1Y1SA

Crystal structure of the uridine phosphorylase from salmonella typhimurium in complex with uracil and sulfate ion at 2.55a resolution
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
250
structure length
250
Chain Sequence
SDVFHLGLTKNDLQGAQLAIVPGDPERVEKIAALMDKPVKLASHREFTSWRAELDGKAVIVCSTGIGGPSTSIAVEELAQLGIRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASLHFAPMEFPAVADFACTTALVEAAKSIGATTHVGVTASSDTFYPGQERYDTYSGRVVRRFKGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQQEIPNAETMKQTESHAVKIVVEAARRLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Uridine phosphorylase
publication title Crystal Structures of Salmonella Typhimurium Uridine Phosphorylase in Native and Three Complexes Forms - with Uridine, Uracil and Sulfate.
rcsb
source organism Salmonella typhimurium lt2
molecule tags Transferase
total genus 81
structure length 250
sequence length 250
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2004-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1y1sA00
4MCHA 4OF4A 4TYMA 1RFGE 1V41E 4IP0A 3O4VA 2QSUA 1ODKA 3MB8A 3ONVA 4U2KA 3K8QA 3DJFA 5CXQA 2H8GA 1Z36A 4WKBA 1A9RA 3BSFA 1RSZA 1WTAA 5ETJA 4DA0A 2IQ5A 2AI3A 2HRDA 4DA8A 3ENZA 1CG6A 5F76A 1VFNA 4F2PA 3FWPA 3OF3A 1RCTE 4NSNA 3EEIA 4OGLA 4D98A 3GB9A 3FOWA 4OEHA 1ODLA 1PKEA 4M3NA 3OOHA 5F7JA 1Z5PA 1V45E 1OVGA 1U1GA 4WKNA 4BMXA 4R31A 1Y6QA 3OZEA 3UT6A 1K9SA 3DP9A 1ODIA 3SCZA 2XRFA 2QDKA 4TXLA 5K1ZA 1CB0A 1T0UA 1A69A 3DPSA 1K27A 4ECEA 4LZWA 1N3IA 4TXHA 1PR2A 2A0WA 1RR6A 1TD1A 4M1EA 1ECPA 2AI2A 1SJ9A 3BL6A 4OY3A 4GLJA 5B7PA 3TL6A 2ISCA 4DARA 1JYSA 3OZBA 2PGAA 4E1VA 1V4NA 1SD1A 1A9SA 1T8WA 3U40A 1YQUA 4R2XA 4TTAA 3OZCA 4L5CA 1PW7A 4F3KA 2I4TA 3NBQA 4G8JA 1JE1A 4L5AA 3OPVA 4L0MA 2QTTA 4QEZA 4R2WA 5C80A 1SD2A 5FAKA 5CYFA 1Z35A 3KVVA 4D8XA 1A9TA 1PR1A 1Y1TA 5CCDA 1FXUA 1ULBA 3UAWA 1PK9A 4GLFA 2HN9A 3LA8A 1YRYE 1JDVA 1JE0A 3EUEA 2A0YA 4DA7A 4KN5A 4X24A 5F7XA 4M7WA 1ZOSA 4JWTA 4NY1A 4G89A 3NM6B 4QAQA 3IOMA 3FAZA 4YNBA 2QTGA 1B8NA 1PR4A 1T8RA 2P4SA 1RYZA 3ODGA 3T94A 3OZDA 1B8OA 1LVUA 4JOSA 4BN0A 2AC7A 4OJTA 2OC4A 1JDTA 3INYA 3LBAA 1Z33A 3E9ZA 1I80A 3PNPA 3UAZA 1TGVA 1T8YA 2OECA 4H1TA 1PR5A 2AI1A 1A9OA 1VHJA 1OTYA 2GUWA 1JP7A 4BMZA 4LKRA 3EUFA 1OV6A 4G41A 1PK7A 4MARA 1Z5OA 1RT9A 5B7QA 4TXJA 2BSXA 3DF9A 5F73A 1RXSA 2OXFA 4PNPA 5DK6A 4DAOA 1JDSA 4DABA 4BMYA 2A0XA 4UC0A 4D9HA 1SQ6A 4P54A 4EARA 2RJ3A 5CYGA 4I2VA 1OUMA 1Y1SA 4GMHA 1U1DA 1C3XA 1U1FA 4WKOA 5F7OA 4TS9A 4QARA 3LGSA 1V3QE 4TXMA 3F8WA 1Y1RA 4DANA 2OC9A 1M73E 3MMSA 1G2OA 1PWYE 4PR3A 1Z38A 2ON6A 2B94A 1ULAA 1V48A 3PHBE 1ZL2A 4K6OA 1YQQA 3P0EA 3QPBA 5EUBA 1XE3A 3KVYA 4DA6A 5KB3A 5JPCA 1RXYA 4QASA 5CCEA 4RJ2A 1OTXA 4MCIA 4JP5A 1JPVA 1Q1GA 5EPUA 1QE5A 1RXUA 1VMKA 1U1CA 5B7GA 3FUCA 1Z37A 3KUKA 1JDZA 1A9QA 1RXCA 5IU6A 3UAYA 3UAVA 1PBNA 4L5YA 4F3CA 1Y6RA 5I3CA 3NM4A 4F2WA 4D8YA 1TCUA 2I8AA 3KU4A 4WKPA 4TTIA 5CXSA 1TCVA 1NC3A 3PHCA 3E9RA 2Q7OE 1OU4A 3BJEA 4TTJA 3FB1A 5F78A 1T8SA 1NW4A 3K8OE 4LDNA 4L6IA 1ODJA 3OOEA 4D8VA 1PR0A 3OCCA 5F7ZA 4NS1A 5B7NA 5EFOA 1PR6A 1PF7E 4FFSA 1YR3A 3KVRA 4YMLA 2HWUA 3BGSA 4OGKA 4LNHA 3C74A 3E0QA 4GKAA 1VHWA 3PNSA 4DAEA 3GGSA 1K3FA 3DDOA 4WKCA 4F1WA 4QFBA 3KHSA 1JDUA 3D1VA 2HSWA 4TS3A 1LV8A 1Y1QA 3P0FA 4TXNA 1Z34A 1A9PA 3IEXA 4YJKA 1V2HE 3FNQA 5IFKA 1U1EA 2QPLA 1NC1A 1Z39A 4QATA 4EB8A 4LNAA 3UAXA 5F77A 1LX7A 4YO8A 1TGYA 1YBFA 1Z5NA 3NM5A 3EMVA 3O6VA 2A8YA
