1Y1SA

Crystal structure of the uridine phosphorylase from salmonella typhimurium in complex with uracil and sulfate ion at 2.55a resolution
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
250
structure length
250
Chain Sequence
SDVFHLGLTKNDLQGAQLAIVPGDPERVEKIAALMDKPVKLASHREFTSWRAELDGKAVIVCSTGIGGPSTSIAVEELAQLGIRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASLHFAPMEFPAVADFACTTALVEAAKSIGATTHVGVTASSDTFYPGQERYDTYSGRVVRRFKGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQQEIPNAETMKQTESHAVKIVVEAARRLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structures of Salmonella Typhimurium Uridine Phosphorylase in Native and Three Complexes Forms - with Uridine, Uracil and Sulfate.
rcsb
source organism Salmonella typhimurium lt2
molecule tags Transferase
molecule keywords Uridine phosphorylase
total genus 81
structure length 250
sequence length 250
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2004-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1y1sA00
1SD1A 1T8YA 4X24A 4KN5A 4D8VA 1V45E 4DA8A 3OOHA 1Z33A 3PNPA 1Z34A 1RXSA 4QASA 4YO8A 1RSZA 4DA6A 1JP7A 4R31A 2PGAA 4MCIA 4OGLA 3DP9A 4YMLA 1FXUA 5CXQA 3BL6A 4LNHA 1PR2A 1RXUA 1Z5NA 1TGYA 4TS9A 3UT6A 3TL6A 1T8SA 4OGKA 4M1EA 3KU4A 3EUFA 4LZWA 1YR3A 5B7NA 3E9ZA 1V41E 1U1GA 1TD1A 4MARA 2GUWA 4F2WA 1K9SA 4U2KA 5B7GA 4TXNA 1WTAA 4L0MA 1XE3A 4D8YA 4L5AA 3E9RA 1YQUA 3UAXA 1PK9A 2Q7OE 3C74A 2RJ3A 4F3KA 4QEZA 1NC1A 4TXLA 4L5CA 3PHBE 4G8JA 3BSFA 1A9SA 1U1DA 1PR0A 1Z5PA 2AC7A 4LDNA 3FWPA 1ULBA 4G89A 2A0WA 1Y6RA 3OF3A 1SQ6A 3T94A 1LX7A 2OC9A 3SCZA 1JDVA 3DJFA 4WKBA 4NS1A 1JDSA 1SJ9A 3DPSA 3KHSA 1JYSA 3ODGA 3KVRA 1PWYE 4PR3A 1TCVA 2IQ5A 4DAEA 1RXYA 5F73A 1SD2A 1OV6A 2B94A 3O4VA 4D98A 5K1ZA 4WKCA 1RR6A 1T8RA 3OZEA 1C3XA 4GLJA 4R2XA 3K8OE 1PR1A 1OVGA 1CG6A 1ULAA 3ONVA 5CCDA 3ENZA 5B7QA 1VHWA 1K27A 4E1VA 1Y1RA 5F7XA 5EPUA 4BMXA 4DAOA 1A9OA 1ODKA 4L5YA 5CXSA 1CB0A 3KVVA 4FFSA 3FB1A 1RYZA 3OOEA 2AI1A 4NSNA 3KVYA 3FUCA 3OZBA 3OCCA 1Q1GA 3GGSA 2A0YA 3KUKA 4DANA 1VFNA 3MB8A 1G2OA 3FNQA 1T8WA 4YNBA 1TGVA 1RT9A 1Z35A 3OPVA 4M7WA 1ECPA 5F7JA 2QPLA 4OF4A 2HRDA 5F78A 2A8YA 2HN9A 4M3NA 5KB3A 4H1TA 3U40A 5F77A 2OECA 2H8GA 1Y6QA 1PF7E 1A9RA 3PNSA 4QFBA 1T0UA 1Z5OA 4QAQA 2QTTA 4DARA 1TCUA 1V48A 1JE1A 1LVUA 5C80A 5B7PA 1JDZA 1A9TA 1N3IA 4D9HA 1Z39A 4JWTA 3UAZA 1PR6A 2OXFA 1LV8A 3NM5A 5F7ZA 1PR5A 1PKEA 3O6VA 1V3QE 1B8OA 4TXMA 5I3CA 1OTXA 3P0EA 4TYMA 4ECEA 3FAZA 3FOWA 1A9PA 5JPCA 4JP5A 1Y1SA 4JOSA 3INYA 1QE5A 1ZOSA 1A9QA 1ODLA 4TTJA 4F3CA 5CYFA 3BGSA 3E0QA 4F1WA 1PW7A 4TXHA 1JDUA 5F76A 2I8AA 5IU6A 4LKRA 4NY1A 4RJ2A 4PNPA 3EEIA 1PR4A 4IP0A 4EARA 4R2WA 4DABA 2I4TA 1ZL2A 2HWUA 1Y1QA 1OU4A 3NBQA 1YQQA 3NM4A 1U1EA 4WKNA 3OZCA 3GB9A 4G41A 4DA7A 4WKPA 3IOMA 1ODJA 1VMKA 4DA0A 2QTGA 1JE0A 2BSXA 4WKOA 5F7OA 2AI3A 1RXCA 4MCHA 3F8WA 4P54A 1NW4A 1VHJA 2A0XA 1Z36A 3EMVA 3OZDA 5ETJA 4EB8A 4K6OA 3MMSA 1RFGE 3LGSA 3PHCA 1Y1TA 3DF9A 1V4NA 3DDOA 2P4SA 5EUBA 1PK7A 4TXJA 4OY3A 2QDKA 4BN0A 1JPVA 3NM6B 1JDTA 5FAKA 1Z37A 2QSUA 1YRYE 2HSWA 3K8QA 4BMYA 1M73E 1K3FA 1YBFA 5EFOA 4QARA 3UAVA 2ON6A 1OUMA 4TS3A 3BJEA 4YJKA 1V2HE 3LA8A 2OC4A 1RCTE 1B8NA 3D1VA 4D8XA 3QPBA 1A69A 3EUEA 1OTYA 4I2VA 5IFKA 4OJTA 3UAWA 5CYGA 1NC3A 3LBAA 4GMHA 4LNAA 1Z38A 4L6IA 3UAYA 4GKAA 1I80A 4TTIA 4BMZA 4TTAA 4F2PA 1U1CA 2AI2A 4GLFA 4OEHA 5CCEA 2XRFA 5DK6A 4UC0A 3IEXA 2ISCA 1U1FA 1PBNA 1ODIA 4QATA 3P0FA
chains in the Genus database with same CATH superfamily
2FEMA 1NPDA 3UKJA 2D13A 2RG1A 3EFEA 4AO8A 1U0HC 4UPEA 4YRJA 5EWLA 1FXWA 1KOFA 2H3EA 1J0BA 4CCAA 1J09A 1NBIA 3FPBA 1Z2PX 4L8FA 1O87A 1Z2OX 3PPIA 1KZ1A 1A8SA 5GMOA 5JQGB 4IFTA 1GYPA 1KDOA 3WRXC 5LP6F 3TZEA 4ER7A 4KREA 1KQOA 4GMFA 3CSUA 3FYTA 1NXOA 2GD1O 2RC5A 2QRMA 3BRWA 3M5WA 4HJXA 3ZOKA 4W5JA 4A0FA 4CMHA 4HUTA 1IYZA 1QIEA 2OCGA 1IHDA 1PDVA 3DDCA 3GDGA 1BGVA 1HFEL 5CCXA 1SPBS 4PYIA 5I47A 3FMPB 1JR6A 1M83A 3PYXA 4J0IA 1G5PA 4I9FA 1Q83A 4UNIA 2YNMD 5DV9A 3L1UA 3OO1A 3CGGA 1QMGA 3FG9A 1FS5A 1MRZA 1QZXA 3M82A 3PZRA 4H9GA 4EFLA 2WD7B 1Z5NA 2QUAA 1FP6A 1Y7LA 3JPWA 4XIIA 5CIYA 1CB7A 2Y0PA 4HGYA 4CF5A 2ZRNA 5H8WA 1OFHA 5HTOA 3UT6A 1AKRA 1NWHA 3IP6A 2ZAIA 3L7AA 5JAMA 4EMSA 3ZWPA 5AKHA 4A8PA 4BXOA 3A6LA 3BSSA 4GIBA 1ORHA 4RD6A 4YEDA 3R5HA 1SCNE 1E1YA 2W6NA 1GVHA 4V03A 4F97A 2P2NA 3O2NA 1L5NA 3K0AB 1ZSVA 4AYWA 2GHTA 3QYFA 2JH9A 3AKDA 5SZHB 3I37X 4CDMA 1SUBA 3HUFA 3ROFA 3T4PA 4ISCA 2BEKA 4QJ4A 1E3TA 3R3UA 2M32A 2QTMA 3EXG2 4GO1A 3KKOA 4ZJUA 1H4QA 3PJGA 2Y77A 1V5IA 4Y9TA 3I72A 2A33A 1SUEA 2QQ5A 1J42A 1GUFA 1XGKA 3NIFB 4IDAA 3KFVA 1QS0B 2HY7A 3E1GA 4JLKA 3SJAA 4MARA 5JH7F 2WSYB 3RV3A 3ELUA 1HLGA 2PANA 1MO2A 3W6UA 1DCTA 2FWAA 3BE4A 2GNAA 2NZXA 4NFSA 4RFSA 3C97A 2YJ4A 4DMKA 4FJ2A 1XQXA 2YY5A 1SB9A 3IT3A 1IQPA 1RAAA 2CWDA 4ZZ2A 4AI6A 2Z04A 1MC4A 1B8VA 2J08A 4TV9B 4DR6B 2R8YA 2FPIA 3RS4A 1HURA 2Y1XA 4ZQIA 1EUYA 4J0HA 4OQEA 3MWDA 1L1QA 3AFNA 4PNHA 4BECA 5A6SB 4EGFA 4A1OA 2JRLA 3QV2A 3RROA 3WRWA 1V4VA 3ZVRA 4F3KA 1T9GR 3EGCA 3BD9A 3VPAA 1O95D 2PLWA 4HWRA 2ZKLA 1Y8CA 2VPTA 2UDPA 3AR9A 2JZOA 2GLTA 4M87A 1ZO8A 2ZBQA 3LVFO 3F5FA 3KKPA 2C1EA 3KEFA 3G5TA 4IEFB 4JUAA 4LY0A 5FWNA 2BFBA 