA 5ECGC 4BKQA 3JTMA 4IEIA 5BQ5A 3T94A 4RTJA 5IZCC 1JPUA 3ESRA 3EVBA 1P1KA 1M2HA 4OHVA 3PXGA 5K99A 2P30A 4IP0A 2R751 4BECA 1GXSA 3P96A 1V2HE 4A8PA 4P4SB 4KQIA 5F77A 5KNCA 2QIOA 1U5BB 3H3FA 1UFQA 2XDQA 3FFWA 3OCYA 5ER6A 3V1MA 2JLWA 1QFMA 3QKRA 1S2OA 1GNSA 2P4EA 1HF3A 3LC1O 1B0PA 4FGWA 1BH2A 1REQA 4OATA 1H66A 1Z6QA 2RHHA 3CSDA 2FEOA 2LDXA 4UUNA 4U2EA 5IUKC 1CDZA 1VLHA 2WT8A 2Z5LA 2PS0A 3GA5A 4O2BB 3TWOA 1N1MA 2DAPA 3UJ6A 1LTHR 4MZDA 2CFCA 3Q7PA 4HRAA 1YF3A 1GTL1 2BOVA 4OXKA 2I6UA 3VDRA 1IHXA 1MEEA 2W4MA 1LJ8A 4FFBB 3OLZA 1THMA 2VYCA 2I71A 3MUOA 5IXJA 3TOVA 1URPA 2PT5A 3OA2A 1ENOA 3E7PA 4HN2A 4TQGA 2FUEA 4N4AA 2PGLA 4BVHA 2X3FA 1Q20A 3ZDBA 3PGA1 4FBMA 3CH6A 4ARZA 4HAIA 3KJXA 3MCAA 4RIGA 1Q2UA 4Q4CA 3DEYX 5CFMA 1B3RA 1GRRA 4GKBA 2ODEA 4UD2A 5CHYA 3BCSA 4GE0A 3RU2A 3NH6A 4LW8A 3W6OA 3QMWA 1CIVA 3PXEA 4Q3EA 2A4KA 4JMPA 4YEDA 3C74A 3TQTA 1DC3A 4IDFA 4LMBA 5IUJC 3RNLA 3PI6A 5I9LA 4KBFA 5HUJA 3S2IA 4BAUA 5IG2A 3K6SB 5LBIA 1FU4A 1XD2B 4N1AA 2ZTUA 1KZ4A 3PITA 1R4ZA 3KLPX 3N7AA 3U3DA 4YCNA 1IBRA 2OLEA 5JZOA 5DBOA 2E4UA 1JH9A 1X3SA 2DHDA 2D8AA 3LLSA 3K6JA 3ICPA 4MOWA 1VJ0A 1F2UB 4CNBA 5FBWB 3G7UA 5FNVF 4KQMA 1KQGA 2B8TA 3GO4A 4WX2B 4ZC8A 2DFNA 4N76A 5CBPB 1E94E 4I1RA 1B93A 2ADOA 5K0LA 1T0JB 1A5ZA 1P5RA 4ALKA 3T7DA 1B2RA 4DDHA 3IQHX 3JQ6A 3R0ZA 4MYCA 5JS8A 2ECQA 3VVMA 3WYFA 1K7SN 1S8NA 2JH8A 4X7PA 4ZJYA 2FWIA 4XOUA 5AVOA 3OCVA 4YLYA 2MSEB 2YQ5A 1E9VA 5GMOA 5A0VA 2X86A 3NOVA 3TYXA 2PCLA 3RSCA 3HKEA 1NAHA 2VP6A 2QU8A 3CRRA 3VA7A 3U7QB 4RA6B 1CRLA 3IAHA 5L3RA 3OJ0A 1W73A 2C29D 1TVEA 2F3QA 4MVYA 1EBFA 5FI0B 3SNKA 1WZ2A 2OC9A 4F5YA 1M6HA 2VKQA 1CR0A 3O9MA 1ODTC 1DFIA 1PDVA 1FP2A 4KQXA 1V8FA 2FSVA 2Q45A 2ZYWX 3CLSD 3DEAA 3DM9B 4NAUA 2G36A 1XP8A 2Y0DA 2Y9MB 3VJRA 4UE3S 5IDXA 4FW8A 4V0QA 3GH3A 4W4TA 2R97A 5EJ9A 3GUZA 1N4AA 1N7IA 2ID8A 2QVZX 4URYR 4QUHA 1TF7A 2AJTA 3JVVA 3PRHA 1KJIA 4ZZIA 1X42A 1QYDA 2FUNB 4XGNA 3LO8A 3GNQA 3NGMA 1ESDA 2C7BA 4LHXA 2VF5X 3T5GA 1ORHA 2JRLA 3IT3A 3ELDA 5IJ9B 3CRVA 3NOQA 1RZRD 1B76A 4WERA 4HLDA 5FHQA 1PFQA 2J32A 3IBTA 1Q16A 5AM2A 4DR5B 1CPYA 4R6WA 3C5CA 3W79A 3CTPA 4LXYA 1UM9B 1BCRA 1EZZA 1Y37A 4JEHA 3FKJA 5KYXB 3GX1A 3HWSA 3QWHA 4KKXB 3A10A 4IDDA 1LZKA 1R1DA 5FNVA 2HHHB 2QX8A 2HLNA 5DULA 3TZ6A 2PANA 3MW8A 3SIXA 3FYDA 3VR5A 4LRTB 4M7OA 4KYVA 3IIIA 4O1IA 1CUZA 1R7RA 3M49A 3N5KA 4TVBA 4AN4A 4ZKDA 8ADHA 2GEFA 8OHMA 3UOGA 2ST1A 2WJYA 3GEEA 3K0CC 3CSUA 3T7RA 2P0YA 5KU7A 2UXBB 1NM5A 3UC5A 2QZSA 3PNOA 4OSPA 4RKQA 4HO1X 4M46A 2AN9A 1NJ8A 1WF6A 1M0TA 4QC2A 3NV9A 3WGGA 2JFHA 4MGZR 1M0EA 1OBCA 1YMQA 3MGCA 2IZ5A 1MQSA 2IHNA 2RI6A 4KP7A 3DOUA 5DCWA 4QOJA 5TMEA 2FUKA 5IJAA 2XJ9A 3PT9A 3STXA 4RNCA 2PT7A 3ZWWA 4MW5A 3BEDA 3C0KA 4HAYA 4F92B 1OZHA 1QO7A 1XNGA 5JSQA 3RARA 4CEIA 3PUZA 1IUOA 3N2YA 2UUCB 2WW8A 2FPLA 4GBJA 1DRKA 4QTUB 2A35A 2H7VA 5DTIA 4DSZA 3KETA 4EO7A 2PLFA 3EZNA 1IJEA 3I73A 5F2OA 1YT5A 3DFFA 4U7PB 4V0NA 2QT0A 3TPFA 2OXTA 5B1IA 1I2CA 4FOLA 1V47A 4BP3A 1U7TA 4DIKA 2Z9CA 1DWQA 3EUEA 4JWTA 2UYQA 3G9UA 3PK0A 3GVIA 4KPYA 1NLUA 2IJGX 1PFVA 4ISCA 4L4ZA 3CU5A 4ACAA 2GCNA 3AUKA 3OECA 4B35A 4D8XA 5J1SB 2HPVA 1UFVA 1TGVA 2OAEA 4HDNA 4RGQA 