1Y1RA

Crystal structure of the uridine phosphorylase from salmonella typhimurium in complex with inhibitor and phosphate ion at 2.11a resolution
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
251
structure length
251
Chain Sequence
b'KSDVFHLGLTKNDLQGAQLAIVPGDPERVEKIAALMDKPVKLASHREFTSWRAELDGKAVIVCSTGIGGPSTSIAVEELAQLGIRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASLHFAPMEFPAVADFACTTALVEAAKSIGATTHVGVTASSDTFYPGQERYDTYSGRVVRRFKGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQQEIPNAETMKQTESHAVKIVVEAARRLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Uridine phosphorylase
molecule tags Transferase
source organism Salmonella typhimurium
publication title Crystal Structures of Salmonella Typhimurium Uridine Phosphorylase in Complex with Inhibitor and Phosphate.
rcsb
total genus 81
structure length 251
sequence length 251
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2004-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1y1rA00
4QARA 4JOSA 4G8JA 3IEXA 4DA0A 4OEHA 4PNPA 3P0FA 1ODIA 1JE0A 4TXMA 1PR4A 4DARA 3K8QA 2HWUA 4L5AA 1K3FA 1ECPA 3OZCA 4WKOA 1T8WA 2A0WA 1TGYA 4TTJA 3UAZA 2ON6A 3GB9A 4BMYA 1LX7A 4BMZA 1Q1GA 3O6VA 3FNQA 1PR2A 5F7JA 3OZDA 4TXNA 5CXSA 2HRDA 1NC3A 1SD2A 1V48A 5KB3A 1Y1SA 4RJ2A 3NM6B 1PR0A 1YQQA 1ODJA 1NC1A 4QATA 1OUMA 1LV8A 4G41A 1U1FA 5ETJA 2OC4A 5IU6A 1ZOSA 2I4TA 1VHJA 3EUEA 4TXHA 2A0XA 5B7GA 1LVUA 1JP7A 4WKNA 1V3QE 5F7ZA 4D9HA 4QASA 3UAWA 1RXSA 4YJKA 4YNBA 4D8VA 5I3CA 1VHWA 4M3NA 4D8YA 1PR1A 4H1TA 1PWYE 4D98A 3EMVA 2IQ5A 3GGSA 1B8NA 2A0YA 1Z5OA 3UAYA 1T8RA 1Z36A 2XRFA 3NM5A 1U1GA 1V45E 4L6IA 4KN5A 3FWPA 1A9PA 3FB1A 4WKBA 3OZEA 3IOMA 4DAOA 4K6OA 4NS1A 1JE1A 5B7PA 3SCZA 4OF4A 2QPLA 1G2OA 1Y6RA 3EEIA 1RXUA 1PF7E 4MCHA 3TL6A 3K8OE 3D1VA 1A9SA 1C3XA 4LNHA 3E0QA 5F73A 5CYFA 4MARA 3KHSA 4PR3A 1Z33A 1SQ6A 2I8AA 4R31A 4TTAA 1JDVA 1A9QA 3E9ZA 5K1ZA 4BN0A 1Y1QA 4D8XA 1V41E 2AI2A 4TXJA 4M7WA 3OPVA 1Z35A 4YMLA 1SJ9A 3NBQA 1PW7A 5CXQA 1OV6A 2QDKA 3E9RA 4JP5A 1RXCA 1NW4A 3LA8A 4LZWA 1PR6A 3KVVA 3KUKA 1N3IA 4OY3A 4GLFA 5EFOA 3EUFA 3C74A 4TS3A 1RR6A 4L5CA 4BMXA 4JWTA 1TCVA 1RCTE 4ECEA 2Q7OE 4TYMA 1PK7A 1T8YA 1Z34A 4L0MA 4TTIA 4GMHA 1VMKA 2HSWA 1ULBA 1K9SA 4TS9A 3U40A 4F2PA 2OXFA 1RYZA 4DAEA 1V4NA 2AI1A 4NY1A 4DA7A 1ULAA 3MB8A 2ISCA 1Z37A 2AC7A 1SD1A 4TXLA 1Y1RA 1ZL2A 1A9OA 3FUCA 3ODGA 5F7OA 1Y1TA 1VFNA 4F2WA 5F78A 3OOHA 3DDOA 4DABA 2QTTA 4NSNA 3PHCA 5F76A 1PKEA 3FOWA 3LGSA 1T8SA 1A9RA 3DF9A 1XE3A 4DA6A 2OC9A 2GUWA 1Y6QA 4OJTA 3UT6A 1YBFA 4MCIA 4EARA 3UAXA 3LBAA 1RT9A 1V2HE 3INYA 1YRYE 1JDSA 1YQUA 1OTXA 2PGAA 3QPBA 3UAVA 2B94A 4F3KA 4EB8A 3DJFA 1K27A 3KU4A 3PNSA 3P0EA 3T94A 1OVGA 3NM4A 4IP0A 4U2KA 4QEZA 5CCDA 1CB0A 4DANA 4WKCA 1YR3A 5B7NA 5CCEA 4DA8A 1PBNA 1B8OA 4G89A 4R2XA 5IFKA 3BGSA 1CG6A 1ODKA 2A8YA 1ODLA 1JDUA 1TD1A 3O4VA 4R2WA 1QE5A 2BSXA 3ONVA 4I2VA 1JYSA 5F77A 3BSFA 3DPSA 4OGLA 1A9TA 1OTYA 1OU4A 1I80A 1WTAA 1FXUA 1Z5PA 2HN9A 4LKRA 1RFGE 5F7XA 2P4SA 4LNAA 5EUBA 4UC0A 5EPUA 3KVYA 5C80A 1TCUA 1U1DA 5DK6A 1RXYA 2OECA 2H8GA 3OCCA 4M1EA 4WKPA 3OZBA 4FFSA 5CYGA 1A69A 1U1EA 1PK9A 1M73E 3ENZA 5JPCA 4QFBA 3KVRA 3PHBE 5FAKA 3FAZA 4F1WA 1TGVA 1Z5NA 3BJEA 4GLJA 5B7QA 1JDZA 2AI3A 4L5YA 4X24A 3PNPA 4GKAA 2QTGA 4LDNA 2QSUA 1U1CA 4E1VA 4YO8A 3F8WA 1JPVA 3OOEA 3OF3A 1RSZA 3DP9A 4QAQA 1PR5A 1JDTA 1Z39A 3BL6A 4OGKA 1T0UA 4F3CA 1Z38A 4P54A 2RJ3A 3MMSA
chains in the Genus database with same CATH superfamily
1NQUA 2BHLA 1T43A 3B6EA 3AR6A 1WMBA 5REQA 2FY8A 4E2ZA 4DR2B 5HTKA 1FSPA 4NAUA 4B6JA 4RK1A 3D2LA 4MB6A 2GBGA 5IC4A 3K7EA 1E1QA 5JWHA 1RRFA 1RMTA 3WNQA 1Q0SA 1CV2A 3DH0A 4DREA 1COZA 1COWD 2RGUA 3OPNA 1O3YA 3K8QA 4UBKA 3S4YA 2C2WA 3TLXA 4OOEA 2VTBA 1TYDE 2Q3BA 3TZEA 1EFTA 2HT6A 1QLHA 4RDIA 2CVOA 3T9AA 3WJAA 4AK9A 1REQA 4IEFB 3B52X 4JP2A 4Y2TA 2YFKA 3IDQA 3FCXA 4BMZA 4RJKA 4DC9A 1XDBA 3GGOA 4ZZIA 1JBQA 2JJ2D 2YWHA 3FCUB 5AH0A 2PX4A 1N34B 4MVJD 2P4QA 4KMRA 1K3UB 2FJ0A 2QLLA 4I1YA 3ZEAA 1Z75A 4FKBA 4XQ9A 4Y0NA 2BELA 1CF2O 2IT1A 1MO5A 2VUSA 3CLRC 4ZCRA 2HU8A 5JNUA 4IV0A 1QHEA 5KOYA 2XUGA 2HRDA 3FTPA 1H4TA 2QR5A 1R8JA 3B8HA 1XMIA 4PZPA 1TMOA 5JPDA 4GOLD 4Y9TA 3C41J 1YTUA 1MDFA 1PR0A 1APBA 1ZESA 3CG0A 3RUIA 5I3ZA 1NC1A 3IEUA 4DIDA 1IMOA 1FE8A 3LFHA 4TMZA 2FXIA 3DMTC 3E2IA 3F90A 4AWXA 1IWPB 2PX8A 1TQDA 4RE6A 5JVDF 3NZEA 4AN0A 1B15A 4Q21A 4WFIA 2QUKA 1WCYA 4WNYA 4J0GA 3H9QA 2YL2A 4YV0A 1MRNA 1VJCA 3ZHTA 3DAHA 1T2FA 2H54A 3T7EA 1W88B 2GOYA 3GXBA 2GHQA 2H5EA 4GR9A 1FJXA 1TLFA 2ZJ6A 2YJ3A 3G2MA 3CWZA 1KJIA 3BA1A 3IR6A 2I54A 3D81A 2AB0A 2GCEA 4I5EA 4OGGA 2KB0A 4QDZA 5F7ZA 2BFNA 1D9ZA 2VHCA 5JI3E 5BRJA 5F23A 2HPHA 4RS4A 1ZUHA 3DL2A 1DMRA 3UAWA 3L49A 2QLTA 4RW0A 4A82A 2I3GA 2JF0A 3GF4A 4CCSA 5C9ZA 1MX9A 4BL5A 1KWKA 4F3TA 1JHXA 1ZU5A 4GMGA 4INOA 2WSSA 3FZEA 2PZBA 1J2YA 2NPFA 1EBBA 2O3SA 5IW8A 2C5GA 1ACJA 4CV2A 4F3YA 2OD9A 3ZDAA 3DQQA 1EH5A 2AKAB 3HU2A 4ZT7A 3BA6A 4D98A 3NPMA 2PT9A 3PRHA 3EMVA 5LQJA 1S2LA 4MR8B 1OAKA 5B55A 4WZAE 2G76A 5C5CA 4XVRA 2NZ8A 3D3KA 5D3ZA 3L79A 3SJAA 4KTVE 3ADBA 3QY9A 1W19A 4AICA 5TMPA 1MHTA 1D2CA 4EHNA 2ODTX 1ONOA 4KJZA 4DBLE 2GFIA 1ZAKA 2EXXA 2QTLA 3G8YA 3T4PA 