3C8UA 4QC2A 4D9GA 3PKJA 2WPNA 2AQIA 4YXFA 1XXHB 2RD2A 2QJRA 3W0LB 4JBWA 2O19A 5DN6A 3N28A 1ZNZA 2QV0A 2VQSA 4LE0A 2C2HA 3OM8A 4XFJA 1P1JA 1Y9DA 1GRNA 4RNDB 5B3JA 3ZBUA 4JBNA 3CZQA 3LC7O 3CSSA 1IAQA 3DEZA 4DQ0A 1XTQA 1N5IA 3EXEA 1ISJA 3Q98A 2Q6VA 2FN9A 5KHAA 1GUBA 1Q0UA 2VJNA 2OSBA 4IDHA 1PFVA 2J3MA 1SQ5A 4HV4A 3NMUF 5JR3A 1PJCA 1YA4A 3ADPA 3MRTA 4OGWA 1KNQA 2HADA 2WAOA 4C5CA 5EJ2A 3MJFA 4NK5A 1L5MA 2HCFA 1OC2A 1JDSA 4G1UC 4NBVA 5AHKA 1V37A 3HDHA 4DBZA 1ACMA 6CHYA 2BKLA 3KSAC 1NBWB 1OOEA 1TVEA 2AG5A 1THTA 2CL0X 3D6JA 3QI2A 4K3UA 1YKSA 3W34A 1QFSA 1WUJS 2X2FA 3B6ZA 3FIJA 2WKSA 2I3BA 2PEZA 1RXYA 3BWEA 2FW6A 1U7UA 1KDPA 2G9VA 3TQHA 2EWMA 1IWBB 4WKCA 4QNRA 4QYSA 2A9PA 2WY2D 3WGOA 2AYZA 1XKLA 2WV9A 2HMUA 2ORYA 1W76A 3WZLA 4C6HA 4H60A 5I5GA 1NVVQ 4J0QA 3K5WA 4BB9A 3U3OA 1D0VA 4JLUA 2OQ2A 3DLHA 1ULAA 4TMTA 1QQTA 4JJ7A 1RZ3A 1RQ7A 2BFPA 4JEMA 1I7LA 1JPUA 4OD0A 3ONVA 3AHHA 1G8FA 2RGBA 3CF6R 2DCUA 1ZCAA 2O0JA 3HFJA 3KQWA 1BX0A 1CTQA 4M8LA 4ZTBA 3RSQA 3B3AA 5B3KA 4N41A 2FEKA 4MCAA 4EH1A 5JIBA 3IRVA 4RFSB 4LY9A 5EHQA 3URMA 3JZAA 4WZBA 2XVXA 3WLMA 3AY6A 2DF8A 4TVKA 3SZOA 4KXQA 3DA8A 3LQFA 4H6WA 2JGMA 3COWA 2WFMA 4MWCA 1IBKB 2XQFA 4TN5A 3U81A 4AP9A 2QZSA 1YV9A 1CB0A 1RAFA 2VTDA 2N3ZA 1FQJA 2XNJA 1WDTA 2GZHA 3D9QX 5GM2A 4J75A 2FEPA 2FH5B 3A1VA 5E4YA 3EDMA 1YR2A 4Z9BA 3IQWA 3U4MA 1M66A 4PFQA 3UJ9A 4O2AF 4RH3A 1ZMOA 4RE6A 2QENA 4CLDA 1GV0A 4TTQA 4XWOA 2R4UA 5LIRA 3UMFA 4EKNB 1BS2A 1NLMA 1SURA 1G7TA 3DL2A 3PQFA 4GEGA 2C2MA 4Z4CA 4AQYB 2IHJA 5F1OA 4OATA 1CQWA 3SYKA 5H4GA 5D6OA 2JAHA 4GXQA 3V48A 4G23A 1BA2A 1Q15A 3IDSA 3PD7A 3H11B 1OBFO 4HDRA 5AUPB 4N8SA 4UHKA 2C3MA 4CIYA 5NULA 4MQFB 2VZ0A 5J4KA 2F1IA 1XA3A 1WF3A 3KUKA 1NVBA 5K45A 5KPDA 2ZOSA 1YRAA 3ELYA 2GYVA 1GZHB 4L50A 3IBSA 3E8XA 1NBMA 2FKAA 3L1HA 1L5FA 5G1OA 1P2FA 1JLSA 3QEBZ 1GUYA 5DM70 3QE3A 1WQ3A 3ZYZA 5J2UA 1PWZA 2O57A 4RZXA 4UDOA 1NLYA 3A4TA 3OUTA 1TGVA 3WKAA 3KPYA 1C0LA 1OLXA 1Y1LA 4EB0A 4IXTA 1E8MA 1K6MA 3RUIA 2IYAA 1J9EA 2O07A 3PJDA 4Y9RA 1JZQA 1P3DA 1HBJA 2XKAA 4GSLA 4KLZA 4XI9A 3AEQA 4M21A 4GC9A 3I4CA 1BW9B 4G4GA 2CGEA 5EEHA 2O2XA 4JP8A 1O7JA 2HN9A 1UM9A 4PZDA 1XTPA 1QCYA 2XTAA 1M8JA 1U1IA 2QTWB 3EDCA 5L4SA 1JG1A 1AQ6A 3U40A 4J03A 1XKQA 3OOYA 4NWIA 2Y68A 2VQEB 1DAEA 3FDXA 3WLHA 3NVKI 2VEOA 3TD9A 1Z45A 1VOTA 3NUZA 1TEXA 5T67A 3CCCA 3RABA 3YASA 4MPPA 5EKUA 4K2HA 3UJAA 1GQQA 3TNDA 1XVTA 4PC7A 3U49A 4JC8A 5IT9A 3I9MA 4UHFA 2GXAA 2CHQA 2ROQA 4L07A 3RS2A 1EFCA 2RE8A 1DKRA 2WTAA 4KK3A 4W5HA 3PE6A 5T5QA 3ZD7A 1Z7EA 2P40A 1XMPA 5DSTA 1ZL0A 2QTTA 3DWIA 2TMDA 3U1BA 3EG9B 1VP3A 3QJGA 1SVUA 5KOHA 2BTOA 4XGIA 2HV9A 3Q40A 5HGJA 3FCOA 4IDNA 4IBOA 1JKIA 4S05A 3OU6A 5DTJA 4IYRA 4KQFA 3OD1A 1SCKA 1FVXA 3BFXA 3MWKA 4J49A 4WFJA 2NU7B 3LLVA 3NVDA 1G3RA 2EZUA 1NE7A 2BFDB 3HBMA 5AK5A 4Q7QA 2R84A 5ADHA 2YWCA 1RBZA 4EQ6B 4PZZA 1OX6A 2AR7A 3ON5A 3A4VA 4XTCS 4YRNA 5JYDA 3EIQA 3AY0A 4FYIA 3T7TA 4YJ2A 3FUVA 3WKDA 1TQ4A 1LV8A 2CV2A 1QH8A 1SELA 2QPAA 3BN3A 1VA5A 2Q0XA 4LHVA 3TD2A 3ZV7A 2WV7A 1BEZA 1Y9JA 2WVAA 4RZUA 1GAJA 2GKOA 2D8AA 2QTRA 1T3SA 3IPLA 5BSTA 5TPZD 3TLGB 3TRDA 2P2YA 1DIGA 3QFTA 1MT0A 3K0KA 2Q4BA 4ND3A 4GE3A 2GCOA 4JKYA 1CC1S 5ICMA 1AQNA 5FTNA 1M33A 1XCJA 1XL1A 4WCFC 4UM8B 1U02A 1A88A 3GAMA 4EO4A 1LSSA 4LXGA 1WLYA 3INYA 3WYDA 1RYFA 5K0EA 3ETDA 3ESZA 1WQ4A 2HDNB 2DY1A 3ET4A 1X0VA 4YASA 1B76A 2FX3A 3RIYA 3VMMA 4C7BA 4F3YA 2B1GA 1XROA 2R2AA 2MYTA 3LYLA 4CMEC 4DDMA 2H6EA 4DXHA 2PO7A 2NU6B 1V9CA 3K5PA 5COBA 1VI2A 5E9JA 1NNUA 3LU1A 1LWOA 3OEED 4PPYA 1I4OA 3H4MA 1OGYA 2PZBA 4Q3LA 4QUJA 5GZ6A 2ORWA 5F76A 2ODBA 1KI8A 2OV2A 3LTEA 1G20B 3LH5A 4HP8A 4AL4A 1WF6A 5E7MA 2IPNA 4QNMA 4F8EA 4CKBA 1K6JA 4JB0A 3FUXA 3H5VA 4CN9A 3O8NA 1IK6A 4B71A 3DR3A 1BE0A 4BNIA 5BSGA 1FSSA 1VI5A 3BIFA 9ABPA 1LRJA 5FLKA 4OLHA 1DIOB 2W2OA 3O31A 4FYYA 1P2SA 1SK8A 2V6BA 3HDYA 3PLAE 1U0BB 4RPIA 3EQ9A 3PC8C 4BJHB 1D2RA 1TQDA 2JIPA 4BLRA 1ZY2A 2LKCA 3AY7A 2A9JA 3FF1A 3FRHA 3LPMA 2NU9B 1L7QA 2J3KA 5JSFA 5EERA 1VLMA 2R7MA 3SKYA 1I2AA 3QEMA 3EISA 5F1YA 4N8DA 2EFGA 2Q5FA 2TECE 2W2LA 1Z6XA 2BP7B 4LV6A 4Q9IA 5D7NA 1FJGB 4WY5A 3PL5A 4BE4A 5CBPB 1K88A 1SKQA 3F5DA 5FWYA 3L7IA 2DEUA 3ZU3A 1O4WA 1G41A 4O02B 4DSAA 2WDZA 3DBIA 1ZHFA 3IOBA 3OZCA 4FFRA 4P53A 2H48A 2C9ZA 3DLPX 4J7AA 4X0EA 3GLIA 1M34A 1TVKA 1AXGA 3TQFA 3GV0A 4E08A 1VBKA 4PR0A 4AJOA 2CW5A 3G02A 4U3JB 5JSUA 1CUIA 4W4TA 1BO6A 3IUPA 3HKEA 2PUBA 3U19A 2RHLA 4WKOA 5CPBA 4WZZA 1SVOA 1RYYA 1ZM9A 5CK4A 5KWVA 4CEHA 5JSKA 1GVNB 1PZXA 1HOXA 4KDFA 4XCVA 1I14A 4KO8A 4FD2A 5AVVA 4IH9A 3MG9A 3GVPA 4WIAA 4D3FA 3P71T 2DXIA 4LF9B 2XOXA 3GEEA 1IZZA 1LFDB 3FR7A 1V6AA 2CFSA 1ZHHA 4ZJPA 1DCFA 1L4EA 1X1BA 1Y5NA 3WFZA 2UU9B 3AHDA 2BPOA 4J76A 1NVKA 5J5CA 4KRGA 4EB8A 1O54A 4PBTA 1SIOA 3G2NA 3MJRA 1IZ7A 1NYTA 2QJFA 4IEEA 1LEHA 4KVZA 2YJNA 1VFPA 1EEXB 2D4HA 3M6WA 5K3AA 2EWWA 1X80B 1U3CA 4JQSA 1DKNA 3EOZA 2HU7A 2AR9A 3ES9A 3IAAA 4Q48A 2VWGA 4UOQA 3PA6A 1G6Q1 3ZUPA 1KF0A 1U9CA 1X42A 4GUAA 3IUSA 3R3XA 1XMSA 3SE0A 4DC1A 4US2R 2QMQA 5AXCA 3UXHA 1MJ5A 1R0CA 1RJDA 1S2IA 2VPWA 3NFRA 3E7PA 3HWWA 1ST2A 2HJVA 2WD9A 3QHQA 1BHSA 4M9ZA 2CFOA 3EF1A 5AJVB 2PMEA 3DE4X 3WIUA 1IOVA 3ZS9A 5IZ4A 1QC5B 