5HE9A 5FORA 3EXHA 2EG5A 3IUPA 2VATA 3KELA 3TVTA 3FUWA 4BIMA 2M98A 3KU4A 3VTAA 3E48A 3UNXA 3KOOA 3W6ZA 1IHPA 2JAPA 4KDRA 1X3LA 1ZPDA 2GN0A 3IUBA 2E4XA 3EXHB 4NFLA 4PNHA 5EXDA 1Y1SA 1XKQA 4E0BA 1W85A 3KDPA 1H9CA 1MABA 2AG1A 1SU4A 1UT6A 5BSGA 4FHDA 5IJXA 3VZDA 4FUQA 5I9MA 3S2FA 2RHCA 1KO7A 1DX9A 2CLSA 3EC7A 2K87A 3LY7A 5JNTA 3R4CA 4E6EA 3O3MB 2A3NA 4TKZA 2ZSIA 4R8VA 5EAIA 1ZM9A 1GSHA 4OF4A 3G2HA 3ZDYB 1UAAA 5ENDA 4AG5A 4DMKA 2VPWA 2OENG 3IDQA 1RFGE 5ERGB 4NCBA 3SPXA 3OE7A 1XZ8A 2JHPA 1HM5A 3NHZA 3ODGA 4OHWA 2ILTA 5D7NA 4KFSA 1G8YA 2LPMA 2D2XA 4LCJA 2O4UX 3FZYA 4JVOA 1A0OA 2Q5CA 2NM0A 4Q3BA 1ZVJA 3TSZA 5IZ4A 2G8NA 4MR9B 4EK9A 1JSRA 1SPXA 4CWAA 2PIAA 1X80B 1QGED 3W6NA 1WCYA 3TEFA 1MX1A 2EIXA 2X2OA 3D3QA 1YBHA 4LY0A 1QU3A 4L9AA 1E99A 3PJEA 2I66A 2W2XA 3FA2A 4G8BA 5JY6A 3PTAA 1P9RA 3M4JA 3ICEA 2IOFK 3PYLA 3WO0A 4BMYA 4ZYYA 4JROA 1JF8A 1VCIA 4D6PA 1DAEA 2XY4A 4QU5A 5AKIA 3THYB 2WWIA 3H18A 1TD1A 2EP8A 2IEYA 2WIGA 3NJ8A 2Q2WA 1T5BA 2H4HA 1Y34E 3HSSA 3F8SA 3PDCA 4HWTA 1NYRA 1I1NA 3LBAA 1AZSC 4IIEA 5DN6D 1Z06A 2MSDB 5IJ0B 3G0HA 3PFNA 1KH1A 1YIDA 3SQLA 3QPDA 2K4MA 1KETA 2GM3A 1RWVA 1VYUA 2NUPB 3ADOA 4HZUA 4QYWA 2J7KA 1U2DC 2J1LA 2KWIA 1AF4A 3RFCA 2CJFA 3RUCA 5KINB 4X7MA 2BHLA 4JN6B 1LW7A 5ALEA 1DFGA 2Z2XA 2I7CA 4BVJA 3KEOA 2VYVA 3F5MA 3QI2A 1GPH1 4RD1A 1TKAA 4BLSA 5ITWA 4YMLA 3FZGA 2WHPA 1ZH8A 2XE8A 4I7EA 3IRVA 4IS2A 4PWZA 1L8OA 2MTBA 3KD3A 1W9MA 2Z5VA 2ZB8A 5ALZA 4NESA 4UTNA 1NN3A 4BCDA 1SHKA 3MM4A 4DIFA 1R8YA 3CS3A 3JWHA 1JG4A 3NYIA 1E1QA 4J0HA 5EL0A 5G1NA 2H5JA 4LIPD 2W2OA 1XF9A 3I5MA 3OFKA 3WIVA 2QN3A 1C7RA 2VF4X 1EAMA 1JDZA 2I34A 5K3BA 4M88A 4XWWA 3OLQA 4B3MB 3JALB 3PD1A 4RE6A 1A4XA 1ISJA 1HI9A 2ZJ3A 4TM8A 5EXTA 1RAGA 1DXOA 1XLVA 3LUBA 4FYHA 3M6IA 4GMDA 2VTBA 4MEJA 3TJMA 1LJUA 4BFLA 1I94B 2OGTA 3BEOA 4YQFA 3MTAA 3D4LA 2YHAA 1TYCA 1G17A 4RSMA 5FQNA 5BNIA 3RRFA 3EAFA 1IONA 2BCEA 3EXAA 1YR2A 3DQQA 3FDJA 3MELA 4I66A 2X3UA 3BXZA 4K6KA 4L3VA 2CF6A 3PT5A 3IT0A 1EEHA 1S4QA 1WP4A 4HH4A 4DYVA 6PFKA 1E6LA 4G5FA 4D4KA 4IKOA 1NVGA 1XYYA 1DS6A 4ZAFA 4EHFA 3TD9A 1HYEA 4Y9TA 4CR6A 3AL2A 3LQYA 4EHKA 5B4TA 4UOZA 4G5SA 3H9BA 3GBPA 2GYWA 1QYRA 1KPHA 2P9GA 1JXMA 1MO5A 2PLNA 3K0KA 4HV4A 2PRZA 4EEXA 4ZVQA 1T8TA 2ZI4A 1CJKC 4H7FA 3L6DA 4JJ8A 4Z9XA 1BIFA 2Y77A 3I6ZA 2X2FA 3C8UA 4LKOA 4DREA 4LXHA 1WXDA 5HVNA 5K0BA 4G0VA 2GEJA 2PUTA 4AF8A 2OPHA 3N0VA 2FTKE 5KOHB 1R37A 1IZ9A 1P1FA 1ECLA 2JVJA 4LJLA 4UHEA 4WASA 5CHEA 3RVLA 4YCCA 4DKXA 2XT0A 4IH9A 1XVUA 2GBIA 2FEMA 1MHPA 1SQGA 3ID6C 2ZUBA 4WLNA 5CB4A 3LT4A 3O5AA 5F52A 2NMVA 1XOIA 1QIDA 3N0RA 1F06A 3D3KA 5AHWA 4CFSA 1E4OA 2GZ2A 5DLQC 3ERCA 4RJKA 3FZQA 2Q49A 5FWXA 4CCWA 3KB2A 5LD2C 1QIMA 3LX4A 4O4LA 5JATA 2V7GA 2EJTA 4AVYA 5IH3A 2PGDA 2YWFA 1A5SB 4GYKA 1RAAA 4LYAA 4OLJA 4OJYA 4QRIA 2ZE7A 1A9SA 1VL0A 1Z4PX 2R7NA 1Y5RA 1UJ5A 1HOXA 3BWYA 1IM2A 1IOVA 3F9CA 4D81A 3QWIA 1BDMA 2I1LA 5MN6A 1DOZA 2WTNA 3V2IA 4AJ9A 1OXKB 3O8BA 5HK8A 5JNLA 3P26A 2A1IA 2PSFA 3SYTA 3IPYA 3PWSA 1YMUA 2I6TA 3RUDA 2NZJA 5LP6B 2NWQA 5CTAA 3O8DA 1HURA 5HS4A 4R1PA 4EKDA 3WKDA 1M1ZA 5LKAA 4BDTA 2H8GA 3ZGZA 2W43A 3E3LA 4I36A 2ZBPA 5LUBA 2PNJA 3ZLBA 4GEKA 