4ZAVA 3N2IA 1WXIA 4L6IA 3TI9A 1TECE 3VKWA 4DMCA 3A2MA 3FWPA 1NMYA 4HKTA 5CUQA 2BHNA 2GXSA 3FAKA 4NIMA 1ZQ9A 1ZOOA 2W2LD 1N6LA 3MILA 3WOVA 1IHOA 2AEEA 3ESCA 2I78A 4G4IA 3ZY2A 5ER9A 1ZSNA 3CVOA 2C8VA 4DZTA 1D1PA 1YVDA 1P4GA 5L7WA 1RJEA 4NCBA 1ULZA 4PWYA 4ZVRA 1EE2A 5ALJA 1USWA 2VAXA 3FTCA 1NN5A 3IPYA 1RTTA 1FDTA 4OXIA 2Q99A 1IOZA 3THWA 1GT91 3UYKA 1HSOA 3N58A 4DGQA 4Z86A 2V8BA 3B2QA 4GM4A 1XLVA 2FSUA 4P6VF 3WOHA 4DLVA 1GPYA 4F4DA 3DWFA 3OEHD 1M0EA 4Z8YA 3C3WA 4IS3A 4C6RA 1HQYE 5DSTA 2PMCA 1Q12A 2PXCA 2AXPA 1VJDA 3BWMA 1N9GA 3QV2A 2GMWA 3BULA 4ETMA 1Z2EA 3FJ1A 3GDWA 3PNOA 3RSQA 2HU5A 2NLOA 3OZ7A 3P8ZA 1LNSA 2DPHA 4Q12A 1EX6A 5A2QA 3KQHA 2XODA 1CVIA 2AX4A 3TNYA 1DAIA 2MSNA 2PFKA 4NPHA 3STYA 5F4ZA 6NULA 1NZFA 5AVKA 2BKLA 1G8AA 2CLSA 3C5HA 4QLAA 2D1TA 1QCDA 2ANCA 3FNBA 3NPAA 2JGIA 1SQ6A 2SCUB 2XCQA 4JBNA 2XB4A 5ILGA 4C3OB 3TG8A 1EGVB 5HKKD 3J80A 1YDMA 1QH8A 3D31A 3G7SA 5JATA 4PSVA 4GXTA 1X87A 2ATXA 3HKDA 2QEQA 3GRFA 4RORA 4EHAA 2X3FA 1JIIA 1R5JA 3PNKA 3G2JA 4YPFA 5IAOA 3EDCA 3ON5A 5DBGA 4V1CI 2BUBA 1W34A 5IT4A 5IKOA 1OBCA 4TUYF 2XBUA 4XR9A 1LDBA 4FJ1A 1TD9A 4HN2A 3R0ZA 4LK2A 4HEQA 4ZVKA 3E9DA 4AUNA 1XP5A 4B8YA 1C3EA 2BTQB 3ANLA 3QOYA 4TKUB 1T6ZA 3T7AA 3TBFA 4B3GA 1DLJA 1ZG3A 2ZIZA 1FYEA 2VPQA 4E31A 5CFLA 3CO0S 3M3HA 2IY7A 4Q4JA 1BD3A 1R88A 2UKDA 2WP8J 1CF9A 4NOMA 1A3CA 2ZTUA 1DBRA 5JRZA 3EVNA 2QDKA 3TW4A 2EW8A 4ND2A 3KD3A 4AWAA 4RTJA 1MH1A 1PT5A 4F92B 1OYVA 1PR9A 4GG1A 4L4RA 1M1NA 3WFJA 4A3SA 1AS0A 1WG8A 2WSLA 1ZR4A 3CX4A 4IXMA 4ALMA 1CU1A 4WAUA 1U8YA 4OLJA 3R0XA 4Q3LA 5AJXA 4BC1A 1VIYA 1B1AA 5B5SA 1VJ0A 4HFMA 4K9RA 2XTMA 1TAQA 4TQAA 5KVVA 1PT6A 2EW1A 2NZ2A 2QZSA 1Z7GA 1DAGA 3B9BA 4BNJA 4RV5A 5CDSA 1Q57A 1WCWA 5CLLA 3QITA 4XLZA 4DQDA 1FZQA 3NYRA 4KYIB 2Q49A 4GZLA 1G21B 2VT6A 1XELA 1XRNA 2ZSUA 4JGIA 4XUCA 4MWOA 4BQQA 4CMJA 4DUPA 4MAAA 5ED0A 1EFPB 4FOPA 3IA7A 4TRNA 3GHYA 3FPFA 4WRRA 5DV9A 5FLKA 1GARA 3WKCA 5B1YA 1STOA 2YW9A 4GLOA 1NDQA 4PQEA 1HFWA 3RWBA 5KNBH 3MHTA 3C3MA 1Z2PX 3N2EA 5CX1A 1DCKA 4J1SA 1E4VA 3TCKA 5EVJA 1Y8AA 3UENA 4JB8A 2JEOA 2XUIA 4TTIA 4AJIA 1PX2A 3LYLA 3I6BA 5T4FA 5HIAA 1KI1A 1GPMA 2JFVA 3UA4A 1UAAA 2IKSA 4FFOA 3HPRA 5AK6A 2AS0A 1N5OX 2EV9A 4LXUA 1N8KA 4R9UC 4YWJA 2J3JA 4CGZA 2RH5A 3DC7A 1WPQA 4XOUA 3NHRA 3VHLB 1HV8A 5EIHA 3B1WA 2QMYA 4U8GA 3TJZA 3TAXA 4GOXA 4D0SA 4XB6B 1AGXA 4MR7A 4HF7A 4HWOA 5KX5B 1ZH6A 2G25A 4NBNA 2NO0A 2P2DA 4WEQA 4BOYA 4DDMA 1UZAA 1ULSA 4G4GA 2A6PA 3A70A 5AVOA 2W6OA 3HE3A 4C0WA 4EDFA 4BTVA 3QTLA 1DG3A 1KK0A 3A1UA 4XM0A 3H86A 7AT1A 2HW8A 1JMVA 5EZQA 1G7TA 2PUGA 2PZKA 2EKPA 2P4HX 2C9CA 4KXYA 4U5QA 4DLZA 1EG7A 5GZ6A 4A8JB 1YZLA 4PZLA 1OZHA 5A4DA 1Z8HA 1BMFD 1SRQA 1WB5A 1Z37A 3HJTA 5C8ZA 1E6EA 1E6LA 4RCZA 1LJ8A 4LW8A 3WYNA 1CZLA 2VRWA 3WLIA 2VRBA 5B1HA 1P7ZA 1ZL2A 3SZMA 2Q5CA 3OKPA 1KVRA 5CIQA 4RO0A 1C7JA 3FDXA 4KPFC 5J2TF 5FH9A 4YUZA 1X7GA 4LTDA 4FOOA 3SC3A 3M1LA 2PGIA 5LU8A 1JA0A 4XWGA 4D0NA 1XN1A 4G4SP 1VL0A 1XGKA 3ZWOA 1RHQA 3P52A 3WA7A 1KI7A 1NJ1A 4PAOA 2W42A 4KV7A 2FMUA 4W1SA 3GH1A 5UKDA 1SOWA 1SHUX 4DLYA 4Q9HA 1M2OB 4LVCA 1E59A 4L7VA 4TPKA 3W5SA 1LSUA 1QF9A 2IU0A 2P9BA 3LF1A 2JIOA 3AF0A 3JQCA 4E6EA 3FMGA 2X3UA 5KIAA 4EKDA 4FM9A 2HXSA 3RSCA 4I1PA 3WBBA 3KQSA 5HF5A 2H4ZA 1IJEA 2RHRA 3A1WA 3RREA 4KUGA 1VJ1A 2B1GA 2P78A 3D6NB 3GFPA 3GWZA 3R0QA 3TCXB 3GLHE 1Z6YA 4TV9B 4CKXA 1M5UA 3KXIA 1O94D 3GD5A 2XAUA 1QVAA 2FW8A 2AX3A 4D7AA 5DBIA 4B4VA 2WV9A 2D0PB 2WG2A 1DL5A 4HTFB 1OTHA 2NUAB 4DV1B 3WMGA 1JLSA 1H2XA 4FC6A 2C07A 5AXDA 2PXHA 1T1IA 3HB4X 4YRFA 1IXRC 1GGMA 3STTA 5EJAA 4Z7OB 1B93A 3UUWA 4CUKA 2PJZA 3RQSA 2P9TA 1AK2A 1GZ7A 3N1UA 3IAM6 3P9KA 5HX7A 4OHVA 3HGQA 1Q1NA 1K27A 2NSYA 3F6RA 4G5HA 4IRXA 4MWZA 4S3MA 1N6HA 1GPAA 4CHTA 3H8VA 5I9BA 2Q6LA 3GRCA 1WPRA 4QNNA 1W9HA 3AKDA 3GJRA 4TS1A 5DHAA 4CU5A 2HD4A 1QUFA 3IBTA 4B84A 1UCFA 1DKOA 2BOVA 5EHZA 2FWIA 3I4LA 4DLRA 4GMDA 3DMFA 4UBOA 3SIXA 3P9IA 2VZ8A 3SF8B 1UPXA 4FZ3A 3RRJA 3JQGA 4NDAA 3HG7A 4N5MA 2Q5OA 4ZO9A 3EGCA 3FN4A 2Z8XA 2J85A 3B6IA 4XD7A 3PXUA 5BRAA 4I9HA 4BAUA 4RFVA 3P27A 1SWVA 3QWBA 2SICE 3AFIA 3AHDA 4MZXA 3SZ3A 4RXMA 2QVZX 2XBMA 4LOHA 1IYZA 2GPNA 1X7XB 2WYWA 3KKKA 4BEBA 2PA3A 3AR7A 4LJ7A 3ZU4A 3R7WA 3UK1A 2JZOA 3M4YA 2ONYA 3PJRA 3GJTA 2GN6A 3BFJA 3CGWA 1JGTA 1O7JA 4K46A 3OMLA 1VHQA 2C2KA 5LBIA 1RYYA 2NU9B 4CZ2A 1CDDA 4O2AA 1IK4A 2VWPA 4RM3A 1L5VA 3AKYA 4ZOLB 4COOA 2C92A 2EQAA 3BSFA 3G7UA 1KF0A 3M2TA 4WXEA 2IP1A 1ANKA 3EGXB 1B23P 3LC2O 3PGKA 4ZODA 3DXYA 3GOQA 4OH1A 3H9EO 5EMKA 2BN4A 1OWOA 1WETA 1IBSA 5BT9A 5F7XA 1S8FA 2YWBA 3E15A 4YP6A 4Q39A 4CMEA 3PUWA 4B44A 1G6HA 4N39A 3T5AA 4ND5A 3VFDA 3WB2A 1IBLB 1KY3A 3R6TA 4BX0A 3PUXA 5JJIA 3KVYA 3ISVA 1X19A 3CRQA 4ZI3A 4KPYA 3FYUC 4RHYA 3ZBTA 3LLSA 3AYXB 3USES 3ZKWB 3VI3B 3OCWA 2HCTA 5IDXA 2DR3A 4TMFA 4UMEA 5DTRA 1EVYA 2Z30A 2V54A 2P5TB 3H97A 3I8XA 3KQUA 4M1EA 2PKQP 4LE2A 2BM9A 3KCQA 3TTXA 3NONA 3ZZUA 1EJ2A 3CNQS 1UBUS 5BXYA 2GZSA 1QV9A 5BSFA 3EEFA 4IS2A 4LRTB 4KHPB 3MXTA 4WK0B 4W8GA 3LQRA 3E6AA 1NOIA 4UU0A 5GINE 4G01B 3BL8A 4O63O 1NTOA 3ASZA 1V9LA 3IPCA 4GIBA 3DO5A 2ST1A 3RYIA 1N5LA 5ALGA 1WDMA 1TGVA 3KR2A 4PAWA 5AQEA 5JC8A 2FMTA 4LF8B 4BWGA 4J49A 4Z49A 3CLVA 5IT9A 2KW5A 