1B3BA 1E18A 2UV8A 1Q0SA 1EUDB 3A1WA 2IF0A 3A2LA 4MITA 4XZ3A 5DN6D 1L4FA 5FDFA 1GD1O 3HFSA 5M2QA 1TCCA 5TY0A 1SG6A 1ZH6A 3GEMA 5FJIA 4BJ3A 2ARKA 4BEJA 4BMYA 2ZVPX 3JWGA 4YLGA 4CLRA 4DV5B 3NDBB 4QULA 4V0KA 2VSOA 1E0JA 2IYQA 3NHLA 1ESDA 4EF4A 1KKLA 3KAPA 3ZWKA 1LVGA 3MMNA 4BO1A 2XAAA 2VTEA 4AY4A 4LJLA 3GFBA 1RJWA 5KSPA 3PUHA 2UYQA 1Q44A 4J94A 5DBEX 2R7KA 2BFDA 1IN4A 2PUJA 4HAXA 4R0MA 1A5BB 1KMHB 5C1OA 2ZM6B 1FDWA 3F98A 2F3QA 2E37A 2NQ8A 3C3CA 5HKBA 1H69A 2ENUA 1V8BA 5L3RA 3X2EA 4BVAA 1V0JA 1JB9A 2AJBA 3H7IA 1KWGA 1XWFA 2F59A 4ON9A 2P62A 1AGRA 2VG8A 4YFVA 1H6CA 2XUJA 1U3VA 2G1UA 3E6AA 4HUQA 4K87A 4Y2SA 4DSZA 4OREX 4RFLA 2FPPA 2B3DA 1E2JA 2B1IA 3O2JA 2PYDA 2IXFA 1P2VA 3M4YA 4J2HA 3RRBA 4QT4A 3BT7A 4I3HA 4GKBA 2IS4A 4IAOA 4KLCA 1DKPA 1Y5LA 2OHIA 2FK8A 2W11A 1UADA 2L0XA 4TTAA 4I1SA 4TTVA 2V5AA 3E3MA 3COPA 1P4RA 3BCSA 4JR0A 4Q82A 5E0OA 5FTJA 5IMBA 4DLZA 1E1LA 4PINA 1ZDMA 2G1KA 3BD8A 4DZTA 1PGOA 4MTCA 4POAA 4GNKA 4TWIA 3AUKA 1QZUA 2N75A 3GC6A 4NVRA 5CTAA 5FIUA 2GJAA 5T4FA 3WGQA 2LVBA 3I9FA 3PIIA 4OI1A 1KFEB 4JYPA 1GNRA 1W5SA 2VAVA 1PD1A 4WASA 1AUPA 3AM1A 1SD1A 3LPCA 3MSCA 5B53A 5GOZA 3O1LA 6AT1A 2ZSBA 4HZGA 2A35A 1DOZA 1VDMA 1N7IA 2C92A 2ZS8A 2ASEA 2E4ZA 2GXSA 4N18A 2OORA 1NUPA 3DFKA 4KX5A 1DAGA 1OB2A 2VUUA 3JCZA 1GTSA 2XDAA 3KJXA 2GK4A 2WWVD 1AY0A 3MLEA 4YP7A 2QF7A 3VI4B 2CLFB 3N2EA 3IQFA 1B8PA 1LDBA 2IGBA 3CZRA 3B3QA 3HJAA 3BD7A 2WJYA 3ONDA 4CM9D 3VXKA 5J4VA 3C2QA 2V1UA 3BMQB 1X9IA 2YN0A 3PDCA 3BPSA 4NBWA 3UJDA 3QE2A 1ISGA 2QLNA 1Z13A 2I1LA 1RACA 5FP0A 3V2IA 1UMCA 1AMUA 3U44A 4ZOAA 2EKZA 4RY9A 4FYJA 3IJRA 4G6ZA 2Q0SA 3OWXA 2R6FA 4EFKA 4R41A 1YQTA 1QYWA 3NP9A 3NOOA 3M89A 5A4MS 1EM6A 2ZUTA 4KN8A 1JKXA 1YR9A 2KWIA 2I3AA 3UJ7A 1ZIDA 2IPLA 4JI5B 3BDIA 5IDVA 1T8SA 3ZHCA 1UXKA 2P3LA 2Q1YA 4WBNA 1GPKA 1OD6A 1J7KA 1G6KA 2H08A 2C3YA 5D7BA 5CFOA 1AUVA 3V7WA 1EUCA 5LLTA 4YRSA 1F0KA 1W2WB 3LY9A 2W8ZA 1B0UA 1TKBA 3CBGA 4CIBA 1U4NA 5IBPA 4ZZ3A 3EXIB 2PDAA 4QPZA 4DV3B 1E59A 1Z0FA 2JANA 1OWPA 3CX4A 1DAIA 1AGNA 3LV8A 2GOYA 4AZ0A 5HVNA 1B73A 2ZSJA 4JP3A 5BNFA 4UTPA 3JQRA 1ODCA 2V74B 1F51E 2NNLD 2MHCA 2VP3A 3IODA 4HSGA 1N57A 4TXNA 4CEJA 4CL2A 1W8DA 2NTVA 3O1HB 4FR0A 1L7VC 4IJWA 2Y05A 4D9FA 5CDHA 1K92A 1I1HA 1P9WA 1GADO 1ZD8A 1JKJB 3KPJA 2PR2A 2JLCA 1SIUA 2VAPA 4RMNA 2Y0EA 3AJ9A 1PEDA 1XJCA 1B1AA 2BBWA 1T0BA 4EPRA 4Z4IA 3I9V6 3WNCA 3KOZA 1T0HB 2FSUA 4L9AA 2OBXA 4N0PA 2C83A 1CF2O 3TECE 2GRUA 3QKRB 5LQCA 2QU8A 1L4LA 3CN7A 3QWFA 2HV8A 3BSFA 3COZA 3SY8A 5CLFA 4BMVA 3NOQA 2R0QC 3WOHA 4BVHA 1IUNA 3IAS1 3PWTA 2GZ1A 1NI4B 2H1RA 1TU3A 1X7DA 3K32A 4XJTA 2PKRA 3WSWA 4EW2A 4P4GA 3E81A 1KSJA 1FNDA 4W5TA 1SZPA 5FI0B 5BWMA 4HAWA 4XH9B 4DNXA 3RYCA 5EINA 2WIDA 2JC3A 3B6IA 4MINA 3L79A 3U7FB 2WUFA 4GMXA 7REQA 2ATVA 1FVOA 1M6VB 3CBQA 1U98A 2PKEA 1K8XB 4ME6A 5K0NA 5HMLA 2CNWD 1LX7A 4F92B 1JBEA 1VYUA 4N76A 3NXKA 3IMKA 4D80A 4Z4EA 3K2BA 5KYXB 2OD2A 3O75A 3NZEA 1NRJB 3VZRA 3Q7IA 1Y4UA 1K5PA 1NATA 4ZWNA 3WLOA 2R8EA 4F6RB 1C3JA 5J4LA 2XAUA 5DISB 4GBJA 1L3IA 1PWHA 3OOJA 2DPMA 1MABA 3QPCA 4P5PA 3OQBA 1AS2A 4DQUA 4YWJA 1AK9A 3EVGA 1WXGA 2ENWA 4BTVA 3OECA 4PZCA 3ZW8A 1KDZA 4BFXA 2BOVA 4C6TB 4EDFA 3QPWA 1ZXLA 1WUIS 2ZZNA 3EN0A 2W6CX 2PFGA 4IIBA 5JTUA 1GPMA 1QG6A 1EQAA 1W30A 1VLQA 4LPSA 2HMSA 4TLMB 4B6PA 3JARB 5FFFA 1Z6TA 4Y1FA 5H7XA 5JROA 1P2DA 4GUDA 1Z6GA 1C3XA 2BDEA 2ZTVA 1DBPA 2ZI7A 3NKVA 4IHJB 1ZHOA 1MQ9A 1ADBA 1NAHA 4FMCF 4IZOA 4LRSB 3USZA 2GERA 2QUJA 5HKKA 3WP0A 3TG2A 4WXMA 1UBNA 2Y1DA 2HO4A 2NZUG 5L3SB 5EI5A 3B78A 1TA9A 1T4BA 1EVLA 4YUAA 1I5RA 5FOSA 3S5JA 2CJFA 2DECA 4QQNA 2UZ3A 4GBED 4RDXA 3KB8A 2IS1A 4CHGA 3PLNA 5JZMA 2XYVA 5JS6A 2V6JA 4DCTA 5F7XA 1T9BA 1LNZA 2PZAA 3PIRA 4DXAA 1YR8A 2QE7A 1QANA 4NYJQ 3RS9A 1DUVG 3BK1A 4L5YA 1TJ4A 2NSJA 5JMPA 5CXSA 4LSZA 4YJHA 2UUCB 2CZGA 2OG1A 2IOFA 3BE6A 1JNYA 4KHZA 5AD1A 1UJNA 5KTPA 1YZHA 3AU8A 1CEYA 1U65A 3CZ4A 2OM2A 2H0AA 2VYCA 4CIVA 3WJ2A 2AYYA 3VNBA 5EAIA 1EAYA 2ZYGA 3DAGA 4IJUA 4MKIA 3UK7A 5KKCA 1LPBB 2WYIA 1Z25A 3JZIA 2I4OA 2Q45A 4XPIA 1G6OA 3HABA 4NSNA 2G3YA 5ILGA 4ACBA 1CP2A 1L8XA 1LC0A 2GEDA 1G5RA 2NAFA 2YC2C 2ZRDA 3IQIX 5TS3A 1MD9A 3REQB 3OZBA 3CLUC 2WU0A 2XRYA 3KU1A 3NHBA 1MW8X 3K4HA 3ZLUA 1N5DA 3LPLA 3LUJA 3KO8A 3TOVA 1A1SA 5FI5A 2EV9A 1N8SA 3Q6IA 1KYVA 2LTAA 4EUHA 5KOHB 1MB9A 4A7PA 3QITA 2DFNA 3VAZA 1ZIOA 4JZYA 4KV7A 3IVRA 3AVUA 3ZD8A 3FUWA 1R64A 5FUVA 5KNBA 4LJSA 1EXVA 3HUUA 4L28A 2NX2A 5IC6A 1VHDA 1U7PA 2RIRA 3ZY5A 3GLFE 4GHWA 5JYBA 1JU9A 3H1TA 3I64A 5FO1A 5J2UB 1T9DA 4ZDJA 4KBFA 4JBHA 2PU5A 2Y0DA 2FQWA 1OCEA 1EFPA 3FNQA 4JDUA 5IC5A 5FTLA 1YVUA 3D3NA 1RT9A 3I6QA 1WXFA 1CJSA 1HSOA 4AJIA 2I6QA 5LP6A 2BFEB 1G3QA 2AKYA 4ZKDA 3B1VA 3EPLA 3EY4A 1E2IA 3O03A 3NI2A 1TKRA 5ALOA 1NVVR 3S8YA 2UXDB 5TJ9A 2F8SA 5EIHA 4DT1B 4WJLA 4BRZA 3CXUA 3N39C 2GNPA 4CEIB 3A3KA 5AQEA 3GGCA 3DPUA 1EFDN 4NAVA 4PYRA 5DP2A 4FI3C 4AUKA 4RKQA 5J2TB 2ZRQA 2PNJA 3T3MB 1LSUA 2HQBA 3HKBA 4O59O 4TKUA 4ZIRA 3KQUA 2H07A 2CXNA 4OX9Y 2ZE7A 4MEAA 1XAGA 4BC1A 1JJFA 2VLBA 3DF7A 3EIOA 4MDFA 1AA6A 5FBRB 2WHYA 2JIDA 2AN4A 4J2OA 3G8CA 4JN6B 3MB5A 4S35A 2OVFA 2N47A 2W2VA 5TEWA 1E2NA 2ZANA 4RW0A 1P62B 1NF2A 4FOPA 4UDYX 2ZREA 2DBZA 2PS1A 3CZ9A 