2DFDA 1VLLA 2FKNA 2J3MA 1Q3TA 2JAHA 3Q9UA 4QOHA 1X15A 4ZGGA 4ZYVA 5B57C 3L4KA 5H81A 3A31A 2QIPA 3RSHA 4ZYUA 1O0CA 3CE9A 3CISA 3K3PA 4D3YA 3LS2A 2H2DA 3EVGA 1N6NA 1QV7A 3VNQA 3JR3A 1VCHA 3UGJA 4HDOB 3SX2A 4GWKA 1N2OA 1V8OA 3P0HA 1VPLA 2CHGA 1Y1KE 1W25A 2YMLA 2ZJ6A 1R0ZA 1SR8A 2FW0A 4W9MC 5MHTA 2FMFA 3ONEA 3WIEA 2QSZA 4EKEA 3EIEA 4ATNA 5I4CA 3QX9A 3WK5A 5DHAA 4MNTA 1FLNA 4NYMR 4B7CA 3A11A 3ETDA 2I55A 2X0RA 2YXPX 1CBUA 4JUFA 1IATA 4O4LF 3E0XA 3OQBA 3VR4D 3M3PA 1ZY2A 4UUBA 3ZKWA 2WLTA 3B3QA 3UMMA 4R9UC 1HTTA 1YULA 1GZSA 3SYLA 3BCHA 3W5DA 1OF1A 4FFPA 4I4IA 4DIEA 3QY9A 4PFSA 3BSFA 4UVEA 1WVGA 5DRTA 2QTRA 1RBMA 3CRMA 2ZB4A 1UUFA 2XIJA 5DKFA 3LGAA 1V9SA 1KGSA 1I1HA 1YRAA 5KTMA 5FBHA 3QUTA 3CLUC 3CVWA 1YVUA 4OHPA 1BEEA 1L7RA 3GT0A 3H65A 4KLCA 2P3OA 4Q3OA 5JAMA 5K45A 2JBHA 4M49A 2XGMA 3CB2A 5TGTA 5IYZA 3ZJVA 1GGHA 4FCWA 2JIBA 5JSYA 2NN3C 2H48A 3KPJA 4IWNA 1QX3A 3MTIA 4NOLA 4CMCA 4DMLA 4S0XA 3LF2A 3AG6A 3CUTA 6YASA 5AM1A 4F93B 1CJMA 4BVFA 3N2IA 2QE6A 2RHWA 3DVAB 3WRXA 3HA2A 5KNCD 2FW8A 5AVRA 3B12A 1WZCA 3B85A 1TZBA 2FPGB 2HX1A 3BSSA 3FYTA 1CU1A 3A7DA 4NP6A 4ZAYA 5L6LB 1GFIA 3JATA 3UWSA 1YCHA 4Y2YA 3K9NA 2W6PA 1Y42X 3I8OA 4OB6A 3NHLA 1OTYA 5DNYB 1I4LD 4AAYA 3P0FA 1NUTA 3DGFC 4M89A 1H0HA 5G0VA 2IY8A 3L7YA 4MS3A 1AQUA 1MN6A 3PEVA 3R0XA 4Y67A 4BYGA 4ZZ1A 3LKVA 1VPTA 1HEYA 3BA1A 4B44A 2ODBA 1JNXX 1FFXB 1SN7A 2Y4OA 1A9RA 4E4RA 1JKJA 1DTSA 1JDTA 3G2KA 1NMYA 3EWNA 1HQDA 3BCUA 3CW8X 4Q5IA 5EJEA 3E3OA 1CEQA 1M3SA 1WB4A 4G0XA 4YJ3B 2C8VA 4FD3A 1D04A 1OXSC 4U7WA 3R9WA 1BGWA 2O05A 2FMXA 1SK9A 3GVPA 1KZ7B 3HVJA 2YV4A 4GEGA 3GJXC 1E1KA 1Z5PA 1MJFA 2OAGA 2ZI6A 4J0DA 4Q4DA 4XJXA 2OQ2A 4V0LA 1DZ3A 1YZVA 2JCXA 1L9KA 3JQAA 4HADA 1HDRA 4MUAA 4ZVOA 3BJEA 2OL4A 4Y9DA 2HT1A 1EE1A 2QUKA 3RANA 1LNQA 1LBTA 3FR7A 2W6IA 2NXCA 4GGPA 3PGMA 3M5WA 3ZHZA 1IWPB 4YJ2B 3B3FA 4L95C 4OUKX 5I6DA 5BOSB 2XUOA 1EFUA 3PTLA 2CUKA 4TSFD 4NBTA 4YLEA 1OXBB 3DO8A 3LY5A 1GY8A 1LLDA 1S1MA 5AKJA 6CHYA 3G7NA 1A9XB 1FFSA 4UEWA 1NX6A 2QRKA 5DGIA 3ZZ0A 1KY3A 5IFKA 3K15A 1C8LA 1MTZA 3FBGA 1AV6A 1I3KA 3LGXA 5EMHA 1KSHA 2OGSA 1F1BA 4YMWA 4ZT7A 1SBHA 2VHCA 4QFBA 4WH0A 4BX2A 3U6BA 3KQNA 3FTFA 1EVLA 4G97A 2X58A 1G8GA 3BPSA 1H3EA 2C7VA 4GL4A 5CNMA 3U4DA 1L3CA 3G1WA 5LDDC 4U2FA 1FTWA 4FFBA 4RCZA 5T3YA 1ZD8A 5FX2A 1UP4A 3O4JA 4YQYA 1EDBA 5JEEA 1BTOA 3MOSA 1FDOA 2IXBA 1E1RA 1YS1X 2QTLA 5DJ5A 2PKYX 3BMOA 3K4HA 5AK4A 3LQKA 4BOYA 1TT5B 3PA8A 1PQUA 1POXA 2O9JA 2VS1A 3A37A 3KWMA 4WVLA 1SIWA 5EE3A 2XCLA 1JQ5A 2X40A 2P9TA 3NC0C 3AHJA 2AOTA 3WL8A 3WVNA 4A8JB 1Q0LA 1M7BA 1VIYA 1DRJA 3QNUA 3JQQA 4JR2A 1UXHA 2ZDQA 3UFXA 2VUHB 3DE0X 4RU1A 4DUGA 4U2GA 4EBBA 1K89A 3AO0B 4U7DA 1O94A 1QR6A 1WXWA 2G63A 4ABTA 4LFAB 2KB0A 1F5SA 3K4PA 4H1VA 4E70A 5AFSA 1ECBA 4XYBA 3PCXA 1M6NA 2HSDA 3B3JA 3H83A 3SK0A 4ETWA 2XNHA 3G88A 4PRLA 4DZTA 4CEHA 3TE7A 1NW4A 2TECE 3B1KA 3A04A 1M83A 4Q1VA 4B81A 3E7WA 4XWTA 4CMIB 4KI7A 1QRSA 4KQKA 3UAVA 3ANLA 1B15A 3DQZA 3HB4X 3K09C 1A71A 3GFPA 3H86A 4O2RA 4QPNA 1KDRA 4OGLA 4G9EA 1QWSA 2QR2A 4JLSA 4ZDWA 4AG3A 4RTPA 3JQ9C 2I4IA 2P2NA 3ZQ4A 3JQPA 1O5IA 1SO8A 1FZTA 1VJGA 3WDMA 3BVPA 3CVVA 3O7MA 4G84A 3EPKA 