4NICA 3SZUA 4CLEA 1SG0A 4QBKA 1JILA 1G5PA 4YP5A 1OOEA 3I04A 2D1YA 4GNKA 4CM9D 3PLAE 3LHIA 2HHLA 2HK8A 4ZT2A 5AKZA 5JH7F 1AG9A 3E70C 3AWDA 5DOZA 4I4CA 4WESA 5E95A 1JIUA 1UXHA 3OOEA 2P30A 5DH9A 1OMOA 1Q22A 1ZA2A 2X8LA 1II9A 3DFFA 2HTEA 1KEUA 2QVCA 3HUFA 4QAQA 1QO0D 3S1AB 4DWJA 4C43A 1V5WA 5B30A 1I6WA 2B8EA 1HDEA 4EX7A 1DKRA 1G6OA 2YV5A 3DE2X 1BH2A 2IYQA 4FYHA 2ONZA 4FVTA 4IG9A 2HEGA 1QBKC 2GASA 3AUTA 4KQ1A 4XGKA 3P9YA 5AIBA 6CHYA 4CEHB 2GA9A 4AJKA 4I5IA 3TQTA 3HDYA 4MRMA 5T8KA 1P5HA 1WF6A 2O0KA 4UHEA 3Q7EA 2XNHA 4GPTA 4LOKA 4Z8XA 3PD0A 1R6DA 1XROA 2X8BA 3HBFA 4GZ5A 4OIMA 4F85A 5HKKA 3DVQX 2IWHA 4AP5A 1UBSB 1C1DB 2RGRA 5DZSA 3H3JA 2WAOA 2C5SA 2JHAA 2Q6VA 2TECE 3NIGB 4LMPA 3UQZA 3FMOB 3C24A 3I52A 2ZE5A 4CQMB 1QIJA 2HMWA 2B8WA 4ZZ3A 4W5NA 3ZXIA 3X3HA 3THYA 2WD9A 3I4CA 4D45A 4M1TA 5CDHA 5EJ2A 2ZSAA 2H57A 1L5WA 1RQ2A 3V8NA 1B0PA 3VPFA 3NJRA 4DARA 4P98A 4I4TF 4IV5A 4QTXA 5K3FA 2JIZA 3ZD8A 1H5NA 4JUFA 2XVXA 1JNYA 3K6SB 3KVNA 5DIZA 3VJLA 3ETCA 3VNQA 4NBRA 2PLWA 1GCIA 4H16A 1URPA 4RQAA 5KTNA 4CQNA 2HREA 2W5UA 4H77A 5G4KA 3TF5A 2ERXA 4FTWA 3UT5A 2ZYHA 3ONEA 2G9VA 1GA4A 1JQBA 4HC4A 3K5PA 1DFHA 3RT1A 4MI3A 3H2HA 1JB9A 4UXIA 3VDRA 4HDKB 4DDHA 2QJFA 3D3WB 1B6RA 2Q27A 4EG6A 3CH6A 1Y6ZA 4IF6A 3G85A 2O5CA 1JQ5A 2CE2X 5EJMA 4LHVA 4Y9UA 2KS6A 3ZU3A 2VDQB 2DWCA 3O1LA 4X6UA 3IVMA 3EC7A 3IP3A 4FGKA 4GMKA 4JDPA 1IXKA 5KS2A 4MVCA 2ODNA 5JD5A 3A1DA 4EZEA 1B14A 4OH7A 1ODJA 4WX2B 4F3NA 5CITA 3BD6A 3ITKA 4MW2A 5AW2A 1GRVA 2ZDQA 3IJPA 4AIIA 4GWLA 4PNHA 1OY1A 1T13A 1PZEA 4R71A 4U00A 4YAKA 4ER3A 5ETJA 1MENA 1RVDA 1JMYA 2I2CA 4YBRA 1VHJA 2VJCA 3BB4A 4AY3A 1IAVA 1F14A 3AZQA 4PZZA 2QU7A 3OOJA 3G68A 5MDHA 2VR1A 3PRJA 3ZE6A 2XB6A 2X5XA 1ORRA 4E6PA 1RHJA 5ENDA 1DRUA 1Y5RA 3EXAA 1ETHA 3TECE 2PS9A 1IONA 3KQLA 1KR2A 2DWQA 4NFLA 1HI9A 2ZSDA 3FBGA 3FBWA 4MEBA 3ONNA 4I5GA 2D2FA 2JJ1A 1Y3CE 3Q85A 1XPRA 3PA6A 4DGSA 3G88A 3BHJA 2YOGA 3HB7A 3U13A 1W87A 2ZJ0A 3P97A 3TK1A 2DC1A 4ID3A 1Q74A 2KYRA 3ZTTA 4MV7A 2CVZA 1W96A 3PYXA 1EJ6A 2VYND 2HZBA 3S2SA 5FV4A 4ZCTA 4UW9A 4FHDA 4MUJA 1AVTA 1SBZA 1VKHA 2BMAA 3LCCA 3LUHA 3ORSA 1L7PA 3E4CA 3P96A 4Q3AA 4J0IA 3WKEA 3DTNA 1DEOA 4B85A 3DOFA 5C81A 1CUIA 2VJDA 4GPD1 2OKGA 3GJ3A 4JLKA 2FSGA 2JRLA 4ZWNA 3RFCA 3OCZA 4DLBA 1TK9A 4V0MA 4F04A 2ODAA 1J2EA 4UM5A 2FRDA 3D7MA 3LD9A 3SHVA 2JLAA 1ZJWA 1HYEA 3HWWA 1DTWB 5B3KA 3PWSA 1QK3A 4UUBA 2DETA 4WGFA 3SLGA 1SUCA 4RLQA 5JZVA 4HDSB 2G09A 5SY9A 3WXMA 1E3DA 2IDJA 1VB5A 3KTAA 1RDFA 1F8UA 2XE6A 3QPDA 4MVYA 3L1UA 3EAGA 1KKMA 3S8YA 1Z18A 3HVIA 2F67A 3WMEA 1Z63A 3TOCA 5TY0A 5DOVA 5FBKA 1WQ4A 2PJDA 4LC9A 1YJ8A 3NANA 4MGZR 1G3RA 4IDQA 3C8MA 1QR2A 3NHAA 4IQ0A 2FEXA 4ZREA 3YASA 2A9KA 4YVFA 3IODA 2P0AA 4OYLA 5FR1A 4MQ4A 2XITA 3LBFA 3NH6A 3JWGA 2TMGA 4REOA 5KINB 4PLYA 5BYAA 7MHTA 3B1YA 4TWJA 3AIKA 1TKCA 1QGAA 2P65A 5BOSB 1YHZA 1LU9A 4LYHA 2ZUBA 1RYBA 3CW8X 3FD8A 1IC6A 3AM5A 3D1VA 1EXWA 1A9SA 3NBKA 3T1HB 2R1UA 3AJ9A 3QOWA 2YJTD 5LBUA 2XZTA 1VYTA 3BK2A 5CVTA 5I47A 2CVHA 2GZRA 5CVUA 3FPLA 5U4QA 2OCKA 3RUFA 1XRLA 5ITZA 3E0QA 4WWHA 1QIDA 1O9BA 2VKQA 2VQ3A 1BQEA 2GN8A 4L72A 5A4MS 2BE9A 5KOJB 3P4UA 3C6YA 3I8OA 1OLSA 1ZI6A 4G0MA 4P9NA 3GZNB 3HVJA 2ZJ2A 3FRJA 4XQCA 5E8RA 3ZX4A 3OFJA 1PWXA 5BSEA 5LXTA 2G4LA 1H4QA 3K9LA 3IOBA 4TKLA 3QYJA 3R9KA 1OGIA 3IUYA 4CE6A 1EGQA 1OXBB 2NVWA 3ZZMA 5LVAA 4CKZA 4CNBA 3PU6A 3QXHA 4QAJA 4FYIA 2J4FA 4BMVA 2CDBA 4FYKA 3RF7A 3DE6X 3KAJA 3PNLA 3ZNNA 2B3TA 3VH4A 3VH1A 4OQ4A 4AB1A 1SXQA 3WADA 3PDJA 1C7QA 5E0OA 5KYWA 4W63A 5LQSA 3RANA 3CC8A 4CKWB 4EK9A 1Y7TA 1GUZA 3ZWAA 5BWNA 2W93A 4Y9DA 1KQPA 1F20A 2FPGA 2O7VA 4KV9A 2B8TA 2ROQA 4Z9FA 3RSZA 4OX9Y 3OQIA 3N3BC 4G1VA 4BBAA 1XZJA 5JFOA 1G8FA 1FVHA 3QFCA 4ESHA 4MKRA 3THOA 1E2FA 3BXOA 4RSGA 1F1JA 2ZK7A 3G23A 1PEKE 3QKSB 1SQSA 4J0FA 2UDPA 4PFKA 1RXCA 4ZPJA 1VJRA 4OUDB 3VBCA 1K08A 2GDJA 4P34A 2IZ0A 4IDAA 2AR9A 3H1AA 3ZGLA 1QRSA 1WJGA 1H2EA 2Y1WA 3CR8A 1A72A 4Y6RA 4A9AA 4ALJA 5L3RA 4YJ2A 1IWOA 1HG1A 4YI5A 1GLVA 4B9AA 3A06A 1ODSA 3D4PA 1U6JA 2Q21A 2QMUA 3HC7A 3RG8A 1UFOA 3QLJA 3TGPA 4FCTA 2OLKA 4Y2JA 4F84A 1F6BA 5JV5A 2YHSA 1U63A 2BL4A 1CEEA 3KQNA 1WMSA 4Q3KA 3O31A 3G7NA 1K68A 3EMBA 1U2QA 4N7JA 3BMOA 1ZM3A 1H93A 1BKYA 1TCVA 3WRYC 1GU7A 5DP1A 5CCBA 2QDXA 4F4JA 4LN1A 5H70A 4YRDA 5GV7A 1J0DA 4JYCA 4AJNA 2FZ5A 1T36A 2CNWA 4YI3A 1FLAA 5A9SB 1W0JA 2RFLA 2OESA 3H7IA 4DJAA 2ZI4A 1YC5A 4NV0A 4PGGA 1BDJA 4UMFA 3HRIA 3TSCA 3Q40A 3VR2A 3CVXA 4C29A 1RE0A 5ILOA 4OQYA 4Q4LA 2CC2A 3DAGA 3PR1A 2QG4A 4L8FA 4WSOA 4BDTA 3OT5A 1BO6A 3I3OA 4W1PA 2Z95A 3RTEA 2LCQA 1FUUA 1AMUA 1VL2A 3MAJA 3SJZA 4ZRDA 3U40A 4YHHB 3N8HA 2OXFA 1GXSA 2WOOA 2ZANA 2C42A 2P79A 3H5OA 4YCDA 5DHUA 3RAEC 1HNXB 1EBFA 1L5ZA 5ALZA 5FWDA 4IINA 4BVGA 1T5LA 3ROFA 1MX1A 1NLZA 2Q2NA 3STHA 1W93A 1Z6QA 2UZ0A 4OV6B 4CIBA 2UZ4A 2IS4A 3U4QB 4GX1A 2VSOA 3OP1A 4DPKA 4AX4A 1JLMA 1E92A 4FNMA 4JI1B 1CR1A 4LQLA 5JHGB 4GZMA 3EQ7A 5I4KA 1U90A 2NU7B 4KO4S 1U3UA 3PQ8A 4Q0MA 2MR5A 1Z4LA 3PKZA 2ZBDA 4MRMB 2HGZA 1B8PA 1YONA 2TRSB 2CSUA 2PS1A 2GRUA 4OKNA 1YOBA 3I2JA 1KMNA 1N2GA 2JGFA 1YJXA 1YVEI 2O4CA 3QPUA 4X7RA 4IIDA 3TQRA 4EFNA 3GYGA 5KKNB 1F12A 5M7EA 5ER6A 4AL4A 4ND6A 1XZAA 5T67A 2QIPA 3E1SA 