3UFXA 4FU0A 3QKIA 2XCIA 1T4CB 3ESQA 2GPTA 4OGGA 4MVJH 4UVEA 3VFDA 3WHLA 4DXDA 4TRNA 3W2IA 4LMRA 4HWSA 2D06A 3AF5A 3HA2A 3KR9A 4MGHA 3VR2A 4ASUD 4L02A 5IP5A 4CUJA 4FB4A 5B7PA 3REOA 2XZTA 1SC6A 1ADJA 4IIXA 5JH7A 1GGKA 5KOYA 1QUFA 2HUPA 4DF3A 4LDQA 2YUIA 2DFVA 3EH1A 3F5MA 3UWKA 5G02A 2NUPA 4OQFA 3CEMA 4C89A 2ECFA 4WX2B 1ECFA 5B4TA 1OXBB 4OYLA 2XXAB 1R10A 2C95A 3IBGA 2XMPA 3RWOA 5B1YA 4GDFA 4J4TA 4HPJB 3FSRA 2J5KA 3DVLA 3BJZA 3UJBA 3ECSA 5ALMA 2DJ5A 1OREA 1SPXA 4KFSA 3U7EB 1PYDA 1UDCA 3OLYA 2AOTB 1XN4A 2PAFA 3D3QA 1U3GA 2HNAA 4OCZA 2QTHA 4MR8B 1SBZA 4LC1A 4PC6A 1E69A 5GV7A 3W90A 4C88A 1FFBA 2P7HA 1IRXA 4DG8A 2LCQA 1E89A 4AVYA 3VGJA 1I9CA 4TTJA 5F98A 3J7AC 1XJQA 2DPLA 1IBSA 1VJTA 5EEGA 4NYIQ 1E2QA 1TPZA 2GCEA 2GYWA 4QU8A 1Y6FA 2JKZA 3HFGA 3ZJ5A 4BKUA 4ITUA 3PWKA 1LPPA 3BK7A 2VKTA 2XMZA 5EJAA 1PS0A 4CKWB 5BR4A 2Q5CA 2YWDA 5J63A 3MMPA 4TMYA 2XCLA 2E49A 1E92A 2ZJFA 3F1LA 3LC1O 4HBGA 1Z6PA 4JQYA 2I3GA 4H1UA 4NZMA 1SH7A 2Z6QA 3V4FA 3H99A 1YDWA 2ZDHA 5H02A 3FJYA 2I6XA 3PSHA 4Z9YA 5IW8A 4PIMA 4MLCA 5ALVA 4UDNA 4P84A 3R3HA 4BCCA 1XRRA 5JFOA 1ZQ9A 4EKEA 3DAFA 1OBHA 2PKQO 2HWUA 5TNXA 2D7DA 4ZAWA 4P6VF 3D7LA 1GLGA 1JSRA 1W96A 6NULA 3UAGA 4DRYA 4UBNA 3U80A 4CV1A 4LF5B 1UANA 1O2DA 1EFLA 4P36A 3T99A 2DHQA 1U99A 1V16B 2DWQA 4HGNA 3BL8A 1TM2A 2P7IA 3DGEC 3QVSA 4GM1A 3QX8A 4L3VA 4RPGA 5JBNA 1T4DA 4BKMA 4ENWA 3OZIA 3CRMA 3MGKA 2JA2A 4M7OA 4XYEA 3N3BC 4KW7A 1LJ8A 5J2TA 3MD9A 4J1NA 3PNMA 2VTKA 4NEHB 3G0OA 4EPYA 1ZVVA 3H9EO 1ZJ4A 2FPRA 3A3PA 4PFKA 4WKPA 3IQGX 4MGEA 4G65A 4QBHA 2FGKA 4RIFA 3J81A 2INGX 4P7JA 2Z1MA 4RJKA 2R44A 4FMPA 4IX1A 1E7RA 1FTNA 2VS1A 3DT9A 3DTVA 3M6MD 4F5WA 3O92A 1P4AA 3JTEA 4OH7A 5HDQA 1XLTC 4BGIA 4S2UA 3VYVA 2OV6A 3RK1A 2NPIA 5GIPE 3L43A 3NV7A 1J0XO 5I48A 3IBYA 2LZ0A 5DHFA 4BXOB 1IB0A 2E4WA 2EGHA 3B3FA 2BVNA 2PKWA 5TLSA 2OXCA 3NT2A 4MUAA 1GNQA 1ZVMA 4XQCA 5DYNA 4DQKA 4RHCA 3TRJA 4M0MA 1DFIA 1KK1A 3E27A 4UBIA 3VBEA 4II7A 3ZQUA 4UOEA 1U3DA 2JI8A 5KJ6A 1HT0A 1YL7A 2A1TR 1R37A 2SKEA 3GDFA 3JR7A 3LGSA 3LPNA 1N32B 1Z75A 3GMSA 1LPOA 4KB5A 3CS3A 3FD8A 3B13B 1YFZA 3DDOA 3ED5A 4ZN6A 3T5TA 1WPXA 2F90A 2XB8A 2P4SA 3TLAA 2GN0A 2Z9DA 4TUYB 1OLUB 1JIKA 3A4NA 3OJWA 3I3SR 1NBMD 3NW9A 1FP4B 4GPD1 3T4EA 1OGJA 3VVLA 1WHTB 1ZH0A 5JECA 2IC5A 4OUDB 2X5OA 2C5SA 4DIMA 1GPLA 1EQ2A 1JJVA 4PCVA 1SKAA 3RSZA 4KGDA 2KSQA 1KJQA 4E4TA 1JBKA 3E7DA 2QDKA 4YJFB 2VF7A 3GLUA 3M4ZA 2A1TS 2FE1A 2Z09A 1RZUA 1K2WA 2FPWA 2WHPB 5BWBA 4QQ8A 5FAKA 2FI1A 1O97C 5FV7A 1KI9A 1YRYE 3GMTA 5EZQA 2E7ZA 5FBLB 3RKSA 4W5QA 5C8ZA 3LCUA 4L22A 2G70A 3MTQA 2HPVA 4B44A 1O95C 4WPGA 2X0EA 3VDRA 2D0IA 1RCFA 2JKYA 3BCUA 1PFUA 1JAZA 2PLAA 3DE1X 3P4YA 4NOKA 3RJMA 3K1TA 1TTQB 1XZFA 1HTWA 3NTQA 3JAKB 3O8OB 4I55A 4JVNA 4PZAA 1DAFA 3C7KA 3HYRA 3NYIA 3EIFA 1HE2A 2PT5A 5D87A 5FPYA 4ZICA 3ABOB 5IANA 1FFGA 4QSHA 3BE5A 3H3FA 3LFTA 1JJ7A 4ND8B 4OJYA 2PRJA 3AC0A 1WY7A 4BNJA 1PJQA 3DMNA 1P91A 1WKVA 4YA6A 3JX9A 1OTYA 2OM6A 3ML1A 2GEJA 4WEQA 1M2WA 1TA0A 5JW6A 2KI5A 3P32A 3S40A 1JIVA 3WX0A 1NC3A 1Z7WA 1PP4A 1ZIXA 2C0CA 4DUGD 4B6FA 2GTPA 4C9BA 5HRUA 4HGPA 4Z3KA 2H16A 1TZBA 1KQFA 4RESA 1LBHA 2A58A 2EJUA 4PQYA 2EX0A 1JHDA 3LK7A 3JVUA 4J29A 4F2PA 2WA1A 1CU1A 1GPDG 3L0PA 1H2FA 1WCIB 3BWCA 1Q50A 2QLBA 3N2GA 1AGYA 4OXIA 5DZSA 5I01A 1AF7A 4TKLA 3B9BA 2EERA 1T8PA 3KQMA 3Q0EA 1Q19A 5DLQC 5IF3A 1LB1B 2F9FA 3PA8A 3PENA 4ANFA 2RHJA 1QCZA 1QK5A 2YR0A 3B48A 3MSXA 3B1YA 4Q4HA 4UXIA 4YQZA 3EA0A 5CT6A 5CX4A 4BVKA 2J0VA 5EXPA 5CVJA 1XMVA 1MBZA 1YS7A 1W88B 2VNJA 4PYJA 4RVGA 3JW8A 3PHLA 1NBAA 5JFTA 1GSOA 1FUYB 2A5GA 2JPDA 4UMDA 3T7JA 2OLJA 1RVV1 2ONKA 4NU8X 4JKOA 1Q2UA 3B1XA 2FY8A 3CG0A 3DDSA 3EVDA 4JJFA 1BGXT 2QUKA 2RGCA 3FOFC 2G40A 4ZCIA 3F4BA 1E79D 4M0CA 2QSJA 4ALKA 3WLFA 3AG5A 3KYBA 4HDNB 4BNFA 5A5DA 2RHHA 2EZ4A 4OQXA 2F3RA 4OGLA 3NORA 1QP8A 2AMJA 5JDCC 1FRQA 2IODA 3QKUA 3K2IA 1LPAB 4NCHA 4O4IA 3DLBA 1PQUA 1I2CA 1ZA1A 1P6UA 2OZPA 3HP1A 1TL7C 1Z7YA 3A9WA 3VDQA 2EF0A 5DIFA 4I50B 3IEKA 3OFKA 5AJXA 4JEHA 1F9EA 3LQKA 3P5BA 4QL3A 1R0ZA 2FSVA 4R8VA 3JQBA 3CLTD 1G19A 3MYYA 4Z54A 4TWBA 1XG5A 3CONA 4WNAA 5CD1A 1GL9B 1TF7A 4IYJA 4JSRA 3LYUA 4OXKA 1SOUA 3AZQA 3WFIA 5E3HA 2VQ3A 4PN3A 2EYUA 3CUSA 3U17A 3ROKA 5CDTA 5L51A 4ZGWA 2G80A 3QKTA 4N5MA 3FOEC 4AYXA 2G5TA 1KEVA 4NATA 2ZG6A 3T6KA 4EYEA 1E2HA 2DZDA 4F91B 1U94A 3EF0A 2CF5A 4PAWA 1XVUA 5HPYB 1LA2A 4TSFD 2QN6A 2R751 1RC8A 1T1SA 3RREA 1SZCA 2GSWA 4G5SA 1NLFA 4PYLA 3M83A 2Q8PA 4E2ZA 1GAQA 1YZLA 1KQ3A 3TAXA 2OUIA 2FZEA 2VDQB 1NW5A 1H3EA 1Z4MA 3LIPA 3IKTA 4XB1A 4CI0B 5EIBD 1H94A 1D8AA 2YWRA 2YZGA 2HTFA 2D1SA 2PX4A 2VAXA 5E2AA 4DSUA 1C41A 1A2OA 4OSOA 4JU8A 5DYYA 2O8BA 2PRIA 4L0MA 5F3WB 2WSBA 5IHPA 4GI3A 1M0TA 5AXAA 3DBRB 3E9RA 2VH5R 3WLIA 3R5KA 4KIJA 3WL3A 1IU9A 4NULA 3UKOA 2Q5EA 3DLCA 3JV7A 2GMWA 5LM3A 1JSCA 5LSAA 4D3DA 1QO9A 2I7VA 2VAMA 2PWYA 2WU1A 4QUGA 4TXLA 2E6KA 2Q28A 3KZXA 3ANMA 2OQVA 4O63O 4X60A 4I1UA 2BTEA 4G8JA 3AVPA 3M4NA 5CITA 1IXZA 3KOWA 4YK7A 4H31A 2V7BA 3JYLA 3E0XA 3QXHA 3H75A 4LI3X 3QWHA 1SQSA 3ROQA 4HDSB 3N86A 1GP2A 4KDCA 2YDXA 4KRYA 2Y1CA 4TL7A 3DOHA 4OXXA 5LYJA 4LTDA 4C0AC 2HUNA 3BIWA 1X3SA 4O4LA 4ESVA 2F00A 3B7PA 2A0WA 3MOGA 4GYWA 3ELDA 5IJ0A 