4BN5A 1JA1A 1QRDA 4R1MA 3GGOA 4WUTA 3QQ5A 1TEHA 2C4MA 3K1YA 3WYBA 1KU6A 3GL9A 3OC0A 1Z0KA 2GK4A 4UFNA 4UOQA 5EJ5A 4U7GA 4INJA 1WB6A 3HNRA 2VHXA 4PLZA 2XD4A 4YHHB 1FP7A 1NVVR 2RHTA 2CD7A 4U9HS 1RYDA 4B0OA 2HJSA 2YX1A 4ZO6A 4KFCA 5A3SA 1II0A 3L5KA 3QVLA 1RYYA 1W29A 2VYNA 4EG3A 3U4QB 1UJCA 4RQTA 4TL9A 3T5PA 1N3YA 3O2QB 4W7SA 3ZCSA 5TPWB 1NW8A 3E3NA 3WSWA 1QIGA 2Z3ZA 5T57A 1NVXQ 3FLMA 4L4XA 1KK1A 3I2FA 4R1LA 4XE5A 2XUZA 3UW3A 2IEGA 2VSQA 4Z9YA 5AKGA 3NYQA 4W9NC 1Z8DA 3NNNA 4DE5A 1WR8A 3QE0A 4FNOA 1GGKA 1XZDA 1IHOA 1HGXA 2LCFA 5CCXA 4NKRA 1HYBA 5KHLB 2HI0A 2IU0A 3LQFA 4WLOA 4BC1A 4DV6B 1CSEE 1ZVVA 1X1EA 4GLBA 3SQMA 2PU7A 4J6EA 3QBTA 1OPXA 4ZQEA 4R5MA 4KO2S 3MIZA 5T8KA 1SVLA 6GPBA 1W9HA 2N42A 4BN0A 3BCRA 5KSYA 1JQ3A 5FLYA 3U4CA 1Z7GA 2QB5A 2IS2A 4ZAZA 4ZP1A 1W44A 2G83A 1EK2A 1RYZA 4QGFA 3ZBTA 3MG9A 2Q3MA 5AOVA 5LIRA 5LXTF 5A06A 4QNNA 3FKSD 1FDIA 1SZJG 3PHIA 1EM8B 2AK2A 4D7AA 1YGPA 1T0BA 2BFBB 1A82A 3AFMA 2FE4A 3K30A 2GJSA 5HKBA 3M5DA 1XRNA 1ZX1A 2JLAA 4M83A 4ETIA 4A8TA 1L4MA 5IDWA 4O6VA 4DGSA 5JSUA 2FSGA 2GBFA 2PGAA 1F2TB 2GHQA 1J24A 2CVZA 1RHRA 3F1KA 3PFBA 1FVFA 1M6VA 4FEGA 5A2QA 4K3VA 2QHXA 4LI0A 3S0JA 2VHWA 2VPQA 4IIHA 5CPFA 2C9DA 1IJBA 2W9XA 4AP5A 3FI9A 2WVJA 4HLCA 4OYHA 3VHXA 1TZMA 4ZMSA 3ML1A 2PYZA 2DC1A 4G65A 4DNFA 4V0OA 7ABPA 4YWHA 5H1YA 4R1SA 2QG4A 1JQEA 2WQ6A 3E53A 2CVFA 5AK6A 4ZRMA 1Z2NX 3GRCA 5HJEA 4NCJA 2Y0CA 2IP2A 5E7JA 2LZ0A 4FE7A 3VFDA 2E4YA 2BEKA 2JBWA 2QTMA 3EY9A 4L74A 1RIFA 4QZVA 2IIQA 4NX2A 3ZY2A 3S5UA 3VZPA 4JK3A 2ZT7A 5AM4A 4FINA 1DPFA 1LQTA 3AERB 4AWAA 1MRNA 3PVZA 2NO0A 3SKVA 4P4GA 5AQ1A 5AW7A 3PYXA 4N5HX 3UH0A 3KZXA 5EMLA 1JB9A 3D7KA 1Y82A 4FZVA 1GNTA 3EPRA 2G9ZA 1L5SA 1X70A 2HJGA 1CG6A 2YR0A 1H2HA 3OE7D 1P1IA 3L8FA 4JWKA 4EA8A 1BXRB 1U9IC 2AWOA 4B3TB 4IXMA 2UUPA 4AJ1A 2ATXA 1LNSA 4YJGA 5EUQB 5LWQA 5KWSA 4IG4A 1N2CA 1HK7A 3B8HA 1CQIA 1BX1A 1QG6A 2Y6UA 3LYLA 1GQQA 3KZOA 3CE6A 3OCZA 4OFWA 4HX5A 1UL1X 2BEVA 3ZJ4A 4EB8A 5KX5A 1YRLA 3NDRA 3EGXA 4EYQA 4D3DA 1QQ5A 2MYPA 3QWFA 1M2KA 3JW8A 2MMGA 4MINA 4XB2A 4DWJA 2BGWA 4C89A 4GX5A 1UC5B 2OORC 4LDRA 4KXVA 2Z57A 4NAVA 3UH1A 2DHCA 2XWPA 1TX4B 5FUYA 4MQMA 1YCGA 2WKQA 2PKXA 3STVA 3WL3A 1F5NA 3OLVA 2YKGA 1AHPA 2P6UA 1HLFA 4RETA 5BV1A 4YIHA 1QM5A 4MVCA 1N6OA 4QUEA 1S1CA 4LRWA 1C7ZA 1E1CB 3KWJA 4HYYA 2BGUA 1Z0UA 1TU3A 3GT4A 2A5GA 3UB4A 5JYDA 2Y05A 4WLUA 1SHTX 1Y1PA 3VISA 3VV2A 1TIBA 3BMNB 4X65B 1Y6GA 1ZD1A 4CQMB 4YRQA 3TQOA 1N3IA 4C0BA 3QLTA 1BG6A 2VPIA 4PCLA 3B9PA 1PKXA 5LVAA 1ENPA 2GK7A 1ENYA 2VFAA 4G8CA 1BA3A 2JGDA 3MMSA 1IY8A 1DIAA 4NYJR 1RXWA 1RKUA 1OKKD 1SZPA 4CPDA 4XSGA 4PNEA 2PXAA 4GXNA 3LLCA 3HB7A 4ESOA 3DYIA 5KYWB 4JL6A 1JLLA 1MX9A 2VL7A 4B2LA 4FWBA 4JBLA 4JXXA 5JQGF 3MRXA 3I09A 3I37X 1EFRD 3MA0A 1BXGB 2FX2A 1E3LA 4IEFB 1RE0A 5K8CA 2KW5A 1PNQA 5A4FS 1ETHA 3F90A 3ZWMA 1CCWA 3ZC3A 3SKYA 2Q1SA 5JYCA 4MUXA 3DVAA 4B0PA 3QJYA 1QOZA 1AIPA 2QNBA 4B4UA 3KKPA 4H1UA 1DG9A 4IR7A 3EW9A 4F12A 4N3NA 3VMFA 2GJKA 3EZ9A 3G9XA 4GP6A 2GLTA 1T1IA 1T9DA 2WKWA 4F1KA 1FX0A 4YUXA 5B7PA 3I9LA 2Q21A 1TGYA 4L5JA 4Q6BA 1XVIA 1ZI6A 3A0UA 3EQZA 3LZDA 1NVEA 2ZIFA 1O77A 2FEPA 4Z8YA 3Q8KA 2XBUA 3KDSE 