chains in the Genus database with same CATH superfamily
5J5AA 1HEUA 4IHAA 1RAGA 3P32A 3KJHA 4TYQA 4A27A 1RWBA 3CSUA 4LK3A 5BSFA 1UKVY 2CKMA 4L75A 4AQ7A 1JJVA 3PQ3A 1ADJA 2KX7A 3OJLA 2IBSA 4UXIA 3HL0A 3SY8A 4NV3A 3WNVA 2EWMA 3O4VA 4UXHA 2C2YA 3CRNA 4DIUA 4F11A 3LX4A 1A7UA 2IYAA 3E3AA 3NBZC 2C7QA 4FGZA 3W2IA 2O2CA 3ETHA 2IFTA 3N87A 1C3VA 1QRAA 3K8QA 2OB1A 2L82A 1BRTA 3P9ZA 3QE3A 2X7JA 1Z7EA 1R9GA 3PUHA 3QKIA 5H7XA 2VYVA 1Y8ZA 4F8JA 1K8QA 2O1SA 2WJGA 3C3DA 4IEEA 4WKBA 1KMIY 4WKGA 3TLYA 2O8BA 4DCTA 3S55A 3AKZA 1Q0LA 4I50F 3LX8A 1OAOA 2Z9CA 5L53A 1POXA 1NBMA 3N8NA 1PGOA 5CFPA 2QBYB 3AF2A 5AVVA 2CB9A 2EW2A 3UWDA 5CA0F 3GCGA 4FS3A 4MB2A 5IARA 2Q4RA 4RPJA 1KJQA 3GCXA 1NSFA 2O2GA 1IVSA 3IAS1 2EW1A 4RV5A 3NBUA 4YP7A 4QBHA 3FOAA 5HTKA 2AFHE 2F1JA 3GJQA 3DTYA 4DILA 1UC9A 5IABA 2IQIA 2VYCA 1O9GA 1IOZA 1U2DA 2H9YA 4B2YA 3P96A 2P9TA 4B4KA 1BJTA 3DOEA 2DF8A 4PZUA 3MEQA 4Q93A 1YCGA 3DZBA 1SUCA 2VQSA 2WPDA 1WAMA 1PJCA 2Q2WA 3AM1A 3HTXA 2IK8A 3ENWA 2DX7A 3QHPA 4DG9A 4M3NA 4QBTA 1O5OA 1XXLA 3VNQA 3DE2X 4CI9A 1DADA 4NBUA 1YE8A 1G6HA 2QUIA 1M2OB 2VNIA 3BZUA 1QM5A 1TIPA 3O83A 5P8WA 5JDIA 2BH9A 3I52A 4IUCS 5FXMA 4D4LA 4R31A 4PYJA 1VE3A 4J0GA 5BSEA 3OZ7A 4OHOA 2CHUA 1ODIA 1PNQA 5JCJD 2PXCA 1BVYF 5K0LA 3WLAA 5BUCA 4G0WA 1IONA 4LOIA 1HG0A 1FRNA 1YZUA 3H9CA 4DMCA 3FMVA 1JAYA 4Z86A 5DHAA 4C7BA 1FIUA 1ZUNA 1R4NA 1L5HB 2SKCA 3NIFB 3PHHA 1HDZA 1RYDA 4P0TA 4BWYA 1PJAA 2HH9A 1V9LA 1ZUD1 2IHKA 4AMYA 2QVZX 4MS3B 5BP7A 3S2FA 1GNRA 3IGFA 3TW6A 2RHMA 3JS5A 1LRLA 3LFHA 4N3AA 4YRCA 2H0RA 4MPPA 5DN6D 4E5UA 1VL1A 1LF0A 2O8EB 2B83A 3G2HA 5GONF 5ALDA 3EZ6A 3KLMX 3UXEA 1E2LA 2DHCA 3CUWA 4F3TA 4K6HA 5JZBA 1Z6YA 1IJFA 4ZIRA 2FSSA 2GHRA 1LGYA 4XRGA 4LWPA 5JJKA 5HILA 2V1XA 3PFHA 4YO7A 5HUJA 3W8DA 4F84A 1YRLA 1PGPA 2DWCA 5KVAA 1ML4A 2ZJ2A 3RK0A 4BFXA 4CLXA 5KSWB 3CVWA 2QL9A 3DEZA 3RWMB 4CEJA 4IIFA 3BJIC 5GWXA 3G8YA 3T9AA 4I14A 4KJXA 4IH4A 4URHA 3AB8A 4RKQA 5CVJA 1RRPA 2IUFA 1XTQA 1U3CA 3DZFA 3MB5A 2FSPA 3O8LA 4X00A 3WK7A 1R64A 2NNWB 4I4TB 5IDVA 4DQDA 1E2KA 3LZDA 3ELWA 4OK5A 3DUFB 1CY0A 4V02A 3AUAA 2R7KA 5JRDS 4QYIB 1WY5A 3DONA 1E1QA 3F90A 4L07A 4RPKA 3EFHA 3NZEA 3MIIA 4PZZA 3OX3A 1UMBA 2VHYA 2O1XA 4ZI7A 2RBKA 3V8MA 4Y2JA 4MW0A 4CUKA 3W5SA 5KYKA 2HW8A 4E4RA 1F6BA 3QUTA 3W06A 4LI0A 3FFBA 5CFQA 4EFLA 1UKZA 1HTBA 1RJGA 4RK4A 3B7PA 3D81A 5K3BA 2UU9B 3F9CA 1HMPA 2O6LA 2JFQA 1VGQA 1S2OA 3JAWB 4JC0A 1GZ6A 4RIHA 3VMFA 4ZGBA 1ZIYA 5CYPA 4BRSA 1TKCA 2ZR7A 4LQCA 3TIIA 4TMTA 2Q9UA 2WKSA 3TLEA 5HHTA 3DVAB 1R88A 2MTBA 2VTKA 4JR0A 4LEIA 2RJOA 2Q1WA 2O52A 5FWDA 5THXA 1EESA 4DB4A 2V4UA 3KKMA 1ULBA 4Y1RB 4TRMA 1C30B 1UFVA 1JHDA 2E87A 2PAAA 4LNUA 3UBTA 2HK8A 4OMDA 5JQGB 2AX4A 4YLGA 5AVYA 4K9RA 1A96A 2VP0A 1HDYA 1WEKA 3BA6A 2PSEA 2FKAA 3UK7A 3WLMA 1R8XA 4KQ1A 5FI1B 3X1XA 5I4CA 3IIKA 4GM0A 2ZIXA 3EC1A 3LYAA 4JSTA 3DBRB 3KAQA 4II2A 3AONB 4XSVA 5BXQC 1XDBA 3DXZA 4RK0A 2XGSA 1PDVA 2EFGA 3JD4A 4GC9A 5DM70 4S3MA 1B42A 4BUZA 1N3LA 3EQ2A 4EI7A 4FBLA 4IUBS 4H7HA 4M7WA 4CV1A 1E99A 2OO5C 2X8AA 4LV5B 1FDTA 2AOUA 1WCIA 3IOMA 1G8FA 3FAZA 1AHNA 1W4BA 3STHA 1JXOA 4UVGA 1QSGA 3U9SA 4IIGA 2P1ZA 1T4BA 2JLZA 3IERA 3JYPA 2Q9BA 4BE9A 2DUMA 