2CXQA 1Q5PA 5AJWA 1EFRA 2ZTHA 3WGMA 1NQAO 4A36A 2EFYA 1WZNA 4L9SA 4OAQA 1ZWKA 1B2RA 3X1YA 3TTVA 1IOLA 4YHBA 5BNTA 5CJ2A 4DMHA 1CX9B 1N2CA 4WJKB 3W5SA 2C4WA 5D85A 4WN9A 4YJFA 5L7WA 2BGRA 3R3ZA 3TDNA 4G5QA 4R16A 2OESA 1II0A 1ZLYA 3B3GA 4PHGA 1XLTA 4JYMA 1SC9A 3DPSA 3DPIA 3ODGA 1CS0B 5IAKA 5TR9A 4IOLA 2F3TA 4JJZA 4Q34A 1PWYE 2FPGA 4R4JA 4TWRA 4OO3A 4B3GA 3ZG6A 1TCVA 1I24A 2HJGA 3K0FA 5BN4A 5KQSA 3RAFC 1AKMA 3WWZA 3AI3A 4H6VA 3Q5DA 1RRFA 3V1TC 1SUPA 4XUDA 3ZWBA 1PL0A 4H4EA 3RKUA 2RCNA 4TLLB 1JLHA 4RJTA 2QSYA 1PR1A 4GWKA 2X7XA 4C29A 1XV5A 1OVGA 4E5DA 1P0MA 2QRUA 3F97A 1OF1A 2RAVA 1MAWA 1YUNA 1NONA 4ROTA 3D7NA 3ZZ0A 5BUZA 1M6HA 4RPHA 1XZEA 2O2ZA 3W1EA 3GN2A 3V1KA 5DNVA 1JDNA 2R8XA 3ZU5A 1QM5A 3IP3A 4Y6RA 3ZR4B 4XSHA 4AICA 621PA 1C0IA 4LXYA 2DHDA 2P91A 3HVHA 3KCQA 3KJQA 4ZAZA 1NHWA 3UAOA 3IAXA 4QT0A 3AL3A 3L6UA 3ZBPA 4YRRA 4FEAA 4F2GA 5GADl 3W78A 3U37A 3I1YA 1C3VA 4LE1A 4U5QA 2PZ8A 3GT4A 4HQOA 3ZXXA 5HQ3A 3HHEA 3QWIA 5IK2A 5KCZA 5B36A 4R8KA 2WAXA 4BB5A 1ZZEA 1GL3A 1UXGA 1V1MA 2NXCA 3D8UA 2MYPA 2P1RA 4Q3BA 4AZWA 3LG2A 3H8WA 1QG2A 3TK1A 3UCXA 1L7NA 4JVOA 1O0CA 1SVNA 3GRPA 4GXRA 1MC5A 1ZN8A 4XQGA 1YWGO 2FYTA 4D3YA 1RI2A 2PGJA 3DZ8A 3DFIA 4HH4A 3ZVKA 3EPPA 1E96A 1G9SA 1L7BA 3HUDA 5DX1A 3VR5A 4OP3A 2DERA 4U9HS 1ZGGA 5EWMA 1MG0A 1CQZA 5HP4A 5GVSA 3PLRA 2WWXA 3AUTA 1Q14A 2X9QA 1O1YA 4YJGA 1AZTA 3GRRA 2IIBA 3R40A 1IBCA 4EHKA 4P5EA 3HGMA 4A0QA 2NUBA 1PJZA 1W4ZA 4F84A 1VFNA 3ZY2A 3QYJA 1OBVA 1L4BA 3DO8A 2ZITA 3OEWA 1QG4A 1JA0A 1EGMB 3N0WA 3ZGZA 3I83A 5FO0A 1D2EA 3RT7A 1L8QA 5K0SA 2FR0A 2X8AA 3IMEA 3DEFA 3EQ7A 3AERA 3KSMA 4OSPA 1KDRA 4O4IF 3JVDA 4KFTA 3Q2IA 4UHBA 2VA9A 3NTXA 4M8NE 3IEMA 3VYUB 3RSHA 3GLIB 1JFRA 1YS9A 2HHJA 1S7CA 4EPWA 1XDUA 5DI9A 5FCDA 4M3NA 1G1MA 4NNPA 4AO6A 1ZMRA 3PDIB 4FILA 2IQIA 1RBMA 1A7KA 1X1AA 5HMMA 2BGLA 3DL4A 3RJTA 2PH3A 4JI4B 4NU0A 1K7XB 4A03A 4O2RA 4JVSB 3FCAA 4F4IA 3I8OA 4FEEA 2B34A 4X93A 4GRIA 1A9RA 5C5IA 1YJQA 3GGOA 3ZEAA 5JNSA 1M54A 1BVRA 1S8FA 3H86A 4K8RB 1PDOA 1DJLA 4CF6A 5TC4A 1Z0DA 3QUAA 2PLFA 4X00A 2AXEA 2Q3FA 2YXNA 4JH0A 4H16A 1IOZA 1CY6A 2OAGA 4R9NA 1Y3BE 1U2RA 3I5UA 1F5NA 5AM4A 2V0CA 4MV4A 4EJSC 4XB2A 1WUTA 1HYBA 1TLLA 1JX6A 5IT0A 5K09A 1LVUA 4KLAA 3SAJA 2GXUA 4UMFA 2V4MA 4INPA 3JQFA 4ND7A 4DR3B 3CM0A 4LX0A 4MLPA 4PCUA 5BWOA 1GQSA 1CDEA 3U3DA 1AF4A 2I2DA 1XEFA 1PIWA 2UZ1A 3AR3A 2O7SA 3OPMA 4M6WB 1C4WA 1D1QA 4L0QA 3RBXA 4BNLA 4ZMSA 3IKLA 2H18A 2WZBA 2C7PA 1ISMA 1U11A 1VIVA 2BISA 1WPQA 1A2KC 2VJYA 4Q1BA 1UK7A 1C4OA 3FZEA 4KXVA 2ZXFA 1QZ3A 1X7XA 3HP7A 3RSSA 1GG9A 3BRWD 3K6SA 3L46A 1MORA 4F12A 1NW3A 5EHXA 1V8OA 4HS4A 2WOOA 1IATA 3AIKA 3BGDA 3R3VA 3BA6A 3KB1A 1R0XA 4BGVA 4Y18A 2PUTA 3NU1A 3CH4B 4DLWA 1RQLA 1DXHA 3RAJA 4B6EA 4BV9A 5K0FA 4PN7A 2GM5A 4KVFA 4A0GA 1VJ5A 1FZQA 1E2UA 3OZGA 4DQVA 1OH8A 4B6SA 4RANA 4N0QA 3RIMA 1Y80A 4AC9A 2GEUA 1K9VF 1HNZB 5DWDA 3H04A 3KXIA 5EGSA 2X7JA 2BKUA 3R0QA 1EWQA 2CLSA 1ZRNA 2HA4A 4XCQA 1Z12A 3D02A 4N9WA 3D3WA 3P94A 4D97A 1UAYA 4GG1A 7ABPA 3TUJC 2DTEA 3JQ8B 1QH8B 4KQ2A 5ED0A 4QVIA 3CF4G 2PBFA 4UKDA 5FXMA 2I7TA 2D5IA 1ZCZA 4GEKA 4K9PA 3E05A 3PFKA 4LOLA 1LF5A 2YWBA 1VL2A 2VP4A 3HDVA 4QOGA 1GILA 3VUEA 2H1VA 2FFHA 2Q8NA 3H42B 2ILTA 2P4UA 4DIDA 3WE7A 4Z4QA 1KXJA 3OE4A 1VG0B 4PNEA 1VCIA 4AO7A 1UJ4A 3KAQA 4ZVMA 3HG7A 1DFGA 4ZVUA 1FQKA 1XTIA 4KQCA 4YBZA 1ID8A 2ZPUA 2A1UA 4HB4A 2IUSA 3M3HA 1E9RA 3DD1A 2ERCA 4W1QA 3LT1A 1UIRA 2A6PA 3HZZA 1RADA 1ULTA 4KL8S 4ZC8A 3K71B 4C0BA 3SJ7A 4CM5A 2OFFA 1QKIA 3TSZA 1IBRA 5B4VA 5K9ZA 3W9YA 3ER9A 1E8NA 3CR3C 4HSEA 2HQOA 5BVHB 4X65B 1RPTA 4OSEA 1XZAA 3AIOA 1E5LA 2GN1A 2J32A 1R27A 2JZNA 3VR3D 1QRTA 3QUQA 2NACA 1RTKA 1I4LD 4UEJA 3IAS6 2BKXA 3CUVA 1DAMA 5HIJA 2D4AA 2LXNA 2XDQA 2DOKA 1WMBA 5ALFA 4ILEA 5IVKA 3O8BA 1V3VA 3DONA 1E5DA 5HF9A 4TPKA 2OCBA 1OFIA 1RHQA 1MC1A 3TQTA 2VYVD 4CODB 2W4MA 4Z5XA 1WTCA 4RPCA 5K3EA 4LDJA 1MDFA 2JK0A 3I76A 3H2SA 2FPIB 2VDLB 1HV8A 3D6FA 3QY9A 2AT1A 3CLTC 3ZI7A 2X5XA 4D57A 4DGQA 3GWZA 1DBSA 4GPAA 2KMLA 3QUSA 1ZD5A 2JAQA 1VIMA 2I71A 2R1ZA 2OBFA 3FYUB 3HB4X 4J90A 4MI3A 2GD2A 3T9EA 4BFZA 4ENSA 2XBMA 3IV6A 3EMVA 4PLWA 1R0RE 2VSXA 3CLSD 3KELA 5CYPA 4BMNA 1Y37A 4B3CA 1T6NA 1RKXA 4EVQA 1XVVA 1IXRC 1V43A 4US1R 5DBOA 3ZLJA 4RGBA 4LXHA 1A9YA 4RTNA 1AT1A 3MJTA 2CBXA 3IAHA 4DLPA 1JFVA 1K86A 1JB1A 3WMGA 2IZ0A 1M2OA 1ZI8A 1EG7A 4DRXB 1JUDA 4OOEA 1YACA 2VF8A 1BRTA 1DJNA 3OIGA 4RS3A 4UUQA 1E8DA 3QPAA 4OMUA 2QT1A 4NMHA 3V8MA 1XKTA 3P97A 4OY3A 4W5NA 3RDPA 2HIGA 4BO9A 3KJNA 4QU0A 1IPHA 4YVFA 3UQZA 3O3OB 3UQYS 4C0KA 4TN1A 3EZYA 3PC7A 1DBVO 2A14A 4NAHA 5LQKA 3U3ZA 1LTQA 2VPPA 1Y8RA 2DBYA 1G8HA 3H4IA 4YT8A 3JZFA 1JU4A 1YZFA 5KTSA 3WK8A 3ANTA 5AUNB 5KYXA 5LP6B 4MRSA 3U6BA 3L02A 3RT9A 4P34A 3TR0A 1M6YA 4PX9A 4H1VA 4DTIA 2IL1A 2AOUA 1R6XA 2VK4A 3T95A 1OA1A 1WZUA 2H2GA 3UJNA 1E2FA 1BKDR 4H6XA 4BASA 3TD6A 3EC7A 3Q8KA 3ESYA 3ZHRA 3PFHA 4KQIA 3KQNA 2EF1A 3MRXA 2EL9A 2OC4A 5LZ9A 2GVDC 1NNI1 2NQ2C 2V54A 2VJOA 3C1AA 3DAOA 3Q6NA 4QHSA 1S4MA 1NN3A 1W4AA 1QGED 2FRDC 2VRBA 2JNWA 1X7XB 3B6MA 5REQA 3TRFA 4HRXA 4UEQA 1D2MA 1R18A 1Z68A 1KKMA 2YJTD 4K26A 1UXHA 2CCJA 3NXSA 4R54A 3W2EA 1N3LA 2GILA 4MS4A 1GGJA 4LGYA 2QX8A 4I2VA 2B37A 2X14A 