4WESB 1H6AA 3EGEA 4YO7A 4D8VA 1VE6A 1A7KA 4MUGA 4KHPB 1XKXA 2A4MA 3K9GA 4RSHA 1GQ2A 5EUCA 4EHIA 1OLSA 2ZQ5A 1IQ0A 1U0OC 1VLQA 5IDYA 2OD7A 4A82A 1GCAA 2VZ8A 4Z0TA 1J21A 1PZEA 3LG2A 2OKCA 5CX1B 2OQVA 3FI0A 4H31A 4CR8A 4BP8A 2Q4DA 4LISA 3EW7A 4EFMA 5K05A 3L0CA 5PNTA 3QKRB 1W4RA 3FPFA 4JFAA 5U1PA 1NR1A 4QBHA 2EYQA 4WXPA 2JHFA 1NF8A 3K92A 3ZIDA 4EZEA 3I42A 1O03A 4YUYA 4X1KB 5EP2A 2FRXA 1UPXA 221PA 1T4BA 3BORA 3MN1A 1N2GA 5CCDA 2RC5A 1X1BA 2DWQA 1ZW6A 1SY7A 2HU5A 2EWWA 4UNNA 4NONA 1PJ8A 1GA1A 1XZGA 2C0CA 2WWVD 4P7FA 3VKFA 5BT8A 5JWHA 4HEJA 4AUEA 5LL6P 2YNMA 1NVWQ 4Y6RA 4ZXPA 2FOIA 5IWAB 2ZAIA 3MTQA 4MIKA 3EULA 1XROA 4URXR 3IAEA 3RS2A 3LC0A 5HR5A 2OM6A 2H7XA 5JMTA 3BC1A 3NT2A 3C70A 1A8HA 3QEMB 3R7LA 3HJRA 4EGAA 1SK8A 4CF6A 1E0SA 1VIVA 3HCAA 1QAMA 4FSXA 4LJ5A 4QHYA 3C4JA 2RE8A 1VI2A 3RV4A 3ZH2A 2NXNA 1F8XA 2OV6A 3P2MA 3LHDA 4OHBA 1ISHA 3CW2A 3WGZA 5D5HA 1YB7A 4BO8A 1XP5A 4WXYB 3TCNA 1TVKB 1W49A 4FEYA 3OZCA 5KQGA 2PQ0A 4MYRA 4HNRA 3WIDA 3UWMA 1CZLA 2V8OA 4R1QA 2CLOB 1D6MA 2Q4OA 3O3OB 4TN1A 4BPBA 1PVOA 1FYXA 2XDQB 2XJ4A 3KX2A 2C4NA 5LA6F 2ERYA 4BFCA 4JLMA 1QBKC 2R11A 1JIUA 4L5YA 4CLRA 1RAIA 4Q66C 2MIIA 4RK0A 1R8JA 1K5PA 4L8WB 4D4HA 5CDSA 3VC2A 3O8CA 1PEAA 2PSEA 1PV4A 2QQ5A 1C1XA 1OYWA 4WCDA 1DC7A 1OFTA 2OFWA 4ENUA 4QAJA 4JI0B 4FMPA 2I3BA 3RS9A 1I4OA 1IXZA 1FNBA 1JWBB 2HHCA 4FE3A 3PHCA 3SDSA 5CXQA 3D4PA 1WSAA 3K70D 1U2EA 1G291 5C37A 1J99A 3C5VA 3V8MA 2B6NA 1NUPA 5J5VA 4JUCA 4XJVA 2P0EA 3DAPA 4ZVPA 4AK9A 2D1QA 4YCMA 2C00A 3E2MA 3GCGA 3QWBA 2R9VA 3ZV5A 4BJ3A 4C5BA 1AMUA 4NLLA 2RSLA 2EFEB 1HYGA 1TYAE 3B1WA 2O2ZA 2P9CA 3G0CA 3NM6B 4A6PA 1X7WB 5DE3A 3V3KA 5C5IA 1UZLA 5KYNA 4HP8A 4PZZA 2HKIA 4EUNA 2OPBA 1WU8A 4MUKA 2C57A 4RIIA 3WKBA 2BT4A 1M5UA 5FA6A 1A97A 3REQB 3OU2A 1K3TA 4M8LA 2GD1O 5CK4A 1HBJA 4M21A 1YOVA 1C8BA 3U40A 5EIFA 2XRZA 3OTIA 3T3HA 4DA9A 5AI5A 1S9DA 1XNJA 2IHKA 1I2AA 1RW4A 1XU7A 2LGJA 3JQFC 4I5GA 5EQTA 4BZPA 4F4JA 1HQYE 3GARA 5TT0A 1L1RA 4C0WA 5CA1B 4HGYA 2XQFA 3BJRA 3LP8A 4TWBA 1GVHA 1GITA 1YIOA 1LY1A 2MSLA 2NACA 4DDMA 5I3ZA 3TLYA 3MJRA 1TQ6A 3QBVA 4A2PA 4D74A 5FL7A 4EAAA 2XB6A 3UMJA 4JU8A 1ZCFA 5C1IA 2X15A 5F73A 2VQ6A 1W2GA 4GOMD 1NXTA 1E96A 2AZTA 2JANA 2QQEA 3OD1A 2HY7A 1LC3A 1N0VC 3BJZA 1MZPA 1TO2E 3MRVA 2VP5A 3NTXA 4P4TA 2IHUA 3NEPX 2JGJA 4RJTA 2CV2A 2C7PA 4FJ0A 5TS2A 2FZKA 5HZMA 2PMFA 2WAAA 3GJ6A 4P7GA 2QEQA 2XNKA 4EG8A 1VPEA 1K92A 1Q1AA 2AA3A 2GAAA 1QUEA 2OO3A 5JZVA 2ZM5A 3I32A 5IYZF 3BS4A 5I5EA 4FMCB 3RRYA 1OAAA 1G7CA 2XOXA 1B1CA 1UBSB 1ULBA 3H2ZA 3EK2A 3IAXA 3IP6A 5L45A 4UARA 2O2YA 4BGUA 3WNVA 2Y6VA 5DNVA 1SG9A 2EQ5A 2PS1A 2WYIA 3CUUA 5JMOA 1AO3A 1A76A 4AYWA 1VSQA 3Q15C 2JCVA 2EL7A 4KR3A 1YONA 4G26A 2FNAA 3GRPA 5T4HA 1J07A 4FYYA 4B43A 4EELA 4EHNA 1I6MA 3C6ZA 4UDYX 2LCQA 1QZXA 4D9GA 1DT3A 1KAHA 1QYIA 3CZMA 4OQEA 4P3XA 4EYSA 4GMKA 2W6CX 4E2WA 3EDYA 3QKSA 1Z5UA 5A9TA 3W7BA 1NW7A 3SLKA 2PDAA 2QVCA 3DXXA 5DM0A 5DSXA 3LWDA 4BVBA 1ZM2A 2PD3A 4P2GA 2W0MA 1GZVA 4F3YA 1Q1GA 2DPXA 2BAGA 5K6TA 2RD2A 4G4JA 1E7MA 3LW8A 3QG5A 2OBLA 4MV1A 3PDIA 4RHCA 5TV2A 1XXHB 3QIVA 2G80A 3A4IA 1Q0ZA 2I2XB 1IIBA 2ZW9A 3A4YA 3CPHA 3LKZA 3D2CA 3P0RA 5IHPA 