2IP1A 2XYRA 2P4SA 1INLA 1IHOA 2WOJA 1DKMA 4IRUB 3JZIA 1W73A 1XJ0A 2QTFA 4WFIA 3ZI4A 5B37A 3VX3A 4X7RA 1EWYA 3R0ZA 1FSPA 4B84A 4M1KA 3HJFA 3T99A 1T6BY 4PAGA 5C5CA 2Q3DA 4BNYA 2G04A 1ZK0A 4MWCA 4FUTA 1IQ0A 2NPOA 2C5BA 3H2KA 1NW6A 2CFIA 1YWGO 4W7IA 2DFPA 2UZ0A 3BXHA 3HR8A 1GRNA 2WSSD 3RI3A 5EJ5A 3W5UA 2YW2A 1VP9A 1MV5A 3DNMA 4OHWA 2HUNA 2X5XA 4QPDA 5FO1A 4G4SP 3T34A 5MN6A 2DBVO 3C5VA 3QV1A 4M4SA 4C05A 2G9QA 3ZHTA 3DOIA 4H1TA 3HYCA 3EC7A 2BFOA 3OU2A 4G97A 4NMWA 5B6IA 1JECA 3VISA 2K5UA 4GZ3A 4K9SA 4KFTA 4DCCA 3K4HA 4R1PA 4DS3A 1MLDA 1QONA 3CVOA 3ZDFA 3ZWNA 1AZTA 1J6UA 4BQRA 2ZZNA 4O59O 2OO3A 5AICA 2MSLA 4TLDA 3ZDDA 2QP9X 4FN4A 5G3ZA 4HADA 3T3HA 4LF9B 1C3JA 1NA5A 1YB2A 3SVTA 4J03A 4MAMA 3VYRB 5CVCA 1RRGA 5J1TB 4H6VA 2YWRA 4BLWA 3CNQS 4INOA 5DU2A 4C06A 4ALNA 1EXMA 3CF0A 4IHKA 4DNXA 5IYZF 2DWPA 4S1OA 3N28A 5CW2A 4NYMR 4ETMA 1F9EA 3PPIA 1GRQA 1NPTO 1KR5A 3CNNA 4KAFA 3P2IA 1V16B 1AN0A 5D5QA 3CZ9A 4TS4A 5E4TA 5H4HA 1JQDA 1LDYA 4BNHA 4JT9A 4GPEA 3G2JA 3VOSA 1ULTA 4W9NC 1RLIA 2O2ZA 2O2XA 3PUZA 4I5FA 4L6AA 1SVIA 5C35A 5JI3E 4G84A 5F3WB 1C9KA 1Y1SA 4GMHA 1W8DA 1Z45A 2ZAMA 1C3XA 3EARA 4WKOA 3RVPA 2ONCA 3WLTA 4OH7A 1GFWA 1N33B 3VNAA 3GLFA 4RZHA 4WXYB 5HOEA 1GZHB 2CK3D 4U2GA 5FBHA 4JP8A 1V6CA 3MTGA 1XQVA 1V11A 1V3QE 3RU7A 3ZIDA 1AQNA 2YNMD 2YHAA 1MGPA 4IIBA 3LOQA 2Q8PA 4A0SA 1GPUA 2JLUA 4KVGA 1HUQA 2FZLA 1BXRA 1Y9DA 3I4CA 3L1JA 5ISMA 4O8CA 4OLHA 4LUCA 1PV2A 1O5TA 2GXUA 2M32A 2HMUA 4G63A 2QX6A 4AJNA 4YLYA 2IDZA 3NONA 5BR1A 3K2IA 4M76B 5I5EA 1RDFA 3S0JA 1JNYA 2GUGA 1AHHA 2ZJ3A 3I62A 5CEJA 2XOKA 4RE5A 3FROA 4YQEA 3ZV5A 2GF9A 3FETA 1P33A 1YC2A 3OZAA 1QO0D 5ALTA 2JJ2D 3ILSA 1DRKA 1ZI8A 4KXWA 3RTAA 3LUKA 1M6HA 1MA3A 1HQCA 2OWEA 4AP6A 3FDFA 2AJDA 5DCUA 3D6NB 1E7WA 5H3LA 2ZBEA 3IEVA 1SXHA 1KZGB 4P3KA 2PSHA 3ZDYB 3IPCA 3KYJB 4TTSA 4I5GA 3E3NA 1OI7A 3AB7A 4FNGA 5B58C 4HLDA 2WF5A 5KAPA 1TX4B 2H7YA 1A77A 1B0UA 1RXIA 3A6LA 5IKOA 3AVWA 1SC3A 4EJSB 1Z16A 5LP6A 2UZIR 2GWRA 2W6IA 4XW2A 5C1OA 3BIFA 3DSRA 3O84A 4EFNA 3MIZA 1NUAA 1LFAA 4HB0A 4P8RA 1O4WA 3EYWA 2Q3LA 2HMWA 3HG7A 1V1RA 1WZNA 2HJHA 1DEXA 3OU7A 3NBFA 5LZ9A 2DVMA 3MERA 2F1RA 2R6JA 4MUXA 2BIFA 3FRIA 4M89A 1QP4A 3K6SA 3COSA 1DBWA 8MHTA 3A1UA 2GMWA 5DFAA 1YRHA 3L7NA 3NP7A 4YHBA 3GEIA 3NVMB 4ITUA 3TR5A 4AF6A 3M6MD 4A8TA 5JDCA 3T1OA 2JGLA 4W99A 2FP3A 2FWIA 3RUCA 3PQEA 4Y6LA 3ZY3A 4B3FX 4QEKA 4EDFA 1TJPB 4UUPA 3VOAA 1JFLA 3V32A 3L1HA 1A9QA 2VYVD 1VGVA 2IPOA 2Y6VA 1W25A 3ACBA 5BV1A 5LQMA 1KBZA 2XRZA 4ZYZA 1GV0A 1UFOA 1ZW1A 1J0BA 4P2GA 5CB8A 4AWXA 2UYOA 2FW7A 5DYNA 1AQUA 3SBEA 1OOEA 4EOGA 3IPRA 3LGAA 3RC1A 3ZGNA 4YJHA 5I3CA 1E6UA 2IXAA 1NBMD 4DLKA 1J2YA 2XMQA 3OJEA 1W5FA 2EYUA 2DPGA 2NVWA 3D3WB 1ODSA 3DDHA 4PGFA 4PU0A 1VPEA 4CODB 4MS4B 1E8MA 1UK7A 3HSKA 3QF4A 1XLTA 2EKPA 4V0LA 5I9IA 1CUDA 4R0MA 3LK6A 4JLDA 1GFIA 1I0IA 5KTKA 1AY0A 2YFYA 4CKBB 2P41A 1XZFA 1OFGA 1RI1A 3HKDA 3X43A 3KU4A 4YBZA 4B33A 3AVVA 4KXFB 1EX1A 3HWRA 5B6PA 4YT2A 5AM2A 5A3VA 3V1TC 2D1FA 2O0KA 3R23A 4UAJA 4CDMA 4FS8A 1PUJA 3PHCA 4Q7LA 4FZVA 2O07A 2WPDD 3BDVA 3OIGA 4HNGA 3D0OA 5KSPA 4EH1A 5FI5A 5GAJA 4AQYB 4BNTA 2BH2A 5F78A 3MN1A 2E6UX 2GN1A 3R7DA 2JIMA 1IBCA 2VK1A 3I6BA 5DLEA 3V8PA 2B8NA 2HA0A 1G9TA 1UPTA 3QPCA 1I7QB 2UXDB 2CMFA 3NOXA 2UZ3A 5EQJB 1QGYA 2ENUA 3ILXA 1NVEA 1I5OA 4GWKA 3BWVA 4RIIA 