4UUPA 2ATCA 3GRVA 3UC9A 3KQLA 1MIOB 3OA0A 4Q6WA 4D4KA 4BE9A 3PCTA 2XHZA 4YUXA 1UUFA 2AB0A 1BXZA 3AKCA 4L6IA 3G8DA 3DYIA 2PAAA 3AUYA 1QO0D 2YWXA 2CXTA 2ZS9A 3TCNA 2AFIE 5I45A 4DUYB 2YQ5A 2P9ZA 3NIWA 4I6JA 1G8KA 1VIAA 3DE3X 4YYEA 1VHQA 3K09C 1P19A 4FCWA 2Q46A 3WHIA 3T5GA 4A0HA 4D9NA 1AQUA 2JEYA 3KL2A 2GKSA 2JCGA 2NUTB 1TJ5A 3I6IA 5KSYA 1I1NA 3W06A 1QB7A 1Y3CE 2QMEA 3OZ7A 3N8IA 1YQ9A 5DK6A 1YVRA 2ZPTX 2W6QA 4B5KA 1AZLA 3H9CA 4YO7A 5KEIA 4EVSA 5JANA 3OHPA 4DTCA 2NTYC 1M10A 1UJBA 2MSDB 2OCYC 1ZAKA 3ECAA 3KT3A 1X1RA 2NYAA 1KZYC 3KAJA 2FPKA 1NWCA 4N0DA 2O5VA 3PTLA 3GARA 5FOQA 5I9LA 3KE8A 5H3CA 3WICA 1E1RA 4RJJA 1BHJA 1Q22A 5JCZA 4RTLA 3CLHA 1WUHS 1XMIA 1U2DC 3Q3JB 4JBGA 1L5QA 3Q15C 5E7QA 3VOSA 2FQXA 4ALIA 2JVKA 3PEWA 2B7CA 1ZJ5A 4KJZA 1JLKA 4PLPA 1XU9A 1NU8A 5C1IA 2ATEA 1DT3A 4NU6A 4B8WA 1JHUA 2ZLBA 5HIKA 1SMKA 5FWAA 4Q16A 3JWPA 3BDVA 2IYUA 5GJVC 2X1VA 1JHOA 4R1SA 3R20A 4F1KA 1UEIA 3PU6A 3RSGA 5K6RA 2I6GA 4RGQA 2HJHA 2J07A 1XRQA 3CFYA 1JLMA 4WCDA 1GFSA 1TGYA 4WMLA 2CYAA 4E7PA 2HA2A 3JQ9A 2Z4TA 5AKYA 1Z5VA 1HT1E 2ZJAA 3LBFA 4HY3A 4EKYA 3DEHA 3I9JA 4TVBA 1XZPA 3OEEA 3A6GA 3T7AA 3B6EA 4EEZA 3DG9A 3LDGA 1FLDA 2PXCA 1UPCA 3GEGA 2VJDA 1XF1A 3GIWA 3H87A 1DJQA 2ABWA 4M1EA 1T2FA 3EUFA 4R2IA 421PA 3ADCA 4ER0A 3F2VA 4YS6A 3CURA 2BM1A 4EY6A 5BPFA 2BSQA 4L73A 1V1MB 5BYAA 2IHZA 1NL3A 2ZIFA 1EVKA 3I9LA 2A9QA 4B79A 2PHZA 4B74A 3KZMA 1T6YA 1UBHS 3ICPA 1CR2A 4Q24A 5EJIA 3RVPA 1CUCA 4BWFB 4Q7EA 4YJ3F 4QGHA 3IAEA 5BY2A 3SS9X 1HPLA 5B7GA 2JFZA 1I0LA 3DZGA 1F9AA 1N7JA 1RDFA 1ZD1A 2FWBA 3ILSA 4JLAA 3TR6A 4EFMA 1FZTA 4YRBA 8OHMA 3WL8A 1F8UA 4L5IA 1PBTA 2IKQA 1FYWA 1ZG3A 1P2GA 3EXG1 4LN1A 1S8OA 2FPLA 2OL4A 2ZR0A 3QVLA 4U2GA 4EHJA 1YQUA 3PX7A 2XE6A 3EVNA 1ZI9A 3GJ6A 4ZMBA 3GT0A 1T4GA 2O2EA 4GYKA 1FXSA 4QHYA 2ZZMA 4CM1A 1Z6AA 2M98A 5FBVB 5I4CA 4WA7A 1FTYA 2G4LA 2CC2A 3FFTA 4F60A 1XVLA 4FC6A 5H68A 3NWOA 3FIUA 5KYKA 2J09A 1ZUWA 5ICEA 3L8ZA 2YV1A 3A9SA 4NZYA 1D5CA 2EL7A 2Z2XA 3AB3A 3OEYA 4OP1A 3WMFA 3SQWA 2LCFA 4Q00A 3FXAA 5L45A 3C5VA 3VSAA 1GCAA 4N47A 4IHQA 1W9HA 3RUHA 3W5JA 5M34A 1ZCJA 4RMJA 1SQ6A 3P26A 4DNPA 1JHYA 1P60A 2ZI4A 4GXTA 2AJTA 3AUXA 3GFRA 2B8WA 3C8MA 2ZAGA 4PWZA 4Y2XA 4BO3A 4BV2A 1HMYA 1US8A 3AJDA 4IJ6A 4WESB 2Z57A 3TQSA 4BNWA 1R7RA 1NRWA 5P8WA 3ENKA 1J5EB 2ATIA 4OFBA 3X0DA 4KAFA 5AHXA 1K63A 4L8WB 4R3NA 5F2OA 5L3ZA 3SVTA 2DH6A 3FYUC 4DV7B 1UJ2A 2FAXA 1TCAA 4Q6BA 4HWPA 4MK4A 4IKPA 4PZPA 1YS6A 3MXOA 4NQZA 1SUDA 3UCEA 3PYMA 2WNSA 4LBYA 5EHNA 4WT7A 4ERNA 4MB2A 5BWLA 3EOBI 4RHUA 1DBWA 3MCTA 3QMVA 4UULA 1SD2A 4WBNB 4W9NC 2EYQA 1IN7A 5TGDA 5JRJA 2HREA 1SCDA 3FFBA 4RTMA 2JEZA 1GRCA 1JXAA 1BWRA 2JH8A 3H0EA 4PX3A 3C14C 4UNSA 3ZGVA 5EXDA 4NEGA 3N87A 4U5XA 3AR4A 4Y8VA 3TX2A 4BN4A 1RZVA 4URFA 4B33A 3NYRA 3LVBA 5EP4A 3TXYA 2DUMA 1MG5A 1UC8A 3JRWA 2D3WA 3GPIA 4QUBA 4KYIB 4A92A 1C1XA 2B2NA 2JBHA 1NQWA 3GJ0A 4EHFA 4ND6A 1YVEI 4PGAA 5C0OE 5JWOA 2ZRGA 2FPSA 1GPBA 2DLCX 3N59A 4JOBA 4EUKA 4BATA 1HG0A 2NO5A 4HLQB 4RKYA 4E1VA 1XXHE 2VATA 4L2IB 1OFUX 1GTJ1 4G1BA 4HVCA 4NL4H 4HDNA 3TNLA 4KR3A 1FJHA 2F1OA 1MX9A 2ZYVX 1QCCA 2ZEJA 1MJGA 3QNUA 4MJXA 3U3JA 5HJEA 3K4PA 3OLWA 2QORA 2IYNA 1W1UA 4DZZA 3B1WA 4P4SB 1B15A 4FNMA 3ZDYB 1UBKS 3AVVA 1AXEA 1QONA 2AX4A 3H9QA 2AJ8A 2AXQA 4Q93A 1MH1A 1ATZA 2HRZA 3T0GA 5FPHA 5HIAA 2TYSB 3NJ4A 3LP8A 4DMFA 5CA1B 2AI1A 4C7MA 4HNHA 1QIDA 2GEVA 4UU7A 4HH3C 1UR5A 4CUKA 5E1MA 3P19A 2D5CA 3WQBA 4MLZA 1ADCA 4LVNA 2O8DB 2EFEB 3G0IA 3KIPA 4ROSA 1UOPA 4ZYVA 1ETHA 4OYYA 1VPVA 3KXPA 4OQNA 2G5PA 3TZBA 4ZHQA 4WGGA 3I3OA 1QAOA 4HMPA 5CVVA 4C21A 1ML4A 4QICA 4ZYZA 2ZATA 3FYSA 3OLCX 5FOXA 2HSDA 3K35A 3U3KA 1LXCA 2GFQA 2H9YA 2YVUA 2JJ1A 3E2PA 4CKBB 2VK8A 2NSLA 4IGKA 2P9JA 4H35A 4L4ZA 5COQA 4CNBA 1C1XB 1XZJA 1M1UA 2ECPA 2DKOA 1UPXA 5A02A 3RFXA 3M5DA 3NAZA 1EUDA 2COEA 2RH9B 4OLJA 1JKFA 1GYQA 2NV6A 1C1DA 4I3FA 4EF5A 5ITZB 1HORA 1OPRA 5F78A 4EJMA 1EDOA 5CA1A 3ZQ4A 3GQBA 1U8ZA 2H7VA 4UOZA 4AKHA 2OENG 2WPDD 2JGIA 4LY3A 2AYXA 1WPRA 2QROA 2JHAA 2YWHA 4H1TA 1KO7A 1ECLA 3MFQA 1PEAA 3H19A 4FBLA 4L75A 1FEZA 3QJ5A 5CA0A 5KX5F 3QE4A 1N78A 3II6X 4G4SP 3GUUA 2OCPA 5ES3A 4AJHA 2I5PO 3OBBA 4F04A 5IXSA 2X13A 3VNQA 1QIIA 1A9ZA 2C97A 3NWPA 2PT6A 1PS8A 4YY3B 1X15A 2J0UA 4UBJA 3FTNA 1DG9A 2I2CA 2ZFUA 3VZSA 1GEGA 3UMSA 4F6CA 1T5HX 1NJ5A 3QELB 5EJGA 1M7GA 4LZNA 5CNMA 3G0HA 4REMA 4CLRB 2POQX 5HUHA 5CVUA 4DIFA 4MRRA 3GU3A 3LPDA 1OZGA 4DARA 5EUCA 3I0ZA 2H7CA 3QEOA 3W4JA 3AFGA 3EIHA 3MVEA 3KOYA 1JE1A 5FUXA 2VDUE 1FJ2A 2MSCB 2WIJA 3M9LA 5BSEA 3ESDA 3MQ2A 2NO7A 1V5GA 5KYGA 1NGSA 2FPOA 3AHIA 3KTFA 4XM1A 4GICA 3SQMA 2UYOA 4CT0A 5A9SA 5JO0A 2C7OA 1WJGA 1N3IA 3THWA 1A82A 2CE7A 3DEIA 3NDIA 3TMYA 4C3ZA 3U7HB 1A2BA 3LX8A 5FWDA 3QWBA 4O25A 4OAOA 2BHSA 5EJ7A 4IHJF 4M0EA 3FGNA 4NENB 3EK2A 4RK4A 4AJNA 2O50A 3MUEA 3G9ZA 1JT9A 1YGYA 3OIVA 2FSGA 5DNEA 4NECA 5F7ZA 3W1VA 3FOZA 2ZVJA 3NBZC 4W6ZA 5DBGA 5IASA 2H3HA 5JISA 1Y6ZA 1AC5A 2KLHA 2YJGA 5DB4A 5PGMA 5BN5A 5H5JA 1OROA 1E6KA 3T7RA 1GJRA 4GLLA 1E2KA 4I4NA 2MINB 3DKIA 1AK2A 1M1XB 2IYSA 2PUGA 5DI3B 4K9DA 3L6CA 3ICEA 2VK1A 1TYEB 2D0PB 3F7MA 1TM1E 5CAEB 5H16A 2WNIA 2O8CA 2AFIB 3DL0A 2QM7A 3FPGA 2CVOA 3HU5A 1C3LA 3TZQA 3AEYA 2HCTA 