2JC3A 2WAYA 3H16A 4RY2A 1ABBA 4DL9A 5KZMB 3C15C 2R8ZA 3GHHA 2QN6A 3N2YA 3P2KA 4X41A 5FL7D 4NJOA 3V1UA 5KQMA 3CSUA 5KWSA 4L9WA 5DBOA 2XVYA 2EL7A 5DGXA 2BFEA 4FXPA 3UT5B 1OREA 4M2LA 5J4HA 4MWGA 1DIGA 1EK0A 2WABA 4GMFA 4JLVA 2QTTA 3LLMA 3O92A 4Y2RA 4S04A 4N76A 4BUZA 2QW8A 4ESEA 5CH8A 3LCJA 2R6CA 4NU0A 3FOFC 4UDNA 2ES4A 2I22A 3PFBA 4M9UA 3QEBZ 2BFMA 3M1IA 3P0RA 2A0KA 5FUVA 4YJFA 4O4HB 5DM0A 1BX0A 4N54A 4PXAA 2HBQA 1K2WA 1YO6A 1J7KA 3UPUA 5HDQA 1G8PA 1WNTA 2BGGA 3I61A 3UT6A 4HJRA 5CVCA 3KKLA 1QG6A 1ULTA 1WR8A 3WLPA 5BW6B 4F5ZA 4FNGA 1EP1B 1N3LA 2ODWA 3GQBA 3BB1A 1DXYA 1JLLB 1ZXXA 3R7LA 4D92A 5JRJA 1F6DA 1JG2A 3KSZO 5K8JB 3AIIA 4PXYA 1AO3A 2Q3DA 3EAFA 1JJFA 4HYEA 3DHYA 3WGIA 2I7DA 2WSYB 4S2EA 3HL0A 1EVJA 4O8ZA 1OI2A 1M1XB 3NGLA 2Q5HA 3H2GA 3SJUA 2D7DA 1I1HA 4DQKA 3I0NA 1BZYA 3NOVA 1AC5A 3ZN2A 3AM3A 4F6RA 2YASA 4MW6A 4DV5B 5I7FA 1CJTC 3N75A 5AKHA 2JG3A 3PNSA 3SR4A 2P3OA 2PAFA 4OLFA 3JQAB 1CJUC 3K0AA 1F2UA 1VPLA 5AI8A 4YQEA 1IEXA 5FPTA 3VTKA 4L4YA 2P90A 1RVV1 1LKZA 2WIAA 4IQFA 2PUWA 2G9QA 2ZBGA 4CMGA 2WMNB 5IUNC 5CCDA 3K9HA 4KQCA 3R8CA 2ZM5A 1ZIXA 3BIFA 3FFXA 3KT3A 4YY3B 3OY2A 5C52B 1RIIA 3W9YA 3LPLA 2X1LA 1YACA 5IS2A 2VDWA 2N42A 3R5SA 4G89A 4WLFA 4WOPA 4FFLA 4R2XA 4BHTA 1N25A 2ZFUA 6AT1A 3HN2A 1TX4B 1GSOA 1U8XX 2W0SA 1SA0B 4IWNA 3QKSA 1WRBA 4XOIA 2I4NA 4BMOB 2P6PA 1GTJ1 3GVPA 1DC6A 4HPXB 4C0SA 3W2TA 4IXWA 4GKJB 2AXEA 1WKBA 2GCOA 3AQIA 1KY4A 5HA5A 2W6JA 2HEIA 4H7KA 2QQ5A 2WP0A 1CLUA 3Q2KA 1G9XA 1H1TA 2G1JA 4J16A 1T5HX 1R0KA 2IEIA 1FUEA 2ZBVA 3JQ6A 3MC1A 5I7EA 3OE4A 3DYIA 5EWMB 3GUUA 5T6BA 5CPBA 1NNUA 1VA5A 4XWTA 5KYWB 4B7XA 3HSSA 2P2ZA 1CJMA 1IHDA 3DEZA 3BC1A 1R12A 3QQPA 2HK9A 2JKYA 3VC7A 1AT1A 4QJ3A 2XCTB 3R0IA 3K1JA 3FTNA 3CEAA 4MITA 5BMVF 4I4TB 1OU4A 1XG5A 3VISA 2YV1A 2YWJA 1E2MA 1EBUA 1ENOA 5TQJA 2P2YA 3VJKA 2X1MA 3EAQA 1ZXBA 4ZDKA 5A5EA 4HAYA 1SGWA 1Y4UA 1ACLA 2IZZA 5FHRA 2RI1A 4G23A 3OI7A 3PWTA 3U09A 1SCAA 2A57A 5LCXA 2G3YA 4G1UC 1I1NA 3ELYA 2BTOA 4ZI5A 4E5VA 4MQEB 2VF5X 3GT0A 1M6HA 3AFGA 2E5FA 4L8LA 4IH4A 2UUOA 2KHZA 1ZONA 1OBHA 1HLFA 4C04A 2QU8A 4P7BA 3N0VA 5DFAA 3ER9A 1OHHA 1NLYA 1Q91A 1TIKA 2P9YA 1PSWA 2UAGA 1ZCBA 2QXYA 1XLTC 3RSSA 2AZ4A 1C30A 2ZUSA 2CNDA 1HG0A 3Q3GE 5EJIA 1W4BA 5JMWA 1VYVA 2POQX 4LF9B 4O0MA 4PX2A 2VXBA 1KS2A 1FFAA 4YWHA 3D7LA 4YEDA 2PCLA 3R3JA 4NU5A 2IF2A 3OSUA 4PRYA 2BR5A 4PC2A 2AOXA 3SXUA 1LUAA 4Z0PA 2HDOA 2XOXA 1E9DA 1P3JA 4J7AA 4X24A 1KDVA 1PJQA 2O14A 2D5IA 2JAUA 1W8IA 5E3IA 1WAMA 1SULA 1WZNA 3HLKA 3VHRA 3WRXC 1KDZA 5JNWA 2QSUA 5LB4A 4A26A 4EJ6A 2YY6A 5A4AA 3FETA 2QE7D 3LOUA 3OCVA 3WLLA 4QXAA 3E7WA 2HJWA 3UMBA 4E2FA 4EYGA 1K7EB 5J4YA 1DAPA 4JI0B 1CS4C 2H0RA 4HHEA 4LHSA 1JHDA 1L4LA 2WSBA 3AOEC 1Z74A 3E22A 1EDBA 1SC9A 2X9VA 3MCVA 1E9AA 1U6IA 1ENZA 3I72A 2WSMA 4R9VA 3MGBA 2EBHX 1R0BA 3SYKA 2NXEA 3JW8A 3MJSA 4P1ZA 5TC4A 2BW0A 1LTQA 3K53A 3ZIUA 4CF5A 4MYTA 1JAZA 1JQJC 2RIPA 5ECGC 2O2JA 2GLTA 2J5KA 3CNBA 1FFEA 1PD1A 3A04A 4HVLA 1L8XA 1D2MA 1RC1A 2RKBA 4JLNA 1WB6A 2KX7A 2NO6A 4NYIR 3ROTA 4CHGA 1UFKA 1DAHA 3BREA 2A2ZA 5E7IA 3DV0B 4BNDB 1Z0SA 4DEXA 3MCZA 4L75A 4MVWA 3ZE1B 1GKIA 2JHGA 4YTEA 5B57C 1LK0A 1SZPA 3MB5A 1SKUA 2JJMA 3R9IA 3WGTA 2NUAA 3C70A 2CN1A 1SB9A 1O97C 3DLPX 3I6QA 3OD1A 4MA4A 3UJ6A 2ZT5A 3SK0A 3AV0B 1Z6PA 5F2KA 2VJMB 1Y8ZA 1ORHA 1Z06A 1ODFA 4TVKA 3AHIA 2AC4A 3CRMA 1OX5A 2C4MA 5LBTA 4QM7A 5B3JA 3NEAA 1UMDA 2GK6A 1TZJA 3G82C 2IPXA 2BEWA 5P8WA 3KHKA 4BV3A 3V9AA 2HWUA 2JFUA 2W6MA 4BZXA 4C4PA 1U28A 3LFUA 2V7VA 1U5CA 2E1PA 3NHPA 4P3PA 4WFJA 2P2GA 4IUBS 4D4JA 3LWDA 1TGYA 3CRW1 4YAFA 1R4ZA 3QBEA 4TTJA 3SS8A 4Q1CA 4C89A 4JP3A 1L7EA 1EWKA 3O0DA 1FYDA 1X80B 2GCIA 1FU7A 2YHUA 1K8XB 3R40A 2W6NA 2ZGVA 4AMYA 1EVIA 3CUEF 2ZWOA 1QHFA 3KKNA 3GROA 4DQUA 3MBKA 3BG5A 4B3HA 2XUHA 3BUSA 4HPJB 3UKJA 4RDHA 1T6YA 3I2GA 2QRJA 2JH9A 1YB6A 3P1JA 1JH8A 4HSEA 4N0PA 4TL8A 2A9RA 1G21E 5EZ6B 3KJQA 3TVYA 2HM7A 3E23A 4ADSG 1PUIA 3NHKA 1TT5B 1Q0PA 3PG5A 1WY7A 2I8CA 3FMVA 5K0NA 3IS3A 3WZ2A 5A2GA 3T0FA 2ZE6A 3MMXA 5ECYA 5BQ5A 3V55A 3SMQA 3QUSA 3M3DA 2O0JA 3AW9A 3RFXA 5EE3A 5IEJA 4CFSA 1ZD4A 2H6EA 5K8TA 1OUMA 4E22A 3CBGA 4JMLA 4M8SA 2ZKLA 3DZGA 5A1JA 1N6OA 3CLHA 2EGUA 5I01A 1YL5A 2AW3A 3DLBA 4BJ3A 3T3OA 5ES3A 2FN3A 1T3GA 1II8B 3HYLA 3WKBA 5LKRA 3GLGB 3D6MA 4PYQA 4AG3A 3ABQB 1EFPA 1U9CA 3OBBA 3SC6A 1HEUA 4L1KA 4JNKA 1H1LB 1I4DD 2VYCA 4LWPA 4P86A 1TUBB 1Z4JA 1LBQA 1NYTA 2GEFA 4JVNA 2BWJA 1E98A 4EBBA 4LF6B 3WMFA 1B8VA 1G9TA 3JVDA 4QDTA 4CTJA 1E0KA 2F9LA 5DCWA 4ZU1X 1UWVA 4A03A 2AUNA 1SUAA 2WYVA 4XR4A 4M6WA 3JQBA 4GICA 4CT5A 3U48A 1MTOA 4HDMB 2CE7A 3H2SA 4WK4B 1I3MA 2E4UA 3A10A 1LLCA 3JCZA 5EMHA 1PR1A 4ANFA 4H1TA 4BQOA 1U6KA 1C4OA 3KWMA 5EZSA 4U2EA 4FFMA 2Z43A 2JIPA 2CV2A 1TM2A 2FB9A 2QVYX 2POCA 4HK4A 2VDNB 1EX1A 2WNIA 3A6DA 3HCAA 3RVBA 4A16A 4J6FA 5AVTA 1YS7A 3TZKA 1DDIA 2PUHA 4DEYA 2OYRA 4ZI7B 1Z36A 2VK2A 4S1NA 1MIOA 4BN5A 2RD2A 1N3BA 2QJTA 3R6GA 1N6NA 3T41A 1E5LA 4HH4A 4KXWA 3WNBA 3HUEA 2VK1A 1UKEA 4E3ZA 1E7SA 4J76A 3A4VA 1HRKA 4LHWA 1EGAA 4W5HA 5LC1A 3SQOA 1UKYA 5KDOA 2GXAA 4BVHA 2VIIA 3SX2A 3BGVA 1YK1A 3M3PA 5TF0A 5FOQA 3NKFA 3HM9A 3N2LA 3THRA 2XUDA 3S1SA 4CF7A 1M6YA 1P60A 3WR5A 4B31A 1WXHA 4J6EA 2XE7A 