5DNDA 3OWOA 2F8TA 4G0PA 4C0XA 5HRUA 2YVQA 2GEKA 3OMLA 1I8TA 3UHJA 2QRVB 3OTGA 4ZO8A 4ALKA 4XOUA 4B9EA 3A4TA 5IN4A 3GCZA 1WQ4A 1Q0TA 1KVUA 1O6ZA 1V7PC 3V2HA 2O4UX 3U0VA 3VZQA 1E1LA 1XTRA 2V7GA 4J2TA 4DUPA 2Y3IA 1OFUX 3K09C 4M7OA 4RQUA 1WZ2A 4A6DA 3QPUA 2J0QA 3MQFA 5B6JA 3B6MA 4GDFA 2CYCA 4MRMB 5PNTA 3R40A 5AHRA 1KK2A 2BTEA 1STOA 3LZ6A 4BB6A 2PWPA 4IOMA 3DO8A 1W2HA 5TEWA 4ZICA 1K3FA 3E4DA 3R5TA 1FFYA 1RCFA 4HN2A 3ZLVA 4ZCMA 5LIPA 1WXXA 1F38A 2E55A 4OYYA 2RGNC 4LJ7A 4CCWA 4ZC1A 1ISSA 1GNPA 2FUCA 1X42A 1Z6XA 2NWQA 3CM0A 1GLGA 1Z18A 1XQ9A 2ANBA 1GUAA 2L0XA 2Y4NA 3IPXA 3NLLA 4OMCA 4RD2A 4DJTA 2WHPA 2VSOA 4ZD6A 1O54A 2QL5A 1DC3A 2XUQA 5AOVA 1QYDA 5IULC 5EIHA 2VZ0A 4LSWA 2BI4A 3VBEA 3OQBA 4JLMA 5IAGA 1AK1A 3BD9A 2EJBA 3E70C 4PIVA 3VC1A 5KJCA 5KOHB 3DDZX 1KZ6A 2HOQA 3LSTA 5ALFA 3K16A 4EVIA 5FH9A 1GD1O 1TYZA 4EUFA 2JCSA 3CIOA 2O8DB 1ZA1A 1E1QD 4YJ2A 4QTYA 3E81A 3SNHA 4Q03A 4ER7A 1KR2A 1GAQA 1L4EA 1VLQA 4WT7A 4R7TA 3QELA 5IJAA 5TNXA 2P4HX 5E2BA 2WM3A 1XRJA 1JT9A 1U8UA 4JHXA 4ZQGA 4XI9A 4CV2A 1FA9A 1ELOA 3IQIX 1BD3A 2NZ8A 1X7HA 5DB4A 4BFCA 4L50A 1KK3A 5TR9A 3CEMA 1KFEB 4ZQCB 8ADHA 1TQ6A 2ID9A 4IFEA 4RESA 3AM4A 3C1TA 3R2JA 3PGKA 2XECA 1XDSA 2AMLA 3AF5A 1V6SA 4ZI7F 5H3CA 2FZVA 3AEKB 3SR3A 1RJWA 3M7IA 2BMWA 4HWGA 1YF3A 4M1OA 4EY7A 1IMJA 3CKKA 4II3A 1NUUA 5SY9A 4LBWA 3FIJA 5BUQA 1YSCA 1OBOA 1N4DA 1UJ2A 2JCYA 2ZKIA 4LVOA 4PAOA 1HE3A 3S70A 3IMCA 3WJAA 2V9ZA 2VPIA 3N8DA 3P5SA 4FSXA 4GIBA 3F98A 5BWNA 2H6EA 2A57A 3A27A 3QVJA 4HTFA 1T34A 2QR3A 2BM1A 4V2IA 1OY1A 3E1KA 3TYXA 2IH5A 4Q48A 2NV6A 3WBKA 3F2VA 4HC4A 5C7LO 5BXYA 2BWJA 4LYYA 3KSZO 2ZYWX 2MIIA 1Y34E 1IVNA 2ZSBA 3PPWA 4B43A 2GVZC 3CWQA 1V0JA 3RH0A 1G8JA 3L9XA 3AESA 2WYUA 4FB4A 2C9MA 2QZSA 4BMCA 1JSXA 1QQAA 1JLLB 5D6OA 3DMPA 3AKDA 2HRDA 4IIEA 4Q7MB 4JX9A 4RIGA 2OYSA 3J81A 1Z4NA 5H59A 1MUUA 1RWQA 3OKPA 1YBVA 5EZYF 4DSZA 3G9ZA 2J9FA 5TT1A 1YO6A 2Q3CA 3CF6R 4BKPA 1NI4B 2XUHA 2XMSA 3BGOS 4WXRA 3MWEB 1SURA 1IHPA 3QKTA 4D98A 4JR2A 2RGXA 3B38A 4J0HA 1B15A 4FE3A 2I54A 5CT9A 1OV4A 1NONA 3ZCRA 4BVFA 1W2WB 3E61A 4MVJM 1OVMA 3AR4A 1NYTA 2BUBA 3FH0A 4RJIA 4YRLA 5B7QA 1CV2A 2JNWA 4MP8A 2AFHA 4X54A 2ZI6A 3NNSA 1ISFA 2OG1A 2OHXA 1LWNA 3CZQA 3N59A 2WILA 3GA0A 1OA1A 1YU9A 1XPJA 2R8YA 4W5HA 2TSYB 1NBIA 2ESRA 1V45E 2FRXA 3BD6A 3CINA 3I9V1 2OLJA 4GX2A 1GSAA 1GU0A 1ZUIA 2AN5A 2D1QA 2J32A 2NU6B 2BFBB 3ETJA 3IP6A 2JG3A 4C76A 4KRYA 2D2FA 4N7MA 3UMMA 3ZWBA 3L7IA 4Y67A 2AEJA 2P27A 4IF4A 3JQ7B 4NEGA 4DLWA 4MRSA 1A3CA 2GB4A 3IT1A 4YRTA 3CGWA 1K6EA 5JW6A 3PD0A 3HBNA 3STXA 2AOTA 1U0FA 3GNQA 2C4TA 1ZD2P 3HP7A 3V6MA 2WIJA 5LMUB 16PKA 4WOJA 1MO5A 4M99A 4U7TB 3T3PB 2I9KA 2F7SA 1M72A 1VG8A 5C51B 4AY5A 3VNRA 3IR7A 5A9RA 3NGMA 2C99A 5CURA 5BRJA 3TD2A 1QOQB 3ABSB 4N6OA 1GTVA 4Q9DA 1LBTA 4HS9A 4LGVA 1SO8A 2EWVA 5I51A 4O2BB 4LKOA 1YI0A 1FTQA 1U98A 2DCUA 4JA2A 3WVNA 2HA5A 3BFJA 1K6IA 3CLKA 3DV9A 4EFKA 3ESBA 5AK6A 3MTAA 3BIWA 3NHFA 1C1HA 2VYNA 3DEAA 3G13A 3QV2A 4MV6A 4S24A 1UP4A 2YQ5A 2XVXA 1HDEA 3HUDA 4WNAA 3SJCA 3TLZA 4REMA 4B1FA 3VYUB 1QH8A 4AMVA 2ZRPA 3TPZA 1LI7A 1NOKA 1SD1A 1TA9A 1XJQA 1EK5A 2YJTD 1GNQA 1Q92A 3OJCA 3A31A 1AB5A 3LIPA 4FQ8A 1N1MA 2NZVG 5M29A 4OP3A 4DKJA 4YACA 1IQPA 4C89A 4GFDA 3ADCA 3T3IA 1ZRMA 3HFSA 2PCJA 5LL6P 3EVZA 3A10A 2E1PA 1Q0HA 2CLIB 1FFCA 1LLUA 2XWBF 