5BP7A 1KEKA 1P1KA 2SCUB 1HE5A 3NDJA 4KSBA 3TLEA 1U5AA 4TKMA 3GZNB 3PI6A 5SY6A 4F0JA 2ONYA 3AFMA 3LJKA 1YCHA 2EFHB 2REXB 2XUIA 4PV7A 1FP4A 1ZGAA 2QXYA 2W8BA 3MWJA 3TVYA 3E35A 2QA5A 2HYDA 4C4SA 4TZKA 3WYGA 3E3OA 4NDNE 2JW5A 4MQBA 2OP0A 4RZ3A 5IKXA 3L01A 3Q41A 4X5OA 3CO5A 1KIAA 2IK8A 3OIDA 4IVRA 3LY8A 1BH2A 1TK2A 4J7XA 4LYHA 1CUSA 2I7DA 2AE1A 1NP7A 1KMNA 3IEIA 1P81A 3N5CA 4IEIA 3HEBA 2CVFA 1JTEA 1U9ZA 3HWX1 3I28A 5TRTA 2OO7A 2WF9A 4NZPA 1L6IA 4ABYA 1OU4A 1SVLA 4IS3A 1DIHA 1JEYA 1YHNA 4BO4A 2XGGA 3R7BA 2EBFX 2FZ5A 4MWBA 3A6EA 3F74A 3KUUA 3VI3B 4DLVA 1AKYA 5EESA 4YV7A 3SG0A 1Z4IA 4M98A 4BLSA 4AKIA 4Z0NA 4EL5A 4TMKA 4HX5A 3DULA 3CF0A 2AH5A 4JJIA 2G9QA 3JAWA 1KZ9A 2IOHA 3DTVB 1X7YB 2FB9A 2PBLA 5A71A 1ADYA 3T7KA 1F8GA 4CCYB 1F4VA 3UHOA 5I51A 2FG5A 4JYCA 3T35A 3BTSA 1QAQA 2H0RA 2H29A 4MIKA 1D7OA 2Y1LA 1YRBA 3THYB 4K03A 5FJJA 1THGA 2RHMA 2Q4EA 2W5UA 2XECA 3MJ4A 3VAYA 3ZCXA 3G0CA 4LJRA 1V8FA 2H51A 2XWPA 2WAYA 2AOXA 1O9BA 1G8PA 4MR8A 5CLHA 2B4QA 2P3QA 3R9XA 3F7NA 1PT6A 5L6MB 3KKMA 5CLQA 5BVHA 4KFCA 3DM9B 3HLKA 1MGOA 2Q6TA 3KSRA 3HEMA 4B3XA 1EP2B 4DL9A 1G20E 1U4OA 1V71A 1S01A 3NPAA 3ZE8A 2A0KA 4O5OA 2RAFA 3ZJYA 1E3WA 4K6OA 4FHFA 4O4LF 4OB8A 3KLOA 3HNRA 3SHQA 1Y1TA 2B78A 4MP6A 1Y1KE 1ZJZA 2UZ0A 4UVHA 1AV7A 3IHWA 1STOA 3DE0X 3E22B 3IP7A 4IIJB 2CNBA 1M6NA 4PSCA 4CKCA 3DBOB 2Q50A 1XJ0A 1ZD9A 3C8HA 3GXOA 2C2KA 5ESWA 3T1YB 2ACEA 3EFBA 1AK1A 5BOSB 4M89A 4ARVA 3QVTA 4FK8A 4EB6A 4D5EA 3VPHA 4DM7A 3E9EA 5EPEA 2OV1A 2VHCA 4Q3AA 3DUWA 1ZBDA 2VAWA 2XYRA 4QYWA 2HH9A 1N75A 1TQ2A 2F48A 2DQSA 3EA5A 5AVZA 3H18A 3GJRA 4FLMA 5K0JA 4QUEA 2X6RA 4JENA 4E46A 4C4ZA 1UAGA 2KBEA 2PH1A 3UENA 1E1QD 3BMNB 1JMKC 4GPTA 4I1RA 5JARA 2Q5QA 4C01A 1EFTA 4CTNA 2VYND 1UF9A 3PEFA 2GBGA 3CPEA 3ZKAA 2H9AA 1L5OA 2H2WA 5EZ6B 2C4KA 2NU8B 3NKLA 2ZJ1A 3ZXIA 3DMRA 1U0JA 1BSVA 3QVMA 5F12A 4Y1GA 3C6QA 1KAMA 3DUFB 3GZ4A 5KNCD 1RCTE 3RODA 3I04M 4KBYA 3V7FA 3GFFA 3F1KA 4KXLA 1XO1A 4KE7A 5HXAA 5L6LB 1RRKA 2X3FA 3B51X 2XKKA 2GDZA 3D7SA 4M9CA 1XDWA 4PEVA 2GPAA 1L2TA 1N25A 4JY7A 1AB6A 3D6VA 2AHRA 4QVGA 4YJ2F 3RFUA 1XJ5A 3VTAA 1E6MA 5IWAB 1MOZA 1ZJJA 2CNLA 3UAWA 5A4JA 5AVOA 1CUHA 3KTAA 2MTBA 2P9YA 3I2IA 4BNVA 4D7AA 1QHIA 3KV1A 1CQIA 1PV1A 3PDJA 4GPEA 4YRIA 3Q88A 4X8MA 2MWMA 1I4WA 2ZAMA 2M6KA 1FDIA 1G2PA 5CM8B 4WCFA 1YBHA 4P4UA 3VNRA 4QAJA 4JUCA 2A30A 1JHAA 4TSRA 1AU9A 3QFRA 2X2OA 4G84A 4MI1A 4EG6A 5JEDA 2XRFA 2J9FB 4ZOEA 2E3JA 5FTWA 2VT3A 3T3EA 1ZGJA 3IEXA 3ZHQA 1YHYA 3ICCA 5ICSA 1ZKDA 1LBEA 1QZZA 1P8AA 3A4LA 3ETGA 3MC1A 3DDHA 2C59A 2VA8A 2XXJA 3H11A 4I08A 1A1VA 1NW7A 1I6WA 1YBMA 2PS3A 2KM1A 5H3HA 3KOXA 1V4BA 4ZGBA 5I4IA 1NG1A 3L0OA 1I3OA 3A2KA 4DA8A 3W9UA 1GXSA 4JI6B 1BMFA 3SX0A 1AGXA 4BNMA 4V1CB 2W2LD 4A2WA 3BFKA 5LPNA 3O3MB 1K5DA 1CRQA 1JQBA 2E87A 2BMVA 3DNPA 1Y8AA 3D6AA 1P1HA 2ZBVA 3STXA 2QX7A 1RWOA 2NZWA 2VYFA 1ZUD1 4YO8A 2R66A 4DCNA 2C3OA 2L42A 2WU3A 3TSCA 5C5EA 3KJHA 4B09A 1H2ZA 2PGAA 3REGA 1PCXA 3COJA 4LFBB 3L1KA 4HHEA 3RUAA 3FETA 3V5NA 1OXKB 1UKVY 4S0ZA 2PXXA 2PX5A 1FYDA 4HN9A 4TYPA 4DMUB 4CETA 2JRCA 3A9TA 2APJA 4MWEA 1WU7A 3JQAD 5FWXB 1KQNA 4J0DA 4O2AB 2PSSA 4W63A 3M81A 3QGMA 3KYIB 3C5CA 5C5CA 2PWAA 4GBMA 1KXZA 4TS9A 2PFSA 3HB5X 5HGXA 1K7FB 1JLLA 5IABA 1XEWY 2ZRPA 1E9VA 1PR3A 2VP9A 4GMKA 4QXAA 3UTCA 4P3PA 3B5EA 3DQZA 1TYCA 3B2QA 1Z2CA 4Z9AA 3DMYA 1W85A 2GFIA 1M67A 1WD5A 3PTZA 4UJ3A 1UXJA 3UUEA 5KNLA 1I2MA 2FPUA 2AWNA 2KQUA 4XUCA 1W581 3RHSA 2O8FA 1G3UA 1R6TA 3O21A 1Z3CA 1I5OA 3RFCA 2HA5A 2PYIA 4COOA 3FTPA 2BHRA 2RHBA 4FGWA 2R5WA 4R98A 2A5JA 4FDTA 4RM2A 5INTA 3H5NA 1HY3A 2IZ6A 3LUAA 3PR1A 4LV5B 4X1KA 1JHZA 5G4KA 1SU8A 4D5GA 1R9NA 1S0UA 2X4GA 3A10A 3AY3A 1QHNA 3IVCA 3SHWA 4KO2S 5L4LA 1L0BA 1TD1A 3M5CA 2BMEA 3CB4A 1IXSB 3SBDA 4CM8B 1I94B 1KQPA 1M0SA 3GLHB 5BV1A 2VWPA 4F7WA 4WVFA 1HQYE 4OLBA 4FJ0A 2WE8A 1YTUA 1TLFA 1VGQA 2Z5FA 3DKVA 3DTYA 3EZXA 4XYMA 4DADA 3F7OA 4NE2A 2IP4A 2NQTA 4MRMA 3AH8A 2GLXA 1OHHA 1ZZGA 2OXEA 2R25B 3EXEB 4PFSA 5IBQA 4JEUA 1XI2A 4XM2A 4B3FX 4NZOA 4NV3A 3HSKA 2Q7OE 2EGGA 4GE0A 1KZHA 3R9XB 1Y6JA 2RKWA 1GAXA 3H8VA 2IYXA 4DLNA 1ZD2P 3DHVA 4QLOA 4FT4A 3WY9A 4BP1A 4MDYA 3VYSB 2FV8A 4JJ8A 3UWPA 3IIIA 1W93A 4R5HA 3FNEA 1ZM2A 1LNSA 1YASA 2QD3A 2QR3A 2W6PA 5ANRB 4AZSA 1UP6A 4OA8A 2IRWA 1U8EA 3DHEA 4YCLA 2QW1A 4M88A 2OVBA 3LAWA 4BS9A 1EM8A 1V7QA 2WKQA 2OPBA 1QIMA 3R7SA 1KYWA 1Y6RA 1Z16A 2OGUA 4PPQA 4XDZA 5CVEA 4N7RA 4MJ3A 3UHJA 1EX7A 3F8SA 3H2KA 4IRUB 3KQOA 2X0RA 4I0WB 2J9ZB 1G7SA 4QLAA 2WWRA 4YCMA 1A8IA 5HZMA 1SHTX 2WM2A 2I8LA 5FORA 3ZZNA 2HDOA 4B6JA 5EXTA 3EWIA 4QVKA 2NSYA 3O8RA 3IS3A 2AUMA 3PPWA 2WLSA 2WD7A 1I4EB 3QA3E 1XZLA 2EG5A 4JITA 3VKWA 5BV8A 5AUOB 5FBWB 1UBGA 2DLNA 3A6KA 3O3CA 3WAJA 4MOWA 5ALTA 2WYVA 1GSAA 1KRHA 3FRJA 3GA7A 3JPYA 5CNKA 1JYSA 3BZWA 4KSYA 5K3FB 3LWZA 3ZV4A 3MMZA 3GFOA 4G4SO 1FTSA 1GLVA 1NE2A 2P9CA 4BFTA 4KGZA 3UOWA 4FHEA 3VPDA 2BT4A 2VUSA 2RGWA 1R74A 2XPCA 1G8SA 1UJ5A 5G0WA 3COVA 4R2HA 1JPJA 4HF7A 2ZRCA 5H83A 1HE1C 3WGYA 4LISA 3Q9SA 4UUNA 4R8LA 1C3EA 1ZYUA 3OKAA 2I4MA 3OZEA 4MQ5A 1IN8A 1H22A 2DHRA 3BHIA 4KWTA 1H1DA 5EE9A 3O5AA 5ARBA 5KNDA 3D31A 1M2NA 3KUDA 2DHCA 5DCLA 3DBRA 5CBKA 2BL4A 2M1XA 4OXYA 3ZJUA 2NZJA 4E09A 4XOIA 