3OQNA 3KJFA 4M9ZA 2X7HA 1TVCA 1ZGGA 4X71A 3BJIC 3K9QO 2XTNA 2R6AA 5B4VA 2NXJA 2FN4A 1NJSA 1PD0A 1RXUA 1YUMA 2J32A 3AEYA 3QMVA 4IGKA 4TL9A 1KYIA 3OJCA 4YJGB 3DDCA 4IZIA 3CMMA 5BW8A 1GNSA 1LI7A 2X1VA 1BS1A 3CPEA 1HKUA 3TL6A 1FFXA 4OQZA 4DHWA 1IG0A 3IAS1 4KYTA 1RHRA 5CM2Z 4KQGA 3ELUA 2R2GA 2VH2A 3FA2A 3KEOA 2M6RA 3JYLA 3P20A 3PJEA 3F0TA 3FFWA 3BWBA 5DBHX 4K9PA 5GPBA 1UBGA 2HCBA 1HLGA 4FWTA 4LQCA 1U9JA 2L0XA 1E9RA 4L5JA 4R31A 4WA8A 4DVGA 3B8EA 3U3RA 3TX2A 1TEXA 5J9FA 2VJNA 3AP2A 1MAVA 2IBTA 3FCAA 4PLPA 2IDZA 1FC0A 3QWHA 1CUGA 4PO1A 1L5KA 2DUNA 3ZZTA 3LQFA 4KE6A 4BEJA 1GY8A 4MWDA 3RRXA 2XF2A 1VL6A 4BO0A 5K99A 3IUSA 1FYWA 4NENB 4R1SA 1CJCA 3V7UA 1UZUA 4BMCA 4J16C 1EHYA 1DC3A 3S2GA 4IFTA 3A6LA 3SBDA 4R1UA 2GAOA 4ZOLA 3F5DA 2G9NA 3UUGA 5B1IA 1PFGA 3ETDA 3B20A 2F55A 4FSHA 1Q44A 1E3SA 3RS3A 5FOTA 1NQTA 4A0HA 2GAAA 2ERCA 2CLEB 4RKWA 4B6GA 5DNUA 4UCQA 5MHTA 1P4RA 1JKXA 1WLYA 2LCFA 3IO3A 1YBMA 1Z4KA 4JFAA 2YYAA 3DSRA 4X62B 2EBWA 2Z2JA 4O1HA 2FUG6 2CL5A 5DNAA 1OAOC 2O2SA 4EJ0A 3BOSA 1CULC 2C3YA 1OT3A 1EK2A 4BP9A 1Y42X 2HMAA 3CKLA 1E6CA 4R2HA 3SYRA 3EBPA 4O4HF 3ONFA 2AN4A 3F3YA 5D01A 1E1DA 2OD7A 1DKNA 5IJAA 2JKVA 3IMKA 4E1AA 4AXBA 4M99A 4NMLA 2PY6A 1OF1A 2RJOA 3R3YA 5JAHA 1OC4A 2YR0A 4FHZA 4HQRA 3VU8A 1E0AA 3N2ZB 1I6LA 3SX4A 2YVUA 3IP5A 2QRVA 3KOMA 4LWZA 4B4OA 3IBYA 5J5VA 4EG5A 1UBOS 1AZSC 4PHTA 2JD0A 5D6NA 5T4BA 3GGPA 5L6LB 3M9LA 4PPYA 1TIPA 4LGYA 1JALA 2ZJ3A 3KG2A 1P29A 5SZJA 3UW1A 2CJWA 1RCTE 3ISJA 1W88A 4JBLA 4UOZA 1HORA 3IBCA 4WNCA 1JQEA 2C59A 4XKJA 4U2CA 3GLIA 1MW9X 2F6RA 3TLGB 3VMMA 4QQFA 3UXMA 2HSDA 4E5MA 1CQIA 2HPVA 1F7UA 4OFZA 4UUQA 1WOMA 3EW9A 3L3BA 1SURA 1XL0A 2WFLA 2E4YA 3GRUA 1FDVA 1CY6A 1DIHA 1E4YA 2VDPB 3IUQA 1F38A 3M33A 5JBQA 4MQMA 5LDGA 2UZIR 1SXJC 4U2BA 4AKEA 4URUR 2AMYA 1FQWA 4AJLA 4DAEA 5A5DA 3LWZA 5KYUA 5B37A 3VYTB 2ID7A 1C80A 1TE2A 2Z9CA 3JQ8A 3MJRA 2I3AA 5HSGA 3KU1A 4LI3X 2GNPA 4LRQA 4HP8A 1IJKA 4O25A 1H3FA 4YRPA 4EUHA 5FEUA 2J3IA 1C1HA 4E32A 2FFAA 1FS5A 3LUGA 3PUVA 3HMKA 3LC0A 1U02A 4LVOA 4QOSA 5TQ2B 1GAEO 3Q88A 4AJ2A 4W8HA 3HI4A 1XVAA 2FQ1A 2ZXEA 4P36A 3KIPA 4X92A 2XCSB 1ND5A 2IOQA 5JJLA 1R0WA 4OJYA 3MMPA 5JVDA 3B3JA 4LZOA 3LZDA 2I6TA 5FTJA 5B2FA 4YV2A 2AG6A 1ZUD1 1SBHA 3U7EB 2EG5A 4NAVA 4NOKA 5JADA 4KR7A 3J7AC 4XVHA 4HMQA 3K8ZA 4PVCA 3L7OA 1QE3A 2NUTA 2QGNA 3QVMA 2QVBA 1LH0A 1T4DA 2GXUA 2PH3A 2E37A 2HJGA 1E20A 1D1QA 1PDOA 2NOAA 3AR4A 2GSDA 4MICA 3W4IA 5CFMA 2C29D 1HM5A 2W70A 3IA2A 3SJBA 4AZ3B 2CCGA 1VI6A 2N1MA 1UMKA 2JJ1D 3BK1A 3STUA 1BRTA 3G6WA 4LMRA 4PTLA 4ZGGA 2Q0HA 4CM1A 3NRCA 4DKJA 3N8IA 2RI0A 4B2PA 1BU8A 3N8KA 1GAJA 1C0EA 2R4UA 4LVUA 1W5FA 3BMQA 3TW0A 2VPTA 2B3DA 3EOBI 4HQOA 2CHGA 1SHZA 1FLVA 1J49A 4OLHA 3UXEA 4R4JA 4P0PB 5JPIA 4FYPA 3D64A 4EARA 4MCIA 4CLDA 3A7DA 5IAJA 3UAXA 4XJXA 3NYQA 4K28A 3NXSA 3VNSA 1QP4A 4W7HA 2DWPA 5BVHA 5GM2A 4NPAA 4YMTA 4BFUA 1YUBA 4P31A 2X2OA 4KXMA 2E82A 2DQSA 3CNHA 3VR6D 4RCVA 1C30B 2P9GA 1X6VA 4H6XA 4I4NA 4IAOA 4A6XA 2H1IA 4G1CA 3Q6NA 1CZRA 2C00A 4EI8A 4EUSA 3UBTA 4QXOA 1CVLA 2GBPA 1GTG1 2NU6B 4BRZA 2A1TR 1X8KA 4HNHA 4IW3B 2X5JO 3H1EA 3ZWDA 3DB2A 5CBPB 2AYZA 3QLTA 2WEKA 4AP6A 1WABA 1CXZA 2H11A 4EL0A 1R9GA 2WB4A 3HN6A 1SVIA 3IUEA 2W2PA 3LI2A 4IP0A 1BMFA 4N5NA 2DHQA 4XX0B 3H1BA 4BLOA 2QD2A 2J9FB 3B13B 4PCLA 4C7MA 4GVLA 3S27A 3WYGA 1RKXA 5A3JA 3ZV3A 1PLJA 1YVPA 3QBVA 1QQ7A 1QKJA 2I34A 4QUIA 2BI4A 2RGNC 3OETA 4JL5A 4OB6A 5IBPA 4ALKA 5BNTA 4GDFA 1UXGA 1EVLA 2A33A 2I4MA 4I3FA 3GUCA 5DTEA 2GTIA 4YMGA 4FNAA 5K3OA 1UBCA 1Z8NA 4RHFA 2H29A 4FMCB 5K0SA 1X7ZA 1VE6A 1XDZA 4CQJA 4DG9A 1KRHA 3UMGA 1J8DA 5CFZA 2XVAA 3QEMA 4H7EA 1XNQB 1ZA1A 4O02B 4LC0A 4KTTE 2D06A 1XNJA 4FB5A 2PUDA 3V5NA 4ZQHA 3M6VA 2PA0A 3WQBA 2Z5LA 1KXJA 4BJ5A 1NBME 2CVFA 1KETA 2WAXA 3FZQA 4IHJA 1M1UA 5LZ8A 1VBKA 1IU9A 1UKZA 1QCZA 3IFSA 1QG2A 2PX6A 4KREA 3FH0A 4G8DA 5K05A 1NQAO 2X5NA 3PUHA 1OX6A 5JNLA 1RLJA 2P3SA 3AOGA 3NBYC 3FSEA 2Q7XA 5EWLB 2GJ8A 1IHPA 4AJ9A 2DF8A 1GPUA 1DTEA 1OTYA 3K9GA 4ZZ2A 1W35A 3MFYA 2ONCA 5D6OA 3IQDB 1X1AA 3CINA 3TJRA 2JAPA 2OSBA 1KVQA 2P4SA 1C3OA 3HV0A 4UHBA 3OQPA 3EUAA 4UKDA 2Q5EA 3L93A 2YVLA 3RS2A 3UJNA 2GBLA 2CXNA 2GS9A 2R6HA 4D9NA 2M6LA 2OM6A 4W7IA 4C78A 1WUHS 3D7RA 4OUDA 4JOCA 2LDBA 1ESCA 1EI9A 1J8MF 4N8EA 5GJCA 4HUQA 1AKVA 4IZOA 4NMMA 1YQDA 1P2BA 3GLGE 2Q6TA 3LRPA 4PLVA 5CM9C 1Q0RA 3BJZA 5C4GB 3HNPA 1V3TA 4BFXA 1PNRA 2HSJA 4EIWA 1E7YA 2X40A 3C3AA 1P7PA 3VR6H 2XRZA 3DBOB 1XD2A 2XI4A 3UJ7A 1DO2A 5K9ZA 4CUZA 3FY4A 1P5JA 3OMXA 2Z98A 4Z4FA 2ZJ5A 2YUTA 1WHSB 3MT8A 2ZVQX 5CYGA 1KVSA 3QFHA 4V24A 3BIXA 1R15A 3UZUA 1CUVA 3O4IA 1CUUA 5L51A 1SU7A 3S55A 1M7BA 2UVDA 3N28A 2H8KA 2HJRA 1LJLA 3PWKA 4RBNA 1V8FA 3MD9A 1E0JA 1JFLA 4QOGA 4F1WA 1Z5NA 3Q0TA 3BXFA 4E14A 2OCIA 2YW2A 1SUIA 1G5RA 1R8QA 3RNLA 5C1DA 2XUZA 1UC4B 2L69A 4R8VA 4LC1A 5LZ9A 4G86A 3A3KA 3IAHA 3FWKA 4HFRA 3WBKA 2C83A 5C37A 3GZNA 1R9NA 4M1OA 2LKDA 1E3LA 2FZWA 4IJQA 1VB3A 3L8ZA 3PNPA 4N12A 3QWAA 3OLWA 2V7WA 1VI5A 1GO2A 4XLLA 3F8WA 1PT9A 1L5OA 2WHPA 2YN0A 3LXMA 5KMGB 2VG8A 3N2NA 4RPLA 4H6PA 4BZPA 4TV9F 3JXEA 2JDIA 2OXTA 3DXXA 1VG9B 1DG1G 2A3RA 4XXHA 3CRNA 3DJYA 3HKBB 3QIVA 3RYTC 2O7QA 3UKOA 4JXZA 4ND8B 3QM1A 1VLJA 