2JLZA 4S1PA 3V55A 2AFIE 2Y1KA 5LZ5A 4UTPA 4M7PA 2TSYB 4M53A 2FDXA 1WPQA 1KJYA 3URMA 3H3JA 1ULSA 2QU7A 1YJAA 3LCUA 1LTQA 1UM9A 1YR8A 5HX7A 2NUTB 1NVVQ 3DYBA 3OIFA 3PYMA 4UBMA 3KKZA 4LNAA 3JZIA 4X00A 2VPTA 3VAYA 4JB2A 4QYXA 3IT2A 3RTGA 3VPAA 4KMMA 2Q8QA 2GKGA 2P9BA 1ULAA 3LZ6A 2W70A 3VR4H 4Y1RB 2XB9A 1U28A 1KY5A 4YRLA 4QLAA 4FZ3A 1SKYB 1NVMB 3CZCA 2PVPA 5ED4A 1MO4A 3NAGA 1ADYA 2PWZA 2ZR7A 5AJHA 5BN5B 3WGMA 4L9SA 1M73E 4G25A 4DILA 5IM4F 3ZEIA 4ZVKA 2ZG6A 3OEHA 4TX1A 2G17A 1RQNA 3HR4A 2HBYA 4Q37A 1UK6A 2BM8A 2KLHA 2VTDA 3AJDA 3KVYA 4ARAA 4RGYA 1RMQA 4AKSA 4BLWA 4CGYA 4YP1A 5E3JA 4XUEA 4MUBA 1ZD3A 1H1TA 2VJDA 2XVMA 4XR4A 1DO2A 3ASUA 3MQ4A 3OPQA 2X8JB 1CDOA 2Z04A 2RARA 5HIMA 3IL2A 4R9SA 3HJUA 4OMCA 1XZBA 3UT5A 4OU4A 3RF6A 5ECDA 4IS3A 3KUKA 3RS8A 4HFJA 2R85A 1NUQA 3R6DA 2O3RA 1T35A 4R1OA 1LDEA 2G9RA 3F4KA 4WA8A 4JT4A 4CDNA 1UKVY 3PNQA 1CRQA 2XYPA 3JQCA 3UQYS 1TEVA 1GQRA 2CBZA 1C3VA 2VYQA 3EGDB 3KTAA 3EA4A 1Y4ZA 4WCVA 3T7IA 5T4EA 3JWGA 1TXGA 2Q1YA 1EB9A 2I4MA 2FQXA 1U2QA 4HOYA 4QGHA 3RI3A 4A6DA 4ZYXA 3AUSA 3MCVA 1RRCA 4KREA 4J7XA 4C7OA 4UKDA 5KOJA 3WYDA 2N3ZA 1D6SA 1C50A 3QE2A 3QW4B 1K7XB 3ZGLA 3ZNQA 1CF9A 2OZPA 4Y7CA 3OUUA 5AJYA 3NWPA 1YB6A 2QXYA 3NOXA 4Y2SA 1L5YA 3UKDA 5CIQA 3WP0A 4U63A 2VHJA 5B6IA 4ZI2A 4K6GA 5AVYA 3D0KA 4JU9A 1P80A 3QF7A 5AM5A 3TQFA 1KJJA 5BWBA 2MHCA 3ABOB 3HBAA 4HQLA 3WK9A 1CJTC 1KDVA 4EPTA 3HJBA 3ZZTA 2GHTA 2PLRA 5EE5B 5BYBA 3G5MA 4P22A 3TZKA 6AT1A 3GROA 1MABB 1TO6A 2JAUA 4JSRA 1OGIA 1D6NA 2O8DA 1IBSA 2ACKA 2EATA 5HCUA 5BRNA 2WU0A 1IZ7A 4U8HA 2VTBB 1TB4A 4QYTA 121PA 1D0VA 1E59A 1ZRHA 1LLQA 3KZKA 4GOKA 4MV8A 3PXXA 1FSSA 2ZAGA 3IOCA 4NU8X 2WU8A 3KLBA 1SGWA 4CDMA 4K2AA 3UYLA 4TZ0A 4MYTA 1Z7YA 1OIWA 5KJCA 2CEKA 1PGQA 5FTKA 1U8FO 3C3AA 2F3PA 3EHDA 4CCSA 5KVSA 3OIGA 3QMPA 4PYQA 1NZJA 2J9XB 1W34A 4YPFA 3ADKA 3DVRX 3DZ8A 3WHIA 3IV7A 5C3UA 4WT7A 1EX6A 4AIRA 2XW6A 4XM2A 5BQFA 1S5PA 3L4SO 4Z99A 1ODJA 1UBUS 1RWXA 1T2VA 3NNDA 3QJGA 4RK5A 5K6AC 4AZ3A 4G09A 3T9CA 4JUAA 1OWNA 2LDBA 5HKLA 3TQQA 3LUKA 4CMEC 1TM1E 2X9LA 4BFVA 4RLFA 5DK4A 3R7WB 4UBIA 2V7PA 1Z68A 4PZCA 4A1OA 3JRNA 1JE1A 2PQ2A 1FXWA 1Z35A 4IO0A 1QAOA 2AFIB 4NBKA 3O83A 2WTBA 4QUDA 5H02A 1SUIA 2WJJA 4Y30A 1FW6A 3BBPA 3DAHA 2EX1A 3W1VA 4RL4A 2G9UA 2X8LA 5CDFE 4TTRA 1JMYA 2ZSDA 4RM3A 4PAQA 3ZLTA 2ZRLA 3L8DA 2QG9A 1ZCZA 2VJMB 5EXXA 4ZQIA 1MEJA 4K1LA 2W8BB 5DN6A 1XTRA 3UFBA 4MVXA 2B5WA 2HJ9A 4CN9A 4UCWA 2M32A 1MFZA 2FB9A 3UHOA 2FA9A 3OO0A 1IMJA 2BMVA 1UMDB 4FIDA 1OC4A 2GKOA 5BNFA 5JCJD 3ZTWA 4R0NA 3PPWA 2I7VA 1GDHA 2W42A 4FXOA 2A92A 3SJBA 3MFQA 5B1DA 2CNNA 4JJIA 1CUXA 1HTWA 5H3CA 1GN8A 4I1OA 2HFJA 3P27A 3ITNA 2I2CA 3DEZA 2R6DA 1QPZA 5AVKA 3FTEA 1XN1A 2JJ8A 2C94A 3CLHA 1JFRA 4ZTUB 1FF9A 2QP4A 3LRTA 5COQA 1SQ5A 1Y6QA 4YGYA 4E12A 4MROA 1XYVA 2C77A 2WHEA 2G0NA 3IA2A 4JQZA 3SLRA 2BFAA 4N6GA 1RQRA 4FR0A 4PGFA 2IYQA 4FGZA 1JP7A 2D2VA 1DINA 5A7GA 1IZ0A 3R74A 2FYTA 1F6BA 1B6TA 3KB6A 1M6VB 3T41A 4D56A 2X76A 5ILQA 3BFKA 3E7FA 3GJ4A 2B3TA 3AF1A 1G21A 2C5LA 4KQWA 3UMVA 1HDEA 4M9XA 1LK5A 3G2LA 5GJWC 2IE8A 3IE1A 1F12A 1NMSA 1T3HA 5GGXA 3KJEA 1CDDA 3FSRA 2P2DA 3PIRA 3RYHB 1Q7EA 4PLGA 1NDQA 1DEXA 