2D5CA 1T36B 5J2TB 4GUAA 1Z75A 1GDTA 1GU1A 1ULSA 1E3WA 2O9JA 4UBOA 3VR5H 1IN4A 3EG5A 2IVZA 3KB8A 2W7TA 3D6FA 1PJ3A 4ISBA 3T9CA 1S5PA 1KDZA 4F6RA 4ZJYA 4UOQA 2HSZA 5ALEA 1GGJA 1U9IC 3U16A 1Z35A 2CCGA 2KM1A 2GYVA 4X6LA 1PR1A 4HXEB 5LBUA 1QTQA 4F04A 1UMKA 2XOKD 3DJYA 5D01A 1TPZA 2CW5A 2XXJA 1Z0AA 4AY6A 4AG6A 2HJGA 2OAQ1 1JF8A 3D2AA 4C2UA 2BDUA 1DIHA 1JQKA 3QM1A 1PK9A 3L7DA 5DWVA 3N2KA 3GGOA 1J8VA 2NGRA 1IPFA 4F6CA 4B82A 3OM0A 2HN9A 2BHLA 4RK1A 3TJMA 2OD9A 4UEKA 5HIKA 4OFBA 3BRCA 1JPNA 3OPYA 2YBEA 3L82B 4LECA 1YRYE 1L3BA 2FE4A 4BX0A 5CLFA 3IEMA 1EP9A 1I32A 3CUEF 1J42A 4YJFA 4U7HA 4ZJPA 4N76A 1FMCA 2ONYA 3BB4A 3L7JA 3MS2A 3L7AA 4XSHA 3EB9A 4P0PB 5DT2A 1EEHA 3CZ4A 3W04A 2W6ID 3TQSA 1YRQA 3EAGA 3H3FA 1FPQA 2BYTA 4KIFA 1DQNA 1KY4A 4BJ3A 4F93B 2IYLD 1QYIA 2RKOA 3OQNA 2R3SA 4O4HF 4XEHA 5T5QA 3WP1B 5AUOB 4REQB 1QIFA 1UKCA 3L8FA 4MWZA 5HX7A 4YNBA 1TEHA 4C21A 2AJCA 2PKRA 4XB6B 4C03A 3W5CA 1ZOLA 3I9LA 4PAMA 1ZEMA 1B2LA 3DHYA 2AOVA 4RORA 2J48A 1WCWA 2V58A 1LDNA 2WOOA 1KMNA 1YQTA 5JRZA 2YRWA 3LRXA 5LP6F 4MDFA 4ZYTA 2IXTA 3OZDA 2JCGA 4D9CA 4EYGA 1XQ6A 3LBHA 3L8DA 4LXXA 4HNSA 4PQEA 4G2TA 4QECA 3RRZA 1BMDA 1JKIA 2CCJA 2VOJA 2ZB2A 3C3JA 3NIWA 4PG4A 5AI6A 3VR5A 1ZFNA 2MYTA 4AS1A 1QK3A 2BJHA 4QBGB 1U2GA 3NHJA 1HE1C 1A95A 4LGYA 3PR2B 3KT3A 1C0PA 4KBYA 3HV0A 2Q4DA 2WFLB 3VOBA 3I73A 3Q5GA 5FHQA 5D84A 2FMKA 4LZJA 2CXPA 2ZVDA 2X23A 4PC7A 4LE0A 4MHSA 4QJ4A 3ZDBA 4C30A 1AM4D 3FCCA 5DW0A 3OIDA 3PUYA 1HFJA 3HCAA 5JNTA 1ZSVA 2QRGA 1YB1A 2VF2A 1JWBB 3HVKA 4UE2A 1T9DA 2DSTA 5CM2Z 4DBLC 1N8TA 4G85A 5G53C 3RYHA 3UAZA 3V00A 4BEJA 2Z8YM 4Q3AA 5EZ6B 2PUDA 1G5QA 4B6RA 3E82A 4BQNA 1DKQA 1ZJWA 1LH0A 1N78A 2J4DA 2R7MA 5HE9A 3V42A 5KDDA 3OLWA 4MUBA 4YDSA 1AE1A 3H17A 2IC5A 4JA0A 4GC5A 3PXAA 4JUDX 3UXHA 3P9CA 3S2GA 2CV1A 1QTIA 4RF2A 2RI0A 3I9V6 4EHBA 1D4OA 1Q22A 3MMXA 3UGTA 5EP2A 5LM3A 1EFPB 3UZUA 1OV6A 3DE1X 2F4VB 2QI9C 4H0CA 3EDRA 5E4YA 3JQBC 5FBQB 5IHXA 1F8YA 5KYUB 4PG6A 1T1GA 1ORHA 1CXZA 2QS9A 2Q2NA 3O2JA 4MH0R 3RIXA 3LDFA 5ALVA 1EFLA 1RC0A 2QT0A 3WRYA 2G40A 2PTHA 4CNQA 4F5WA 2WD8A 4QUAA 2LD4A 2F4NA 4B75A 1JDBC 3O2SB 1UM8A 1NZJA 3NIDB 4JP1A 3UCFA 4B6SA 1SUBA 2Z6UA 2YNMC 3F3SA 5IPFA 2O5CA 3HU5A 4OSEA 3MTIA 1H2WA 4NMHA 1RYYA 4LRSB 1KYWA 3AR6A 5A3SA 2JGRA 4KPFC 4YR7A 2PG3A 3GDHA 4JNKA 1JFRA 4RF5A 2K7FA 1IBMB 5AVQA 3ZD8A 3Q2IA 2VXCA 3PA8A 5DGDA 2D1YA 3PP8A 3UV7A 2VDRB 4Z8YA 3H75A 2BOVA 3OJWA 1XTUA 2GM4A 1KYVA 3VU0A 4IDOA 2J9GA 3MTQA 5KYNA 4WOPA 4KWEA 4JLWA 4WLUA 3LGSA 2Y9PB 1F0KA 5BW5A 2WUGA 7MHTA 3TRHA 4UFNA 4ICIA 3QUCA 4G5OA 4ENSA 4A82A 3MXTA 2BPOA 3OQHA 2VVTA 1H2XA 2GKGA 3V1YA 4BRUA 4E5DA 721PA 2RE8A 2O54A 1MJGM 4K5QA 4IZHA 4YMHA 1A5TA 2X9QA 5IBPA 3BXGA 4EG3A 4YRZA 4AJOA 1Z2AA 2IOYA 1Y63A 2MINA 5DNVA 4E94A 3AETB 1DDOA 1RYFA 1XRRA 4LPKA 1JPUA 2NN3C 5HIIA 4HAIA 5TGZA 3LC1O 1VL0A 1X1TA 3CX8A 5JH7F 3WP0A 5JT1A 1Q2XA 4E32A 2V98A 5DM2A 4DPMA 1I5RA 3UJ9A 1QRRA 3O74A 1GZ3A 3SYTA 1KC3A 1FFDA 2TMKA 4U9HS 1X3SA 1QCCA 5K5EA 4JCCA 5FPPA 3VOTA 1FRFS 4GUDA 4CKXA 1F0YA 3AJAA 1CYDA 4EAQA 1IVYA 4XGIA 3TE7A 3LQ2A 1XE3A 1MVNA 2LKCA 5DTEA 1ZQ9A 2WHQA 3BMNB 2RHGB 2X5JO 2JHGA 3FW1A 3IT2A 4OLBA 3C6XA 5AIBA 4Y9SA 2XQJA 1OKKD 2W6NA 1OZGA 3V3KA 3ETGA 2LW7A 1NXQA 3OETA 2VDWA 2P67A 1SEVA 1GDDA 4PC6A 2DT5A 4YJGB 4A03A 1RJFA 2NUBA 2FY8A 4TMWA 3TTVA 