3OC0A 4BQSA 3U44B 3SVZA 4FFPA 1FMCA 3R23A 4G26A 4D6PA 1VLHA 2G0AA 1P2TA 2BUBA 2PX6A 3KB2A 2FDCA 4B7UA 1V9LA 5B7QA 3RHTA 1I30A 5BQ5A 3ZV5A 2PMCA 3EZ7A 4DW8A 2PCLA 3KHTA 5F1KA 4MDHA 3BIXA 1R0BA 2ZU0C 3NHFA 3U60B 4M38A 4DAOA 4KQGA 2QD2A 4GMGA 1U7TA 1YJ8A 1PS9A 2WJWA 4RPKA 4BUJA 5B2EA 4N3BA 4ODIA 1JYEA 1R3DA 4U2BA 3ZJ4A 2PL9A 4WZBE 1E7QA 1VXOA 3QEKA 3OURA 1U2QA 2X5JO 4KWIA 3FR8A 3D7MA 4RDIA 1B2LA 1POWA 2FWJA 2Q3BA 3QKSA 4IZHA 1TRHA 4RSGA 2GZMA 3P96A 1E6CA 4F93B 1SVMA 4MVJA 5A9SB 3E1SA 3RYHB 4XLLA 2CNNA 2A3RA 2HPAA 3G2IA 4JGBA 3IC5A 1OBOA 2NZ2A 2VO1A 3P9RA 3ZWNA 2C8LA 3ESXA 1W0JD 3GY0A 3NAMA 3MOSA 5JOQA 2QRKA 2J33A 3UMMA 5T6MA 3AW8A 1DMRA 2JARA 3K8ZA 4EG8A 3GNSA 2B8NA 1CZKA 1R9JA 4GM4A 4O4IB 1XU7A 4WBXC 2Y71A 4BB0A 2YVKA 3AGQA 5JC1A 3THSA 1G2OA 2VZ8A 1FYXA 3AB7A 4ZI5A 5MHTA 2X0FA 4RKWA 2X5NA 4Q47A 3I73A 1OU0A 2C61A 5G1PA 3WV4A 5FRDA 1N92A 5DJ5A 2R1UA 3KWJA 1YF3A 4B0OA 3QFSA 4M7WA 3HLTA 3T8YA 1NZJA 2VXOA 3DW3X 3CVVA 1P77A 1E9BA 1JHPA 4OF4A 4RELA 1GAEO 5BN3A 1W5FA 3HKDB 3AL0C 3U39A 1U0LA 3GHYA 4GMDA 2H17A 1GSHA 5BVGB 3GW8A 3MERA 4DYHA 1GARA 3S29A 1PZFA 5GONF 5LOVF 4Y2PA 1D1TA 2O7RA 4I66A 1UINA 4P9NA 4O0MA 3HV0A 3GVIA 3AM4A 4EA9A 3IUQA 1JRLA 1Q57A 3WRYC 1DEKA 2YXEA 1MLDA 2QT9A 5T3UA 2I78A 4ZREA 3SOZA 4A10A 4JNKA 1UPBA 2VXCA 2Q5IA 4YRGA 2DP4E 3TTWA 2O2GA 2IU4A 3MJCA 4H18A 2YHSA 2W6OA 4BNXA 1JEEA 2HBZA 3NV9A 1DEHA 1AUQA 4RIEA 4IHKA 3R74A 2ZWPA 4NBSA 4YT5A 4E5UA 1KFCB 3NHMA 1RJ9B 1XNGA 3TN7A 2VUTA 5KDDA 1FFSA 3OFVA 4H77A 4ED9A 2HB6A 3QZUA 4FCVA 3NH6A 2GJ9A 1MX3A 5TT1A 2PEYA 4ZRNA 1EIZA 1AVTA 1XZBA 1ODSA 4TSFA 2LR0A 4QFMA 2FKNA 1XALA 1CCWA 4GLOA 4DWJA 1BROA 4ZT5A 3TOXA 1GTL1 4O08A 5FUMA 4NMLA 1VP9A 2I3DA 2ZRHA 2VXYA 5HZGA 3N70A 2VIIA 2BGMA 4WBSA 3NM5A 4IDFA 4PU0A 3STUA 2Q3JA 1PJ2A 3LS2A 1V3QE 4Z7OB 3GI1A 1CJTC 1G8JA 1RHRA 2QVBA 3IDZA 4LYFA 4AG5A 1JL3A 1T2DA 2KW5A 4EFDA 2XZLA 3DZFA 3P0EA 3AHFA 3ZIAA 3TEMA 3FI0A 3FJ1A 4A16A 2D1YA 2W6IA 1BYIA 4JDPA 3GLGB 2GRJA 4MQ4A 2J3IA 1FDUA 3GZTB 3I39X 3LRTA 3PFWO 4M1TA 2IYEA 4DC9A 4FW9A 3WVNA 3EVZA 3PT9A 2EFCB 4ZRDA 5T4EA 3T41A 4EYQA 4B7CA 5TE9A 1ODLA 1HOTA 1V3TA 3QLVA 3WQQA 1SN7A 5HSGA 3WQRA 4JI0B 1CZLA 5BRNA 1KMMA 1EVQA 2ZU6A 3DBVO 4MUIA 1VJRA 1W2GA 3ACBA 1QO0A 3DMHA 4BPBA 1FRZA 3MGBA 4WDQA 3SYMA 5IU6A 1EFUA 2O3TA 3TQCA 3RRNA 1ORRA 4LKRA 4B2IA 2O6LA 2FN7A 3O8QB 4FZ5A 4MWSA 4OAPA 4O4JB 1RWNA 4YGXB 5DGXA 4Q1CA 5JALA 3FPCA 2F2TA 2H5EA 4DLYA 1LV7A 2CEAA 1ZN9A 1OWLA 4A0SA 2DMRA 3EA4A 3NNSA 1MQAA 2MR5A 5HJ2A 4D3ZA 3VR1A 4HNGA 4D1YA 3LQ1A 4JLBA 2FWNA 4JJGA 4LHYA 1JW9B 1LSJA 1NW9B 4CLXA 2Z2IA 4GF5A 1L5GB 3ZQ6A 1TUBB 2FWIA 1ZL2A 4DHEA 4F86A 4DR2B 4G0WA 1D2AA 3COYA 2QRPA 2C8JA 1EMDA 4IJVA 2QUBA 5DT2A 1Y1QA 2YFYA 4MO9A 3QH4A 1O5TA 4KI0A 4MW2A 2C5GA 2VDPB 3EGXB 2CLOB 4H15A 3A8TA 4Z7QB 3W4IA 1CR6A 2J41A 3D4IA 3LT0A 2D5AA 4LOHA 2ZULA 3NIDB 2V6IA 4Y30A 3BUSA 5GTDA 2GPJA 2V6GA 4O3FA 4QSMA 1FX1A 4D9EA 4EPXA 1ZAYA 3ZE0B 3LCCA 2VYNA 4MSUA 1TJ3A 2V6MA 1GNTA 4G25A 4JLVA 2XCOA 1CULC 4UATA 4G41A 1Q17A 2XIJA 2Z5GA 3HCNA 3V4OA 1GDTA 1YE8A 2PWPA 4G5XA 4NNJA 3G7NA 3QUBA 1Q3TA 4ASUA 3OKFA 5K6TA 2YY6A 5GJCA 1LSOA 4MHOA 1HQKA 1Z2NX 3ZHXA 2CLCX 1E60A 4TYNA 2BSXA 1RXVA 4D9MA 1XFDA 5ELLA 5A3SA 4PTLA 4X7BA 2X4LA 1OFTA 1EXWA 2O7QA 3HO6A 4CF7A 3UJHA 1UBLS 2EWVA 5BNZA 2XVZA 3KR0A 1IZ0A 4E33A 2OO5A 5E6SA 3WMXA 2UXCB 3BOSA 2OWEA 5CJPA 4A6EA 3HCWA 2H63A 4LJYA 4BN5A 1U90A 4MGZR 3K96A 1FNBA 2AE2A 2P9EA 5FA5A 5C4IA 1NJ8A 1KIFA 4W7IA 1ONOA 4PXAA 2P11A 1PGPA 1SXQA 2LP4Y 3GAZA 1RFGE 2BEVA 2GAOA 3Q72A 5DHQA 1DELA 2G1PA 1E63A 3CPHA 2GYYA 3RRZA 4KLNA 1ZICA 1U0FA 2RHOA 3C1TA 2E5LB 1QORA 3DNFA 3HCBA 3VO9A 3WNQA 2D5LA 1WDWB 2VCHA 4I50F 3FWHA 4TLBA 2V9CA 3M6FA 1NYRA 221PA 4RH1A 5AVJA 3UWMA 2IHVA 1RJFA 3A9RA 1JIXA 3R8CA 1D6JA 3IKJA 3TBKA 4RTRA 2JLYA 1P5HA 3QX7A 3PQEA 4RHXA 5LQUA 3CR7A 1NBHA 1G20A 3G6WA 2BEWA 3DBLA 2GZSA 4Z0TA 4RHTA 3W6ZA 4BOYA 3BIJA 4RMIA 2JGEA 1BXGB 4Q1AA 4DPMA 3EG9A 2FRDA 3F7TA 4YIKA 2HNKA 3LBIA 3OTQA 4MUBA 1KBOA 4BFUA 3BTUA 4HYTA 4OHFA 1NVUQ 1KYQA 3OT1A 5JZOA 3RC8A 1WZCA 2Y93A 2NUTA 1G98A 3B1ZA 4QEKA 4ZT6A 1SKUA 1SNYA 1YRWA 1C0KA 2EEPA 2JD1A 2JIQA 1VSQA 1T5SA 2H1CA 2JBWA 5J9FA 1F6WA 3WIEA 2V65A 1N8TA 2CHEA 4QARA 5JY1A 2N46A 3UAVA 1N5JA 3L0CA 4A8JA 4BO8A 1FYEA 5EQDA 2YKGA 1OH6A 2R6CA 3H9GA 2ZCJA 3R6DA 4AN0A 2EOAA 3LT5A 5DNWA 5KTOA 3FKJA 3R6TA 2O5CA 3RU9A 5KS2A 3WR5A 1XCPA 2GS9A 1IN1A 1H4TA 3CVOA 2RAPA 1HE8B 1Q20A 5K8CA 3ZHBA 3D1VA 3AI2A 2OKGA 4K6MA 3DE7X 1EWYA 2EC5A 1I3LA 3U1VA 3NR2A 1OX4B 4ENRA 3Q8MA 2O7NA 1M2VA 2AMVA 2ZRFA 3PHIA 5CP8A 1J8DA 1V7ZA 3PXDA 3Q11A 1PX2A 5ARCA 2WTXA 3AQIA 3UGTA 4MA0A 1BS9A 1BEUB 2QL5A 4R1PA 4UHJA 1S1CA 2BJVA 3VZBA 4PRLA 3I62A 1CJCA 1V7PC 5ALXA 1NP6A 1GNPA 3ANLA 3GVHA 1QU2A 3LW8A 1OLUA 2FR8A 1KVTA 4WZAE 1O5OA 3ROTA 2PD3A 3FM9A 2H1IA 2JCXA 1ZU5A 3G89A 2ASVA 5JDIA 1XNRB 2BF4A 5KX5B 1P4HA 3I12A 4WGFA 4BLUA 1FDSA 3I05A 4AU1A 1EVIA 2YIMA 4KYVA 4ONEA 1ZBQA 1LDYA 3MBKA 1EX9A 2GJSA 2JLVA 2P30A 4BNKA 1AKWA 3FZQA 5A6VA 2EFDB 1KS2A 2HKIA 3BICA 2CHVA 2D8MA 1CT9A 3B12A 4PS1A 3TE6A 4DBLC 2CT8A 5F21A 3U4AA 1ODIA 1RPNA 1GDDA 2PGNA 2PRYA 4H6PA 3R09A 3BM5A 1CE8B 3VOTA 2EP5A 4M1WA 5HRAA 1B16A