1PG2A 2NQ2C 3RUFA 5E1BA 1I2MA 1QHFA 3QRWA 5I51A 2XWSA 2GX6A 2NO4A 4LG1A 2ZVPX 4QUIA 1JWAB 1THZA 2B5VA 2IOYA 2C3UA 2VR1A 2WD7B 3I1IA 4LNHA 3TTTA 1FDWA 4IIVA 5C1PA 4CIYA 2LUOA 2X1VA 3LO5A 1HQKA 1J5PA 4XDYA 3EVTA 1NYQA 4NEHB 2NU8A 1RXSA 2VNIA 5ILOA 1FDVA 3QY0A 5JR3A 2PGOA 3HCDA 2FZEA 4PPNA 4HNHA 4Z54A 4KX3A 3GJ5A 1NL3A 1U6KA 1W1IA 2COKA 2V97A 3LI2A 3IE2A 4B17A 1ES9A 1P4AA 3M9WA 5BNTA 5SZIA 1L5WA 2X0KA 2QP3A 3W7AA 2AJLI 2WWTA 1KFCB 4QJ3A 1PVVA 1L1QA 3ZWVA 1T5IA 3JPWA 3NDIA 1GEGA 3RQIA 4EY6A 1A5BB 1K6XA 1AUOA 3LXUX 5L4NA 4IF4A 1O08A 3V4PB 2Z0MA 2I4OA 3PQ6A 1Z0AA 4BVEA 1QOQB 2A0KA 3VDNB 4RCVA 1PRYA 3LPCA 1C4WA 1W4BA 5CYFA 2BFCB 3WLLA 1P2FA 3HO8A 2J6CA 2R4QA 4RENA 4DPKA 1M34B 3IEMA 4NNPA 4V2IA 5IVHA 1QKJA 1E0JA 3FX2A 2CC2A 3JARA 4OB7A 1X94A 2AFHA 4LC0A 3VU3A 4D0RA 2MSWA 2W6MA 1VE7A 3OT1B 4TVKA 1L5RA 1PBTA 2AQKA 3CLSC 3LOQA 5EEGA 4Q9JA 2WHYA 2XWJI 4YJGB 5LQRA 5CURA 4H3VA 1YBVA 4NU5A 4IHAA 3WGYA 1C0KA 3TECE 3O4IA 4PG5A 4PO3X 4P54A 5AVUA 2YZKA 4O25A 3ASVA 2BSQA 3MPUA 1FL9A 1VGVA 1NQVA 3SFTA 3FPEA 3OZSA 3OHMA 4US2R 2HJHA 1G59A 1S8FA 4MITA 4ETMA 1JI3A 1YZLA 7MDHA 3A6ZA 3F4BA 1HH4A 4ZI7F 4Y2VA 1SVSA 3W5BA 3LSTA 4UHBA 5EIBC 4HUQA 4YNBA 1LS6A 1L6RA 2ZWAA 1DAOA 4LMRA 1U0NA 4ZDIA 1K63A 1WS6A 2PVCA 3DTVD 1VIAA 5HEKA 3N8IA 3JY6A 3JYOA 3E5HA 1SB8A 4KN5A 2QL5A 5E9QA 4HEA1 4ZQBA 5E1DA 1CLUA 1RI2A 1GUBA 3PENA 5KSOA 4IDCA 5CJ2A 3NBQA 3PWTA 4TMWA 4ETNA 3QELB 4DQ0A 1W46A 5CX4A 3HYRA 1OILA 2IYPA 4GKKB 1JPJA 1YS4A 5GVRA 1SWWA 4IIFA 5DNCA 5L3SB 2EC5A 2OZLA 2Q50A 3OCXA 2NUAA 5FYQA 4JLPA 3NT5A 3WRYA 5JYBA 3B6IA 4P81A 4E5KA 5G02A 5TQ0A 1YJXA 5C52B 1PUJA 3LW7A 2Q8NA 4KAAA 1JIIA 1S0UA 1T6YA 2G7MC 4HJXA 1N5JA 2PRIA 5CM2Z 3DEKA 3JPYA 5TRTA 2OP0A 3G02A 4O5OA 4QICA 4EG7A 4LF9B 1CQJA 2GBCA 1BKSB 1ZNQO 5HPYB 4L2IA 5K9ZA 1M8PA 2HZBA 1WTCA 3KQWA 1T43A 3LF1A 5LQKA 1J1IA 3NKFA 3DPUA 4IXTA 2YIJA 5KKNB 1LU9A 3KK0A 2FWPA 3H84A 1L8QA 3ABIA 3L49A 1N92A 2ZR9A 3QG1A 5BW6B 4LWOA 2LWIA 2UZ3A 2R5NA 3HG7A 3NIWA 4PZ0A 3AUTA 5EOVA 4YUZA 3HTXA 3GEGA 2B99A 3FOEC 1Z0DA 3BTUA 1XTKA 5ERXA 1J42A 4D9JA 5E7IA 5IF9A 2Q7OE 2JGLA 5C51B 4LYHA 3GN2A 1HPLA 2D1YA 1AU9A 2HQOA 4WFIA 1WKBA 2CF5A 2XXAA 4UC0A 3DZIA 2JW5A 2RK6A 3A1CA 2CBXA 2OOKA 3QELA 4MULA 4AROA 2XYGA 4EB6A 3SEAA 1V7ZA 5AKZA 1G38A 4ER7A 3DZKA 3PRKE 2G5TA 4E21A 4ZT6A 4BU1A 2QLNA 3VH1A 1LVGA 3ZI0A 2PUHA 4OHXA 1V35A 2CXXA 2LVBA 3HJAA 5CM8B 2EJWA 4XJTA 5K0JA 2ZYGA 3CKMA 2BFOA 1EWVA 2VZ0A 2DKOA 3AVOA 4EHHA 1E69A 3DL4A 4FLEA 4AX4A 5BV0A 3ZK9A 1GAQA 2IYOA 4C06A 3T3DA 2OGZA 2A1TR 2PZAA 3C8ZA 1XXHE 1XEWX 3FLEA 3LVRE 2VHTA 1SXJD 4BNUA 3QITA 5CA0F 3QKUA 3BAZA 3R3YA 3A1UA 4DCTA 1CEEA 3MHPA 5E9JA 3NVMB 2B98A 3KKNA 2P27A 2CK3A 2WE8A 4Z0HO 3NGXA 1Y5NA 2FPUA 1YQWA 3EOBI 2RGDA 3L79A 3OJOA 3HJCA 2ZYAA 1VKHA 3MS2A 3D3EA 2CLCX 1RJGA 4MJXA 3B51X 2IZ0A 1M1UA 4BKRA 3T4PA 3H13A 4OHZA 3A58B 3QSYA 5I9IA 3DLBA 3QPUA 4B6JA 1L5FA 4BGEA 2AOWA 2Q5HA 1KKMA 4L9RA 1USUA 3N2GB 1D03A 3GDGA 5F9MA 2NZ2A 3CG0A 1UINA 1ZGJA 4NQZA 4KE7A 4F2PA 3OJWA 4LJAA 1TTHA 3IESA 1XE3A 2BM1A 2W6ID 3IJEB 8ABPA 1JYFA 1Q3HA 1AXRA 1K5GA 1QHIA 3FWZA 3OX2A 5J43A 3CINA 3CH5A 1QH8B 1C4OA 2FPRA 3BXFA 