2OO5C 4NJMA 3GFRA 3LBIA 2HNKA 5KSZA 2R96A 3A36A 3TDKA 4FSXA 1XRQA 3H2YA 2IYEA 2AJDA 2BM0A 2NXNA 2XZDA 3I9MA 4WV3A 2WTEA 4PG5A 5EC8A 4RJTA 1KDRA 2XB2A 1A71A 3BXGA 4BKUA 1QPZA 2IYPA 4O1IA 2O59A 4J2TA 4OQPA 2FP4A 4MV9A 1ZVKA 1K8QA 3HB9A 3BAFA 3ZNPA 3ZU6A 2VUIB 2NZUG 3O9MA 2X0NA 4U2FA 4NPCA 5JHHB 2ID4A 1NNI1 1QGZA 3WIDA 5ILQA 2QRLA 2J41A 1EXDA 1YK0A 1OXVA 2UXCB 1MMFB 2FU5C 3DMNA 4JYMA 3K9NA 3HDQA 3D3WA 3TMYA 4ESVA 2H0AA 4GC9A 3SGLA 1XLUA 5E6UB 1CNMA 2Q3FA 4U7WA 4FW9A 1OYYA 3IDSA 3HXKA 4MQ5A 4OQXA 5KYNA 4JSYA 1T8WA 1NVVR 5FORA 1UEXC 5AFSA 1Q3HA 2PR2A 1PEAA 4LYEA 5KYXB 4EFKA 5HRUA 2ON6A 4U3JA 4B7AA 1IUNA 2PX3A 2IHNA 3OEED 3CGGA 4L4XA 4QL3A 2E4WA 5IJWA 2DTEA 4QBTA 3R3HA 2FEMA 4BMSA 4JQSA 2RGDA 5ALSA 1PGQA 1OZAA 3U0VA 1UQUA 5AKXA 4D9MA 1RRPA 1ZGCA 3LQ1A 1JTFA 2P4UA 4OGFA 1A8QA 3IC5A 1OLXB 2YJ6A 1MOPA 4DZRA 3FYDA 2EP5A 1KMIY 1DZ3A 4GPAA 4KXFB 5KI6A 3AV3A 4BLQA 2PGLA 4FUQA 4C76A 4WN9A 2Q41A 1C7ZA 1DRJA 1LF5A 2VPZA 4KYVA 5AM4A 3ZLUA 4B4UA 1SXJD 3W2EA 5LZ4A 3O7WA 3E7DA 5HE8A 2FXVA 1ZI8A 3COSA 4UZEA 3BTVA 5BSUA 3RO7A 3GJ6A 3FDZA 4BCBA 3EZLA 1U98A 3EXG2 1Z0UA 4TV8F 1R0LA 2DHDA 1EFRD 3UOGA 2B4AA 3UG7A 1ZMRA 1S4MA 2O6LA 2UVQA 3PT5A 4FOLA 2WHPB 1O6ZA 3EIXA 5P21A 5B2EA 2CXTA 1GV0A 5KQSA 5EIBC 2H16A 1TVMA 2GEBA 1FBTA 2ODPA 3DO6A 9LDTA 2B4QA 1OXSC 2XNCA 3KZOA 4GEKA 2JGNA 3TR5A 3AGPA 1ZO8A 1NP6A 2DG2A 4QBGB 1UKAA 4RA6B 2CJFA 2FCRA 2LIVA 2P7IA 4L50A 2DPXA 2ZI6A 4HAOA 4QASA 5FBHA 5T4HA 3RKUA 3NHZA 4OJNA 2I6UA 1BDBA 1SNYA 2GX6A 1U2TA 3MF4A 2EFCB 1AOXA 4QOIA 3OECA 5FBZA 4DLPA 1LFAA 2AZTA 1X15A 3N87A 3TTUA 1NVXQ 3DF7A 4Y2VA 3R20A 4DQXA 2V7EA 1COWA 1VA4A 2XJ9A 2RHBA 4H08A 4M3NA 5DRYA 1Z6TA 1UPTA 1Z4MA 3TFWA 5EIXA 3G8BA 2YZGA 4V02A 3VPAA 1N0IA 1PWYE 4NZNA 2MHCA 3OHSX 4QDUA 3AOEA 3QF4B 3EZGA 3A9RA 5BSMA 2O50A 3FVWA 1JS1X 4IVPA 1QVVA 2IYWA 3PDHA 4V1CA 3LUBA 3OUZA 4RMHA 3OZVA 3H5RA 1QVWA 1P2VA 1LW6E 3WJ1A 4CL2A 3VO9A 5ELXA 5DTJA 4P92A 3OU6A 4CLOA 3GVCA 2CLKB 2QUBA 3GUHA 4EWLA 1TI7A 5DTIA 4P3NA 5IBCA 1P9NA 1S3FA 1V45E 2FUCA 2JGKA 1KDTA 2WICA 3CKKA 1P75A 2FZCA 3GCDA 4LDZA 1JB1A 3E27A 1QCYA 3ZJVA 1PV4A 1OFHA 1RKQA 2A30A 1Z88A 1T5OA 1VCOA 2GO7A 3VR0A 1W2GA 2PLFA 1JYFA 1K6EA 3EIQA 2DJIA 2UYYA 4NS1A 3BT7A 3U3OA 5CT6A 3TSWA 4PO3X 4ZAXA 2WUEA 4MUKA 4C4ZA 5CU7A 5B58T 4G0WA 3QWFA 1VXOA 4TQGA 3B7GA 3I8SA 1G38A 1B6GA 4S1WA 2D0OB 3CNOA 3RUCA 3DAYA 1CZKA 5B6IA 4AY6A 3AVTA 3H5LA 4OP2A 2IYLD 1WQ3A 3MW8A 1LRLA 3FVQA 3PPIA 5CJJA 3HXPA 2FF5A 2BH9A 3B6JA 4RQBA 3RSHA 3T7TA 2CK3D 3M6WA 2HC9A 3FTDA 2YH2A 5H3CA 1T0HB 1ZM9A 1VKOA 1W5BA 4Z3DA 2YZKA 4AU1A 4CVNA 3KT6A 1XYVA 2CFSA 3OZTA 3PUKA 4HVAA 5FUQA 2C9MA 2OBBA 4TLAA 5FUBA 1I7NA 1JFFA 3A1VA 2ZVDA 1ZD9A 3E5NA 1J8YF 3EHDA 3GRVA 3K1YA 4K9NA 1JEOA 2BMFA 3ELWA 4FYWA 4P38A 1BW9B 1Z0FA 2C8KA 3I39X 3ET4A 3DM5A 5HJEA 1YR7A 2OHXA 5KDLA 4EG1A 3AI2A 1VHTA 2G8NA 3VR5A 4RMJA 5CEEA 2VZLA 4LWOA 2QTVB 3PC4A 3D8TA 3SIPA 2RHCA 2DWOA 3NBXX 4UTNA 5DU2A 3GG2A 3MBIA 1BAPA 5AXAA 5JS2A 5AHRA 3V4PB 1P2TA 3UHPA 1MZPA 3TIGA 4QT0A 5CB6A 2OCAA 3O21A 2IYAA 1FDIA 5AXCA 3LPAA 5JARA 1V2GA 2B5VA 4JLSA 4FCVA 4MRSA 4NP6A 5JQGB 2QM8A 5CW1A 3EZNA 1LX6A 2XD4A 3WL6A 1RC8A 1G8GA 4BE7B 3PUIA 8MHTA 2BJWA 5J1TB 5ALFA 4N48A 4GP9A 1NFRA 2VHWA 3IMGA 3IVCA 4U8HA 4RCYA 2M32A 3UNXA 1ZC4A 3EODA 1N6KA 2FMHA 3IJEB 2XW6A 3SQMA 1PW7A 2ZXUA 2GBFA 3DE3X 4K9MA 1A27A 5KREA 1TB4A 2N3ZA 3LXXA 4Y2GA 1EFHA 1KU6A 1R0SA 3NH9A 3Q9UA 1PJAA 1R3UA 2GETA 3L4EA 3BTSA 5EEGA 2PFSA 4C30A 1FOEB 1ISIA 3AY3A 4M9XA 5A9TA 2IHYA 4GSLA 4LJ9A 3M1YA 4J8PA 3GBPA 5U1PA 4OY3A 5HK8A 2PSEA 5JSZB 3MTBA 3UXHA 3P19A 1Z5GA 3IPAA 5ALLA 4GVXA 3E1GA 4V0ME 4ESOA 1RJFA 1VL1A 4GO1A 4R05A 4E5SA 3HKEA 5F52A 4AJ4A 5LQKA 1O95C 4K6HA 1I10A 3LDUA 3QU2A 2PMBA 4MMZB 1KH1A 4D9FA 3ZXSA 2ZAGA 4LOJA 1T9HA 1IN4A 1HA3A 4LMBA 3RH0A 3OM8A 4DSUA 2WF7A 4LYFA 2FCAA 3DTVB 4OO3A 2IW1A 3ITNA 3WGYA 1VL8A 4YJ2B 2WUDA 5KNDH 3CS3A 3ESRA 1I51A 2FE1A 4JC5A 4PW0A 3KZNA 1YI8A 2XX3A 5HM6A 2JEZA 3HDGA 3M82A 4IO1A 1SBYA 1UBFA 1NDHA 3OC0A 5ALXA 5KQPA 1K9SA 5G0TA 4R51A 1P80A 3GP5A 1DT5A 2V6JA 3NT4A 3Q0IA 3KXDA 4OM8A 4B6OA 4TYYA 1FUKA 4RTMA 2DWUA 4TS9A 2AN9A 1FMJA 3EF1A 1MV5A 3V1MA 3CZPA 4F11A 4LHXA 1T0PA 5SYNA 1R0YA 2FSPA 4FCWA 4JQZA 1XEWX 4ENWA 3K09C 2EDAA 1QC5A 2CGEA 3CEJA 4E4RA 5F9MA 4B3DA 5KHLB 2HSZA 3Q9NA 1W6UA 3I28A 3R0JA 3WLTA 4BNMA 1ZS9A 3I2IA 1P1JA 2V6GA 3PEUA 1DQRA 3RJTA 2P62A 3LRTA 4C1BA 1MW8X 3OX1A 2AQKA 3S40A 1X39A 2MYNA 1Z7WA 4NTZA 3OPYB 2V7BA 2WIBA 3LG2A 4QOEA 2MINB 4RHXA 4A6PA 2AC7A 2MDTA 3AT1A 1BS2A 1HZZA 3KPWA 3KUCA 1YOVA 1ORDA 5IABA 5AHWA 2L18A 1SD1A 4MRAA 2Q8QA 3MS4A 1RLMA 4IIUA 3NG1A 1C2YA 2C0QA 1Y8RB 3OQVA 4KB5A 5G2OA 1O6BA 5JJ5A 1CPYA 4M1KA 1LLFA 2VQ6A 5EPEA 4FBMA 2WTXA 4R2LA 5FOXA 1KERA 4FFBB 4F2WA 2RI6A 5DHRA 3H8SA 4O2BB 1Q95A 3PHLA 4J03A 4KZPA 4E12A 3R74A 2HADA 4B2LA 5K0ZA 2BEJA 3GAAA 3DDOA 3HB1A 2H9AA 4P7JA 1AGYA 1BCRA 2WWFA 3KZXA 2VQFB 3WGQA 1PS0A 2Y05A 1KRWA 5FTNA 1KE1A 3GFQA 4H4DA 3JAWB 1XZMA 5CFOA 2DVMA 3LJKA 3DCJA 3K8YA 1II0A 1S5PA 3QPAA 2A9JA 3SXPA 2ZWPA 3AVUA 5IZ4A 2R85A 4UJ5A 2VTEA 1IEVA 1D0SA 2CNWD 4QSHA 1AQYA 2KLHA 1ZD8A 4YRZA 2O3RA 5AHXA 1XDSA 5JDIC 3MTDA 4YP1A 3ND6A 4GBMA 5IUKC 4O0LA 1NVBA 