4DREA 5K4AA 3C0KA 4UNPA 2G5GX 3AM3A 5T4BA 1NLFA 4HVCA 4OGGA 1AF4A 5F1YA 1OAOC 3OOJA 2EX4A 2V7BA 3O0DA 3PE6A 4M22A 3UKOA 2OZEA 3NVDA 4Z9YA 1ETHA 3RYIA 1UDCA 3EGOA 2Q4BA 4M8SA 2AFVA 2IIQA 5BNIA 3NKFA 4WRRA 5BW6B 3JAMA 4HRXA 4L5IA 1W19A 3IVXA 1M6NA 3T54A 4PCLA 6CHYA 2BEJA 1ZLXA 3M1LA 4LYFA 4K6MA 4QGGA 4Q1VA 3Q7QA 4A0RA 3M6LA 4LYAA 4MIEA 2R8BA 1C9MA 1U2DC 4OGFA 1P4RA 5ENVA 2W00A 2QYSA 5TPWA 2LR0A 4ZYXA 5AVSA 1DIRA 2CZQA 4Z9AA 5IMSA 2G17A 2W2KB 4AKSA 2AKAB 3W7BA 3SDSA 1OX6A 1PL7A 1F06A 4N01A 3EGIA 4IWNA 3LF2A 3VPXA 4QT0A 2GXAA 5AKXA 4TQGA 4DRXB 2ZATA 2XQKA 4CJXA 2J33A 5AVXA 4CCAA 3MPOA 3ZD9A 2E9SA 1VOTA 4ATNA 4BNIA 2NP6A 4OL9A 2Q5HA 5JDIC 5FL3A 4L0DA 1XRQA 4RVCA 2ECOA 2OPBA 1UPBA 2XI4A 4H31A 5I4IA 4MROA 2YHBA 3WYBA 4J6FA 1X77A 2NO5A 4P38A 1I7LA 2DJ5A 2QSZA 4UVIA 3K9HA 3ROEA 5K7SA 1N5DA 4NBTA 3H6HA 1Q17A 3GLRA 1OU4A 3TK1A 5AVTA 5JO0A 1CPYA 2GDZA 4Q1AA 4LRWA 1RRFA 1V7QA 3A9CA 4GKVA 4RM3A 4NR0A 4U8HA 3IBYA 1ECCA 3G89A 4ZP1A 4B46A 4E09A 4E5KA 5A5VA 4I99A 5A71A 1G59A 5D7BA 3S28A 4TZTA 3BILA 5IRCD 2PX3A 2X4IA 4IMPA 1EFCA 5AHWA 2A5FA 3GJYA 3FDJA 4EYKA 4IIHA 1OZFA 3H3XA 3PWZA 5HIMA 2HR1A 2A1TR 1WEHA 4CF4A 3AV0B 5FTJA 1H2RS 4FZ3A 4JY7A 3EGEA 4TSRA 3M4XA 5FJIA 3V2IA 4AC9A 2R8PA 4ARSA 4HUTA 2PVPA 4RF3A 4XLTA 3L8GA 2EL9A 1B8VA 4UASA 2PGLA 1ULUA 4JLAA 5EFOA 3FTNA 4IGAA 4D3FA 5CDGA 3UWOA 4FD2A 3DLAA 3KVRA 3UJCA 4AJKA 5BN3B 4YMLA 2RHDA 2PL5A 3DG9A 2HWUA 2CN1A 2EKQA 3Q3JB 3LV8A 1KARA 3NYQA 2I03A 1DJPA 2VTVA 2WUDA 1GCOA 3AXTA 3HJAA 1RJDA 5C8DA 2IZOA 1TPYA 2UAGA 3H9BA 3P5BA 2G5TA 2QUBA 4KO3S 1XZAA 3I6YA 4CFYA 4F0JA 3PI7A 3RYCA 2HA2A 3QFSA 4YALA 1T4MA 3CH7A 3IOYA 4M1QA 4JOBA 3AX6A 1XMOB 3J81k 3ITDA 5BR8B 1JB1A 4RTNA 1C50A 3JW8A 4IWYA 1IU9A 3K1ZA 1B16A 3A25A 2H29A 4FOLA 3CG4A 1AV6A 3OPNA 2Y76A 4XVHA 4DUYB 3N1UA 3FDZA 4AG5A 3PF8A 3RVKA 1VFPA 2VYND 4KYVA 2PLAA 3TMKA 3QITA 3SHTA 4EJ2A 1QGUB 3KEFA 4QUDA 1CUIA 1PL6A 5GINE 1VP3A 4KE8A 4UTOA 5G0WA 1KY2A 4XUEA 3KLPX 5CLJA 2BFCA 3K8ZA 3L7BA 4HBGA 2PMBA 2FK8A 1RACA 3MOGA 2B0CA 4NDAA 4N8DA 3UMYA 1OGJA 3U56A 4RPIA 1OLXA 4BXOB 1HWYA 1WXEA 4CM3A 2GKOA 3HRIA 3TD6A 2AQKA 4BQFA 4MLDA 5KSYA 4YN3A 5DBFA 4IGEA 3RE1A 4RZSA 4J3FA 4FFBA 4BP8A 3JU3A 4GNKA 2V8BA 4GZ5A 3UAXA 5DBGA 1EBUA 5LYJA 2NVUB 4DMRA 5C7OO 3R44A 3TCXB 4F12A 4XPIB 2LCIA 1C9YA 4GI7A 1EK6A 5EGNA 1P31A 3C87A 1KI4A 1J2RA 2REOA 1R3UA 4K46A 2O5VA 5HQTA 3K0FB 5C8YB 1J07A 1H5UA 4K7JA 4PIMA 3VKWA 2DETA 5FD8A 1F2VA 4L9SA 2MWMA 1XPUA 2WWIA 1EXNA 1RCUA 2M98A 2GCOB 1P4GA 3VC3A 3WL7A 3E3OA 1ZM2A 4ND8A 3DHVA 4YV7A 1VZ3A 4EMSA 3DZIA 5K51A 3WMFA 1UANA 1VA5A 1Y7PA 2YQZA 3KXDA 4I9HA 4LSGA 4U2KA 1JKFA 1I2AA 3JVUA 1VBMA 4GMGA 3WWOA 3PEYA 4PG8A 1BMQA 1TM1E 4DADA 1L7MA 4B32A 1YGYA 1DRJA 1Z4QA 3M1IA 2FEWB 1XAJA 5EKSA 3RVRA 3L06A 4GL4A 4ARZA 4ZMRA 2C9ZA 4L28A 2VSFA 4DYDA 1JVNA 1JSCA 1GPMA 5AKIA 1VMEA 4D9FA 1E64A 4RFSB 1QS0A 5KDLA 3SWWA 3PQ2A 4DR1B 4OQNA 3EJWA 3AC0A 2G07A 2P1RA 4NTZA 4BEVA 1SFRA 3M4ZA 4IAOA 3FWPA 5F64A 3B6ZA 5I7RA 1YCDA 1E62A 1V37A 1QNLA 3PKJA 4IV5A 2GZ2A 4PYQA 3WLNA 3B1JA 3VR5D 1EBBA 1QIEA 3O91A 1BDJA 2FMHA 5G1OA 4YRDA 5CHYA 1H3NA 2V4ZA 3DGFC 2WP0A 3PV0A 1EFAA 1NHWA 5DEIA 1UDBA 1NX6A 1Q7CA 3GX1A 1HNNA 2WJ4A 4P4SB 5KOIA 4F6LA 4XE5A 1QKIA 3RU3A 3U4MA 3RADC 1DRUA 1M2FA 1RMTA 1VRCA 2OQIA 3O8QB 4GF5A 3KVOA 5EJFA 