3ZI4A 2H1HA 4FFSA 4DARA 1GA4A 1AO0A 3KSBC 4E3WA 2O54A 4JC4A 5CNJA 3VO9A 1UZAA 2HPZA 4JQYA 5FJJA 2P2CA 2J07A 3VTFA 1BXKA 1P5FA 1GKUB 3UFXB 1SC1A 4N41A 3RWOA 2WWHA 5J1TB 2ZP1A 5DW0A 1N2HA 3B1XA 3KQSA 2XCRB 2Y27A 5FPTA 3T34A 3FYUB 2WSSD 3O93A 5EQJB 1TT7A 1KYWA 1JYSA 3LQ2A 4PLVA 4UPEA 1UBFA 2EU8A 1OUMA 3C2QA 3ASZA 1P91A 1PP4A 3EVCA 1ZW1A 3JD1A 1HO3A 3QTTA 4HK4A 1TUBA 3BFXA 5C0OE 3B53X 4CR7A 1TO1E 4HPJB 4AYTA 4K28A 4RLSA 3OOYA 2HBZA 1WL8A 5DXFA 4Z86A 1M1XB 4KVGA 3U7JA 4DCSA 2ENUA 1Z18A 2EFHB 3GBVA 3Q5GA 1RU3A 1EA5A 2A94A 3GIDA 5GINE 2JA1A 4AO7A 1Y7LA 4DAOA 2ADMA 3UUGA 1FUYB 4KBGA 1TKCA 5CB6A 4JJ4A 1KGDA 3TXYA 3HDGA 4AQDA 4Q4AB 3HLTA 3L01A 1T4CA 3OOEA 5J4LA 1E4YA 4RPLA 1OOEA 3FPGA 4P84A 2QMUA 2JFBA 4UNPA 1PG5A 2QMZA 3BDIA 4OQDA 2PZGA 3I4FA 3LBFA 4Q4AA 3TDNA 1K9SA 3KKMA 5J5CA 4AF7A 1Y8ZA 1PFYA 3MMZA 3QE3A 5CH5A 2R2GA 4I1VA 3DE2X 2QD5A 1X1RA 2Q7DA 1TJ4A 3OHPA 2IA5A 1AQYA 2MT9A 4PNZA 1QQAA 4YXFA 2J5RA 5AW9A 5JZ9A 2YRFA 2XV1A 5E9AA 1D9ZA 3T1YB 5DPMA 2YVQA 3O4HA 1RP7A 3ZZNA 1H2YA 4H17A 2OTCA 3VO1A 3DAFA 5INTA 5JCOC 2NV0A 1B6SA 1T5LA 2CLMB 3W1EA 3AERA 4EJSC 4CG2A 2R7LA 1P7PA 4LBYA 1FK8A 3EBLA 4PSDA 4QXQA 4B3FX 1FCJA 4H1WA 1JQAA 1PGOA 2PGXA 2VDWB 4RVCA 2AN3A 2PXXA 4DTIA 1APBA 3M6FA 2O14A 1U0LA 1USWA 4L22A 4RJIA 2Y93A 1LF0A 2PUGA 2ZE5A 3SU8A 5JAUA 1MDFA 2O8CA 1ISIA 1HRKA 4D8YA 2D0PB 5KYYA 4XIYA 2JIZA 1T4CB 3OPXA 3AJ8A 1DQZA 1P2SA 2GD0A 4MUIA 3SS8A 4DQVA 3NBYC 5H8WA 3FZEA 2FLVA 1I0IA 1DXHA 3D6AA 4HDSB 3UWDA 3IX7A 1SAYA 1EP2B 4G0YA 2E21A 2KHZA 3CEMA 3EVDA 3G5UA 3R44A 1UQRA 1LWOA 4RLQA 1C9YA 1BGVA 1SQ0A 1MKYA 3DO6A 1CS4C 3WB0A 4TS9A 1YFKA 4DGQA 1T13A 2AXEA 5KBYA 5ADVA 4HDSA 4QATA 4WSOA 2QN7A 3G6KA 2PBFA 4FN4A 2M9MA 4PX3A 3OAAD 5M04A 1QH1A 1JDPA 1U0JA 4XUDA 4HKTA 4ON9A 4EX7A 1TVCA 2YRWA 5LQJA 3WISA 1MGOA 4OYYA 1QONA 3PWKA 3Q10A 4I6JA 1XDUA 1ZEMA 2QZZA 2REBA 1XZKA 2B4AA 2XD9A 2BFDB 2XBLA 4O8ZA 3I3OA 4ZIRB 5LNK1 2BC9A 1RBQA 1CUUA 1HT2E 1P5JA 1WDWB 1T6ZA 2GJ9A 4LXQA 1CE8B 1Z16A 3W3AA 2QPAA 4HY3A 3WFZA 2B30A 4QPPA 5EXSA 1NQUA 5JNVA 5K6AA 4LVUA 4BLTA 2OUKA 1KZ6A 4DYHA 3BQNB 4F06A 1RWKA 3VNUA 1QC5A 2D4HA 4C04A 1AB5A 1CW2B 1V3UA 4K1XA 2ZBEA 3CRW1 3NT4A 1O9BA 5SZKB 5ANRB 3GJYA 2WTEA 4OHCA 3GJTA 1JQBA 2GN9A 4KXMA 3T5BA 5BUZA 3C98A 3UMCA 2IODA 4IDQA 4D4LA 4D4GA 2P6RA 4D0NA 4IJ6A 4PXAA 5IAOA 4YV1A 3NCHA 2OBYA 1L8XA 4J4TA 4KBYA 1A72A 4M6WA 3ZPXA 4X20A 5AM0A 1SXHA 4Z51A 1Z45A 1KI8A 2DYKA 3BXEA 1ZHFA 3NHBA 1Z13A 3NETA 4CCYB 4NCAA 4HZIA 5DBFA 3V5NA 3OCWA 1BOFA 1TLFA 1Y33E 1L5ZA 1U3CA 2HEIA 3F97A 4IGEA 3KLNA 2XTJA 3D5TA 3AEKB 4LOAA 1USVA 4JMLA 2HMAA 4Q4JA 4TLDA 1PSDA 3M5CA 5FIUA 3TLEA 1MIHA 1YR1A 1SUAA 3OFVA 2OG2A 3L05A 4H27A 1OYYA 5DTQA 4WRRA 5FTNA 2C5BA 2K6GA 1XALA 3TVYA 1I4EB 1F4VA 1A7AA 2HREA 3AVUA 1VL6A 1BQ4A 1E61A 4PX9A 4LCEA 2ECFA 3OZTA 5T6MA 3N2NA 1JU3A 2C4VA 1S4MA 2R8RA 4B3DA 1U31A 1VL1A 4CQMA 2Q5LA 1UEJA 4RD3A 3WYGA 4WFJA 3GVHA 3VZSA 1OAOC 2EARA 4RDXA 2ZJ2A 1XEXA 2VRWA 1G6Q1 2FPIA 2F62A 5JAQA 5A6SB 2DERA 1BYIA 1UPBA 3E5RA 2O8BB 3AVYA 3BWXA 5P21A 4Z2AA 2RAUA 3IELA 1BE8A 2IY7A 1YA6A 5WRFA 3U16A 1I13A 1U8TA 2QVXX 3NEYA 4PZDA 2XUAA 4I99A 2CNOA 3S40A 3LUJA