4Q6WA 1J8QA 1DEAA 2JI8A 2Q5FA 5L40A 2D5AA 3A4TA 1WW8A 1E0DA 1J0AA 3OQIB 2ZB7A 4US0R 1KWGA 3A9VA 1DC5A 2D7CA 4MB0A 4NFHA 1GTVA 1RT9A 3DZHA 1AB5A 4YMHA 3LUFA 4TKVB 5B6PA 3ZJTA 1LZKA 4JI8B 1OTXA 3OTWA 3C3DA 1E1CA 1ZH8A 1H66A 1GGHA 4ZAWA 1GUFA 3WAKA 4CL0A 3C85A 1UJMA 5JYCA 4F3KA 2FAXA 1XHEA 2V3CC 5JC1A 2VDMB 3I2HA 4QYXA 5DW3A 3ME5A 5I9MA 2J59A 1G1AA 3TTSA 1MV8A 2CL6X 4PRKA 2R87A 1C0LA 5F9HA 3OJXA 1P0CA 3P0EA 4UHHA 4I3HA 5AUOB 4NABA 4RJIA 2VPIA 1P62B 4F2GA 4P35A 4HT3B 2I7CA 2FEPA 2WUVA 3DE7X 1BOOA 1PLKA 1KQOA 4Q1FA 5KTPA 1ZJZA 3N0XA 5HOEA 2I87A 3E8XA 2ZTVA 3QXSA 4CEIB 1CB0A 1DX9A 2QUAA 4YQFA 2IX3A 2UVPB 2QTWB 2ECPA 1D3AA 4ISBA 4ZEWA 1E3JA 3RS9A 1EZ1A 1FDWA 1QB7A 2GPWA 3I9V6 1E8MA 2VPWA 3OOWA 5LA6F 3WB0A 1TCAA 3JYPA 3K6RA 3DAPA 3LXRA 4NK4A 3KB1A 1U7OA 1XXHB 1ADBA 3U0BA 4MUXA 2G82A 1P7VA 1KZYC 4TGLA 4TV9A 4P53A 1QQ6A 3F6PA 3G02A 1XTRA 2Q9AA 3O8OA 1F60A 3I6YA 4RGQA 5IBRA 1R4NA 5CDYA 3GARA 1I7DA 1HQKA 4QUGA 5IXYA 3VH2A 1B16A 1CJVC 4LKOA 1UOPA 1LBEA 1R0XA 3JATA 3KXPA 4FQ7A 5EJEA 4B75A 4EZBA 4DLWA 4F4FA 7ADHA 4L27A 2FWNA 2REQB 1BDMA 3ZE9A 4B3FX 2QX6A 2PL5A 4AQ7A 1IB0A 1NQOA 2B98A 1NXVA 3PQCA 4MINA 1F0YA 4IJKA 1TU3A 3W8EA 4YCLA 3G0DA 3WGLA 4KH0A 4PFQA 1FXUA 5B3JC 1UC9A 5BWOA 4B6EA 2R4QA 2QN9A 1AM4D 1RFGE 2ZQ5A 4RK4A 5A4KA 4QYIA 4TMXA 5C51B 4FLEA 3NVDA 4UC0A 5LJLA 5DDIP 1HL3A 3ZI4A 4Q4AB 2RK4A 2BZSA 1M8PA 5K45A 1TNDA 4OQDA 1ZN7A 3WLJA 3V2HA 2AD1A 3FOZA 1RAGA 2V6IA 2WG1A 4XEHA 5DK6A 3ETHA 2XKAA 3MWDB 1IN8A 2OPBA 4MMXB 3ANXA 3HVHA 4O29A 4U7PB 4E4TA 1FXWF 4HUTA 3KR9A 1LBHA 3OZBA 4FCCA 2OQVA 2QV7A 1J56A 1NUPA 4ETNA 5IT0A 4FSDA 3NBFA 1UC8A 1VGVA 1XEXA 1OWPA 5HXAA 3VR5H 4UD2A 1YBHA 2GF2A 2DFVA 2VYQA 3AY6A 3GRZA 1M9NA 3E9NA 1AKQA 4NECA 3KVRA 2JFQA 1TJ3A 1G98A 1MNAA 2C97A 1XD9A 5AM5A 2FJUA 3FCCA 1R8XA 2A9VA 2QV0A 4GI3A 1NXWA 4DLSA 1F2DA 2WE8A 5I51A 3N7AA 1QH8B 2CFRA 1AKYA 4GKAA 2D0DA 1FA9A 1H8EA 4ASUA 4XQ0A 2OHJA 3QENA 3IR5A 5SZKB 4E1VA 2C3MA 4YO8A 1J1ZA 3EZ6A 4O59O 2OE2A 4DR7B 3IEKA 1RKVA 1CUZA 3I09A 3KFVA 3QLUA 4OMUA 3N86A 3DBRA 2I4RA 4IKPA 1C1XA 5FIUA 2AOVA 4X97A 1NW6A 4YRGA 2AL7A 1PYGA 1Z2AA 4MUEA 3KDSE 4CCYA 1J8VA 1QFMA 1YJBA 2C1XA 2CDNA 4F5WA 2FEAA 1LQTA 1QRDA 2V6MA 2WT9A 3PJGA 3PX3A 3R9XA 2NP6A 5LMNB 1WCIB 1Z39A 1JQ3A 1V8DA 3H2BA 4BBPA 3L0IB 2QB5A 3JQBC 3DB1A 3SX0A 4Q48A 5DIFA 4QTZA 4UTXA 4GXQA 3RYHA 5CA1F 4WESB 1G3MA 4CM8B 4FB4A 1KJWA 2WZQA 1CDEA 1T2EA 4D3SA 4UUPA 1XQ6A 1Q2UA 1Z5ZA 2WUGA 4JOSA 1Z29A 4X7PA 1SUEA 1J1UA 1RNLA 2X4DA 1NVTA 1XZHA 2FRVA 4PC3A 2ZIXA 1EWRA 3QLVA 4JQOA 1E2JA 3AFHA 3FWYA 3W8RA 3CVUA 4JLAA 2ZSJA 1QG4A 2VJPA 2C3PA 4QOFA 3OKCA 2TSYB 1WSDA 1YR2A 3PE6A 2A1IA 5CX4A 2J9GA 4TMWA 3Q15C 3JR7A 3K32A 4AS2A 4WI1A 4B17A 3GJ0A 3WMWA 2BRUC 2O1EA 3VYVA 4L5AA 5AJHA 1M1YE 2XADA 1O95D 3FPAA 3SFZA 3BXZA 4J2HA 5ALWA 2JAXA 4HS4A 2EGGA 1NKSA 3EZ2A 3ENKA 5F5XA 1K92A 1O9GA 1U99A 3FW1A 1LX7A 3M34A 3W9SA 1GG5A 1A4UA 3AUXA 5I7AA 2WQ7A 1NBOA 1PR2A 1PJBA 2ZUVA 3KE9A 4DG5A 3C6ZA 2C57A 4PQYA 5KNBD 1MDBA 5JAPA 1CIPA 4TKZA 1QX4A 5WRFA 2OAGA 4GFDA 2VJOA 2BGTA 2CMHA 2Q4TA 3MLAA 3WNZA 3ZQ4A 2A7QA 1YDHA 1EGHA 2QAJA 3RTBA 1Z7BA 5JG7A 1CUJA 2G83A 2RGBA 3HBLA 3RVQA 4EHIA 5KB3A 3MSCA 5H3LA 1T5TA 3LUCA 1JPNA 1KI8A 3GGGA 4ZIRB 3K30A 1OWLA 5C8XA 5JS8A 3THXA 2FW1A 4NYJR 4R2KA 4DJEC 5SZHB 1YMUA 5LSAA 4N18A 1JSXA 2WD8A 1PJ8A 3QELA 3KLBA 5E4TA 2ZPAA 4WH0A 3IE1A 2LRHA 3IP6A 3FFAA 1E7QA 3O1HB 1UJ6A 4DRXB 1ZOSA 3F1KA 821PA 4CETA 1A5AB 4NBUA 1R10A 2B9VA 4UEJA 4ZT5A 4Z51A 5ALVA 2NT4A 3PS9A 3INTA 3AGQA 1P8JA 2ZJOA 1CQWA 3SHWA 3SVLA 3LO5A 3SHOA 5ESDA 4O4IB 3OKAA 5BSVA 4X44A 1R37A 4ERXA 4OI0A 1WB9A 5A04A 1T5SA 4B2YA 2WYOA 1MBZA 1EPUA 2W37A 4M0LA 3S44A 4FDVA 4P0QB 4D8VA 5ALKA 1VHWA 5DF1A 1Z0ZA 4OPMA 4HI0E 1PWEA 4QXPA 3TAHA 3ZGXA 4EELA 4JEIA 4N4AA 4OJMX 1UXJA 4W1RA 3MMNA 3FRIA 4IICA 4CMAA 4JLPA 1RLTA 5JI2E 1I6KA 3UKDA 1B26A 1QTRA 2J5XA 2X86A 4TUYB 3GGSA 2F64A 2Q1UA 4OFBA 1BFUA 1I36A 1NIPA 1EE1A 4A1OA 4LFAB 5LIRA 4M0DA 1Z6XA 1JLRA 2NZYA 3BX1A 3ZU5A 3FLAA 3I9NA 2H1LA 3K0KA 4JR1A 4P80A 4ZEVA 4AO7A 1ULUA 4F3RA 4JK3A 5AK5A 1JFRA 3QF7A 3O7MA 3PEWA 2YMMA 2A0UA 4IMRA 4KN5A 5FI5A 4CEJA 2OGWA 3HZOA 3RGWS 1TQ4A 3HA3A 4K1XA 4WKBA 4WK6A 5D3MB 4CMBA 3T1NA 3LKZA 3D6FA 4MVJI 3KKOA 4MPPA 4KPUB 1PL6A 1GQFA 3H6KA 1N5MA 4EPRA 2G40A 5CTAA 1AS3A 2B8JA 2QENA 1Y33E 4V1CB 2VN8A 2PBZA 5KCMA 1HURA 1H0HA 5JAUA 2BDEA 4MIYA 3GMIA 4LXHA 4RZ3A 4RTRA 3MERA 1L7MA 5B7PA 1XLTA 3HJHA 3GMDA 3GCWA 2QG9A 1DAKA 5TARA 4Y9SA 5IYZF 4EPVA 3HR8A 2V7QA 1TPYA 1ZD1A 4QBFA 3OZWA 4DXAA 1V1JA 4JU9A 4EBFA 2V9CA 1C3LA 4EO9A 3SE0A 3C5EA 2I3ZA 3QSGA 4QBIA 2O8DA 3ZHCA 2NADA 2AWNA 3M5CA 2GO1A 3EA4A 3WWEA 2FFBA 1GR1A 3MWEB 4O4HA 3NWPA 5ALTA 4FGSA 3RC2A 5B6JA 1P2UA 1T2VA 1VKNA 4NYMR 4FN5A 4FI3C 3QNMA 4R54A 1E7WA 4R84A 5FLYA 4ETIA 1KPHA 4JI3B 1MPTA 1EB9A 4IL5A 4XPIA 5AVUA 4F4HA 2PJUA 4F9EA 2EZUA 3L7CA 2P75A 2CMDA 1ZK2A 3QVTA 2J6CA 4TLBA 2CDRA 3BH6A 4P4GA 1T0JB 2A92A 3PC2A 5H68A 1DOAA 2F43B 1MGPA 2A88A 1DKLA 4DYDA 5I4BA 1D5CA 1ESNA 2OR3A 2CLCX 4XWOA 4DNPA 2JAQA 3M81A 4LWQA 3T99A 4MJLA 1R4MB 3WB9A 3A4LA 1HEIA 3L0ZA 4X1YB 3VYUB 3KV3O 1M6VB 4DM3A 1L7BA 5LU9A 5AW4A 4JT9A 4M7PA 4MPTA 3MCAA 1A9QA 4BLPA 