2X40A 3WSTA 3QE2A 4HNUA 3L1KA 1JG4A 1JJAA 2FG5A 1YB4A 1IATA 3MOSA 4LTMA 4R1MA 1LSJA 1IHYA 3R3XA 1B3RA 1N1DA 3R4CA 1VJDA 5HCNA 3UJ7A 2AEMA 3QOWA 3PPVA 2VCYA 3X0DA 2JFYA 3L46A 2AE1A 1WDTA 2IYXA 4NPHA 2QHXA 5FA8A 4EMUA 3CZCA 2QORA 5D86A 3P0HA 2JAPA 3CXUA 5CDUA 4X5OA 2J3HA 4DWWA 3ZJ5A 2E6KA 1K6XA 3H2GA 4BGIA 1EI9A 3WB0A 4MDEA 4M0CA 4CZ2A 2ZYRA 1T0UA 2GDJA 3I2FA 1AKNA 1T3SA 3A8TA 1CIVA 3M3HA 4HDMB 2SCUA 1GGKA 4ECEA 4D42A 1Y3DE 2O8BB 2GM5A 1U7TA 2Q1XA 3CEJA 1KWKA 1XMIA 2ZRIA 3LUJA 5HJ5A 2AS0A 5D3KA 1ODCA 4JLNA 1TKBA 1Y7HA 5CVUA 3ZE8A 1VCOA 1G7CA 4I08A 2EZ9A 1QOPB 2W93A 2ZSFA 5TJHA 4RD6A 2HT6A 4FOOA 3C6KA 3ZK8A 4YB8A 1KNXA 2O2JA 2H4ZA 2RI6A 3A2LA 1Q6YA 1TDJA 3AJ8A 1BOFA 1FUUA 1MAWA 4RDCA 4BO4A 5BNTA 3KB6A 2O50A 4UPVA 1WUKS 4R5MA 5ENDA 1ENOA 2YVKA 4GLJA 1XJCA 3MTDA 3Q85A 2A5JA 2G71A 3R6DA 3FNEA 2QJOA 3MWLA 3ADPA 1C1DA 1XZMA 1T9CA 1UXKA 3IUSA 3WLQA 3P27A 4DLUA 4YREA 4K0RA 1MOPA 2JIOA 2H59A 4JB8A 3OURA 1C8KA 2QNRA 2FFQA 2VPYA 1F60A 3WK6A 1R0YA 4C2BA 5KTTA 3JASB 3HCBA 3LQ1A 3OZCA 3DT6A 4GEGA 1S96A 3UC9A 1IY2A 1M7BA 1RLTA 3CV3A 4MV7A 4X1KB 4XX0B 2XTJA 2X15A 3DXFA 1L7BA 1LPPA 1P61B 1SQ0A 2XCIA 3MSCA 3IEIA 4FIZA 3V9PA 1C4WA 2QTTA 3B3FA 3ONFA 1PQPA 3WGGA 3FYUA 4JXZA 5K6AA 1XDWA 3RM3A 1Z8HA 2PUTA 3GVIA 3PFGA 4X85A 2H0AA 2QRJA 3R7BA 4B4WA 5FUMA 2HRRA 1XLVA 1R6UA 3TNLA 1NVXQ 1PWZA 2H4JA 4B80A 4CMEA 1TK3A 1S8FA 1KFCB 1YJ5A 4PG7A 3BK2A 4X1YB 4F21A 5LP6C 4BBAA 2F8MA 5B3KA 1YDGA 2C2GA 4MUMA 5C3MA 4WIAA 1NWHA 3LBYA 1XXHE 2HLPA 4HYTA 4FB5A 1Y4AE 3IXQA 5KJFA 4WVLA 5JS6A 2P2NA 5THKA 4HB2A 1WXHA 3C1UA 1FNBA 3JCZA 1SC1A 3REFA 2YHUA 4C4AA 1G21A 2ZBQA 3ISVA 3V1NA 2C20A 2F9MA 5A9SB 1FLAA 3RRBA 1PR9A 5DCLA 4E5SA 2EXXA 2CCKA 4DCGA 4EW6A 5JDCC 1ZGHA 1XMSA 5KBYA 3JQGA 4D25A 3LHIA 1AX9A 3IHWA 4Q1EA 3D1LA 4XFJA 1JNXX 2AX3A 2Z8XA 4I5DA 5DBEX 5FA6A 1TCAA 1CUSA 1JVSA 3Q87B 1E7MA 1ESNA 2AOXA 5AM4A 2W6MA 3F6BX 1IB0A 2PUWA 2AR7A 2O2YA 1KEPA 2X0FA 3RUPA 1L4LA 5BWOA 3PVCA 1PSWA 4PZYA 5JAQA 4XFKA 3TZBA 1O0CA 1RWKA 1C1YA 4XD2A 4MVJE 4NJOA 1QF7A 4HUQB 2DKFA 3ZUGA 2YV1A 1LBIA 1Q7GA 1W47A 1XLTC 1ZQ1A 3LBFA 1Y80A 3THRA 2I1QA 1QCDA 3T94A 3QPAA 2ZTSA 1KHTA 3BXFA 2ZIGA 3IPLA 4BNZA 3PUXA 1N6LA 1BFDA 3BTVA 4DEYA 2PO5A 4TRNA 3HQ4O 2GRJA 2WWXA 1U2QA 4YFVA 3LG2A 3HBJA 3WYAA 5KO2A 1NOIA 1ICIA 1LQ2A 4RTPA 1GQQA 3MUEA 1WSAA 1XVVA 2B20A 2G28A 2HLHA 2RBGA 1KRHA 2X9VA 3CR7A 4J7AA 4WZZA 3R0QA 5CBPA 2AHOA 2K7ZA 3A3PA 2ASEA 5CVDA 3RD5A 3KXLA 4FFRA 3U7EB 3WFIA 3EDYA 1CYEA 4U2EA 1XQWA 4S1WA 2FF7A 4AAYA 3TGPA 4M9RA 3LKDA 1I36A 2VJMA 3DV0B 1SA0B 2QVBA 3MSXA 4UMFA 2PSJA 1FYEA 1TK2A 3HVIA 2J4FA 1N0HA 2EJVA 1TADA 1CX9B 2PQMA 4WN3A 4OOFA 4C4OA 5I8WA 4BTEA 2FR1A 4C2TA 1TYBE 1YZLA 1U0SY 3V4RA 3E27A 1MO4A 1OTYA 4PONA 5L4LA 2ONJA 1W6UA 2RHWA 2FP4B 2FETA 1BS1A 1CJSA 4GH5A 4X97A 3ZH9B 2QB5A 2QX9A 3MHPA 3DVLA 1XI2A 2EGGA 3KO8A 5ALZA 4FMDF 1DRWA 1HBJA 1RI2A 5CNIA 4BC0A 2OVBA 2ZP1A 4GT1A 3LLSA 5P21A 4ANFA 3DEYX 1LPBB 1NR5A 4RA9A 3AJ9A 1JB9A 4BJHB 3L4EA 5JJCA 3V7FA 4I5IA 2ID4A 2ACWA 5F73A 3ESRA 3WKAA 1ZINA 4JL8A 4D97A 1EXDA 1OFTA 5T6BA 2RB4A 4EBBA 3LCJA 3L7LA 3ORYA 1GNLA 1VB5A 1TFUA 4GOOD 2IIVA 3B78A 4F4HA 3UTCA 3CX6A 1E98A 3I9OA 3V4VB 5KEIA 3KQLA 2CHVA 4QREA 2OQVA 3WAKA 1Y33E 3CB4A 3GLGB 3ZXSA 4EARA 4JV5B 4Q1BA 1TZJA 1E1MA 3HJGA 1DXHA 1A8QA 2ZBPA 3ED5A 4FC6A 