4LECA 2IE0A 3KEMA 2M1ZA 1C8BA 1I3LA 3QMWA 4ZP1A 4TN5A 4TVSA 2IWRA 3UB2A 1ZAYA 1E8NA 4ZN6A 5FQOA 2FUG1 3CQ9A 1V41E 1SCUB 4HDNA 2OHIA 4HYYA 3ZYZA 5EUCA 4BP8A 3LW7A 4TXJA 3SNHA 4AURA 5ESRA 3ROKA 4CF6A 4ER7A 4PZ9A 5AUPB 3DMYA 1LLDA 5H02A 1Y7PA 2WYHA 2IHJA 1UFQA 1VGQA 1W8DA 4JIMA 1N0HA 4GF5A 3CVJA 1PU2A 4X1YA 5G02A 3U17A 4BFCA 2CXRA 3MAGA 4CL3A 5L3ZA 3ROEA 3PF9A 1YDEA 5JXGA 3IVXA 1MP0A 1C3OB 4DMKA 3L43A 1EM6A 1IHUA 5DXFA 3KKZA 3H5NA 5JY1A 4IGIA 3VAYA 3ZWPA 5AVXA 1YRHA 5DULA 4XAQA 2VHZA 3GFSA 2VP0A 1I7LA 1JDBC 1M34E 4I4IA 5J2TB 1QE0A 4DB4A 4LX0A 1WCV1 3EWAA 4J1TC 4PYIA 3TOZA 1YS9A 2ZS9A 2R7NA 4OXYA 3GCGA 3HO1A 3NDRA 1KGSA 2P77A 3AP1A 4JLMA 4CCWA 1H6DA 1JXMA 4PFJA 1N5DA 3EUFA 1ZD5A 4DBZA 3L6OO 4PEVA 3C74A 2HNAA 3EDYA 2AQIA 4PG6A 1RRVA 5DWQA 2GCGA 3IVAA 1P9WA 3V42A 3GEHA 4YCNA 2DKFA 2F48A 2H59A 3WJ7A 3SHTA 1M1YA 2IUFA 3LAWA 1NVMB 4FXOA 4JWTA 3ILYA 2X2PA 1E2UA 1P44A 3E18A 3QHQA 4URWR 2NMVA 1GNQA 4GI7A 4RXTA 4NHOA 4UUNA 4CRWB 2C84A 1H9BA 1Q5PA 2FX5A 3DMRA 3IMFA 4KIUA 1XRPA 3VU9B 5K6RA 5A7FA 2Q5QA 2RAVA 3AINA 1V26A 4F06A 1MUUA 2FR1A 2Y9PB 5JCPA 2HRZA 2OO5A 2O2HA 5G40A 2R84A 3C7DB 2HBZA 1P7CA 2FG7C 4GMHA 3DD5A 1E4OA 2G9UA 4R6XA 2XE4A 1D6JA 2JHPA 5K0TA 4M1SA 1V9SA 1W1IA 2AG1A 2AT1A 1O8BA 1GSIA 4PLCA 3CVVA 1F4VA 3ZWBA 1J42A 2VHUA 3OTQA 1U8FO 3E03A 2BKXA 2WHXA 5F33A 1IHXA 3TMKA 4LCJA 4C0QC 1N75A 2R1VA 1C7IA 1Y3IA 2HL6A 2CXPA 2OFWA 1UM8A 1YGYA 4KWEA 1V4NA 5FXMA 4EJSB 4ZMSA 3LLCA 2O8FA 1EU1A 1A5BB 2VJBA 4C06A 4IGFA 2IPAB 4HEJA 3TAUA 3EY9A 3RU9A 2AC2A 1L6RA 2PGJA 3PPWA 1BMDA 4AI6A 1CE8B 1KIMA 3ZWWA 1VE9A 3BWYA 3KOWA 1CJKC 4KE7A 2ZRPA 4KIWA 5DT9A 3HEMA 5TGZA 5BW5A 3RBXA 1MO2A 1X2EA 3WQQA 3UH0A 2O8EA 5CH5A 3DUWA 4WZ6A 1UFVA 5CEFA 5HRCA 3B89A 2BFFA 3SDZA 1H8ED 3DVAB 2WW8A 4ASUD 2A86A 1KZ9A 2PK3A 4KFSA 2PUEA 2I6GA 4M9QA 1DNPA 3VHXB 2R8YA 3C87A 4RK7A 5J47A 3ZGVA 1S2MA 1E6UA 2CCJA 4UULA 2NT3A 3CF4G 2A4MA 1WMDA 3HRKA 5DLPA 1MKYA 4NDZA 1TOAA 2O7RA 2VJLA 1XEFA 3CUKA 2ZM6B 3U62A 3A11A 4QDJA 1Z3IX 4E07A 1ZVVA 3OX3A 4B71A 1IE3A 2A5JA 5E1OA 4A1FA 1QV6A 4JX9A 4IEEA 4RVGA 5F76A 3RABA 2D4AA 1KFKB 1MQAA 3FPBA 4L76A 4TTTS 2XZOA 3D5QA 3FIJA 3ESAA 3ZGNA 3NB0A 1K4YA 2H0QA 2HV8A 1RI2A 3KSDO 2VNJA 4C4RA 3GV0A 4IDGA 3U7JA 3H1FA 3R3XA 4A91A 4TQ9A 7MDHA 2XHEA 1Y6QA 1UBTS 1GEGA 1IEWA 3AHEA 3GGJA 5EXEA 5H9VA 3RRYA 1F48A 4JC4A 3BF8A 5J58A 1IVNA 1NT2A 4JUDX 1JVBA 1SK9A 2QX4A 3JASB 1GITA 2FX2A 4GRAA 4YMIA 5AK3A 1SEVA 2HRQA 2VRCA 3GCZA 3CKYA 3KYBA 2ZUUA 3X43A 3ZXXA 2IHBA 4X8OA 3K0FA 3VR4A 2B0JA 3EXIA 3G1WA 4HJXA 1XJWA 4K6GA 1WA5A 4YECA 5FUXA 3WICA 1TKRA 1U8UA 1EQUA 2BTQA 4H18A 4TKUA 4YJHA 1JVNA 2H7YA 2PWZA 2JFPA 3E9QA 4JEUA 4Q37A 5GONF 3W7AA 4C7BA 5CLGA 2IODA 2VHJA 4F4UA 3R1IA 4ZYZA 2HLDD 4EY3A 3C97A 1DXHA 3DLTA 1ZIOA 4I19A 3U44A 1YQXA 2HU7A 2XCUA 1XQXA 3JPYA 5AR1A 1E2NA 2AR0A 3S3TA 3L6EA 1HPLA 5KWVA 1WBJB 2NO7A 3SBXA 2RJNA 4PONA 1K89A 5G0SA 1RI1A 2H3EA 1OVGA 1ZFNA 4MR8A 3HHEA 2H1OA 4HLNA 2Z6UA 1G4UR 5EQTA 3HACA 3KZCA 4MUNA 3ISTA 3EH2A 4LZZA 3P9CA 2VAPA 5EZYF 3N70A 2VDVE 3MIZA 5E38A 2VDUE 1B8OA 2WVJA 1SH7A 4NBTA 4RFLA 1YFJA 1N2HA 2F7SA 1A96A 3AILA 2AFHB 4JC0A 1RBQA 1VIVA 3MT0A 3TLMA 3ZU2A 1YRQA 1J99A 2JZCA 2HUNA 3BGSA 2DY1A 2HCJB 4LXYA 4K6MA 1Q77A 1YMVA 3LSTA 4MNTA 1KOJA 3SBEA 3MJDA 1I7PA 3QBTA 3E3MA 1L7NA 1R5NA 2WJAA 4TT3A 2ADFA 1U8EA 3TTWA 1GVNB 2NO9A 1HYQA 2XYQA 4MVJA 4XD2A 3SICE 1OBOA 4G9EA 5BNFA 1M33A 2AGVA 5TJHA 3WAJA 3FOAA 3KO8A 3G5UA 1Q7RA 2IXTA 3BE6A 1OYWA 4GI1A 1UIRA 4RD2A 3WIVA 1GEEA 4Q9KA 2QD1A 3MTEA 4DB2A 4JBWA 1MD9A 1VMDA 3AESA 2XY4A 4CG0A 1WCXA 2G4VA 2E87A 3E9MA 2UV8A 2FWPA 1EFVA 1TL7C 3UWKA 3H4IA 2ZIUB 1JYEA 3CUVA 3OIWA 4JVOA 3BZUA 1Q7GA 2WOJA 1UJ5A 1Z0JA 3PUYA 1VLQA 2P5YA 3AVPA 3F97A 3PQDA 1KTVA 2B99A 4EKNB 4D41A 4QUBA 4FX2A 3NVKI 2WZDA 2E5WA 5G1NA 3WMXA 1UANA 1FP4B 2F4NA 3RD5A 3PF8A 1JHOA 3WL3A 2XQIA 4DTIA 3VKGA 1EG2A 2O06A 2WZBA 1QBGA 2PH5A 3IQZA 4NZYA 5GOTA 4JYZA 1DWPA 3R75A 3DVLA 3DMDA 3FPJA 4KQ9A 2GT1A 3W7VA 1A7UA 1JXQA 2H8GA 5DM60 2IA5A 4WKPA 1W4ZA 2NSDA 5KTSA 2LCIA 3N8NA 2CUZA 3BWEA 1PWZA 1ZOLA 2ZRMA 4G56A 1HYBA 1GFWA 2PGDA 3ZZ1A 5HOQA 1HE2A 1RWBA 4EHBA 1PJTA 4TLEA 3GLQA 4MQEA 1BGWA 1K66A 4EKIA 4H1WA 1SVKA 3ZY6A 3OF5A 1NMQA 1TF5A 3M6IA 4I1UA 4IDNA 4J0HA 3C5CA 3LL7A 2GAJA 2HF7A 4IR7A 4B73A 2A1UB 2F17A 1WZ2A 1AB6A 3CJQA 4M0FA 1IY9A 2ZJYA 1S6YA 3BJEA 4GR5A 1SD5A 1XTKA 3WTBA 4D9JA 2G28A 2XA1A 2ZTSA 1F9EA 4AQDA 1WW3A 4WBNF 2VXCA 3JX9A 4EYEA 4FT4A 3LQYA 1RBMA 1UMCA 2EARA 5CXXA 1P5ZB 4WJZA 2HWKA 1DC4A 5AK4A 3HI6A 1C1YA 2NNLD 1T25A 2H4WA 2YRXA 2HAEA 3RC1A 5JNTA 3T1OA 2G77B 3QEJA 1MRSA 3ABSB 3CU5A 1D03A 2RIRA 4JKIA 5E7JA 3F3KA 3HPQA 3UBMA 4DCUA 3F3SA 2PUFA 1DKMA 3DP9A 4DNOA 1A77A 3S2ZA 2J3DA 3RS4A 3WO1A 2GBIA 1SA0A 3TTVA 2ETVA 4OGKA 1BVUA 3TLZA 5ALMA 2Q4EA 3CTMA 1TW3A 2X19A 1NJ6A 2QD3A 2OQIA 1HYHA 2DM6A 1A2BA 1R66A 2PUTA 2WIFA 1EAYA 2Q29A 3LNTA 3BF7A 2QTCA 3CX3A 4EB6A 1QH9A 1X42A 2NQ8A 5CLHA 5HF6A 5C35A 4HB0A 3GRPA 3VO2A 5CT8A 1G5QA 3PFNA 2ZRNA 2CBZA 4U02A 5MGNA 2YQ5A 2P6RA 2D5LA 2IHZA 3I37X 3QYAA 4C4AA 1NV8A 1TA0A 4A5OA 5AIAA 3I9V1 5KTYA 3A9WA 5E3JA 4CMEC 2BFBA 2EBUA 4Z4QA 4CM4A 3ETLA 3GELA 1ULHA 1WIWA 5EIOA 3ICQB 1B42A 1NJ8A