4YJ3B 3PR1A 5IJ9B 4TLCA 1ZHFA 3QWIA 4JMPA 3RTDA 1K2WA 3ZWMA 1REQB 4G4SO 1GTRA 2O3UA 3JZAA 4PX2A 5LOVA 5BV7A 3IAM1 3UT5A 2QL7A 3PFFA 2JARA 2OHVA 1E2NA 2JEZA 2P4UA 4HLUA 1Y7IA 2JGAA 4HZGA 4IOJA 4UD2A 1Z2PX 5DGXA 4D26A 4P93A 4YXWA 1I33A 4BFLA 5KYYA 1LNQA 1M8KA 4FDVA 4KE6A 1WMDA 5I4BA 8OHMA 1XGKA 2E4UA 4EI8A 1TAQA 1M73E 2XUPA 3MMSA 1EM8A 1ZCBA 3D6VA 4DPLA 1ORIA 5KTOA 5BUSA 2YL2A 3Q9UA 3T4UA 4FGWA 2XCOA 5FEUA 1TCBA 1C41A 1M1YB 4AX8A 1GUYA 4EFMA 2BR4A 3FTFA 1V96A 4Q82A 4WFKA 1SCUB 1FBNA 2PKEA 4NYIQ 1V43A 3EXIB 1TZKA 3AERA 4LF8B 2EEZA 3D6UA 2GILA 2EDAA 2NZXA 3O4RA 1SELA 5CVVA 4ASUA 1WPRA 4E22A 1T13A 5ABPA 2YCBA 5EUBA 3ZWCA 4YP0A 1F8UA 2V7QA 5JPCA 2A5DA 4W1QA 1CQJB 1H2ZA 2R6CA 4LWZA 2X0DA 3KZXA 2ZIFA 7ADHA 4DR6B 3H1AA 3TB4A 4B3BA 4KPGA 2AEEA 4ZKDA 3FPBA 2I3BA 4OM7A 1NW7A 4JP5A 1GGFA 1ZVVA 4IIJF 3JQQA 1FX0B 2CL6X 4QFDA 4UE6A 3N2YA 2ZUTA 3PXGA 2FMXA 3R0VA 4JYZA 2Z5LA 1X92A 3AEUA 4M36A 1H9CA 2NO6A 1CNEA 2VT2A 3JZFA 3TIGA 3AR5A 4NPCA 2Y77A 1PJ2A 4K9MA 4B0OA 2OESA 2QD2A 4ZZ0A 2OORA 1NZDA 3RASA 4Z3KA 3LPMA 3HYNA 4NV0A 3TE6A 2Y71A 1WMFA 1E1CB 3IHTA 4LJ5A 2AZDA 2AB0A 3K35A 2FPKA 2D0IA 4ER5A 1X14A 1WDMA 5AM5A 1QYWA 3HZRA 3DE0X 2HJRA 1M34E 4CETA 3BULA 5GQSA 1N6PA 1Z68A 2DE0X 2QX8A 3R3UA 1QDUA 1RTKA 5FTNA 3T5DA 2HMTA 2PUAA 2Q21A 3HFJA 4ZPXA 3ISTA 1U28A 5JJBA 4KGDA 1SVWA 3BSWA 3UICA 3I5AA 3L3BA 4X71A 4QNRA 2WKRA 1YVRA 4MIKA 1VE7A 4GVLA 4RO0A 1VJ0A 2BL4A 3NAGA 2AG1A 4CM6A 4PE5B 1D6SA 1RAEA 1WWKA 3I9JA 4J3JA 4Q4JB 3VU3A 3EEFA 3UAOA 4F2WA 1SG6A 2PGXA 1ATIA 2NUPB 2W48A 3LLUA 5FT9A 1G7SA 3QHAA 1FDRA 3R7AA 1TCVA 4JGIA 4S0XA 4GG1A 1DU4A 3UJDA 3L18A 2ZTLA 2JJMA 4Q0MA 5BWCA 3E9RA 3ZWAA 5ALIA 4UDOA 2I4IA 1K1EA 1QUFA 3K71B 4O3FA 1Q21A 1ORDA 2FPPA 3RU2A 3EOAI 4ERNA 2HIAA 1RMYA 3PDWA 4C3ZA 4C7OB 3LY5A 2HSJA 3IODA 5B36A 3LJKA 1NY5A 1PT8A 4WLFA 1R4MB 3JRXA 1CQIA 4PZAA 5I5GA 4EUEA 3M6XA 4GE0A 5C3UA 4D82A 1R74A 3QE9Y 5KYGA 1W5SA 1FP6A 1D2MA 4RVNA 5EJGA 5K3AA 4BLTA 3W5BA 2UUAB 2R5NA 4OXKA 3ZIAA 5MFZA 3OIWA 4UBMA 2NTJA 5CNKA 4A5OA 1OZ0A 4EJ0A 1T5TA 2GZHA 1NIPA 1SN7A 1TA4A 3LM8A 2GAJA 2QJFA 4ADSG 2O8FA 1UWLA 3HZHA 1EWTA 1IJKA 4DIDA 1N2HA 2OAGA 4R9RA 1AG9A 3KPUA 4TLMB 3ULKA 3GFFA 2C8KA 4D79A 4LWQA 5BSTA 4J7XA 3FTQA 4PHCA 5E1MA 1T2CA 2UZ1A 5JWHA 3RO7A 1HFEL 2XXAB 1DIOB 3Q15C 1NV8A 1QX4A 3QMPA 2WWTA 3ZEIA 2R1UA 2R1TB 2RMKA 4MGKR 3ER6A 5F21A 3SU8A 4W63A 4UTZA 3JYHA 2E4YA 3LSYA 4MR8B 1D1PA 4OQXA 2Z3WA 4PWYA 1FQKA 3MLEA 5B58T 3MK31 2NO1A 1TJYA 3LA6A 4PRKA 5AJHA 2HHJA 1Y1QA 3NU1A 4KRGA 1TIBA 3ND9A 3P0FA 4OBWA 3L49A 4Q3NA 1M0SA 1Z34A 4PC1A 3LPAA 3GYBA 4UHBA 2XZTA 2IJGX 3E5MA 3O4FA 5B1DA 1UZMA 1K97A 4L4RA 3UMGA 4DSNA 3IEXA 4JZKA 3IAM6 2PFKA 3RVSA 1T6YA 1UAYA 5E6SB 5GIPE 1MAHA 3EMKA 4TWBA 3Q41A 4R1NA 2VJOA 3AB3A 2XH8A 3DW1X 1AS2A 1T9KA 1WNTA 3HKCB 4PSCA 3RVQA 4RUKA 3FI0A 4Q3OA 1M6EX 3P9XA 1YFKA 3MWYW 5LNK6 2OFXA 2MJLA 5JLJA 1DKUA 1U3FA 5B55A 2ZRBA 4IILA 4JEIA 2PZEA 2REQB 3CF4A 4YONB 2V96A 3MUFA 5JATA 1IJEA 1ISIA 1PFYA 3FMIA 4TL9A 3ZE2B 2R84A 2O48X 2Y9MB 3P1JA 2H2HA 4J0CA 3F6YA 1K4MA 4D74A 2XWJI 2XXBA 4RTLA 3EIWA 1SUIA 3VTAA 1UKBA 4OX9Y 2IUSA 1X2BA 2XMZA 2X1LA 3OPMA 4Z7NB 2JIPA 3VTKA 4PO3X 3GFOA 4H1VA 1GTL1 4KN6A 4PQFA 1VLVA 5LD2C 4K1LA 5K3DA 2J3QA 3DMFA 2GLUA 1E3LA 1ZAKA 3H1GA 4I4CA 4HB3A 4K9QA 2MMCA 4G8BA 4HZUB 5HTOA 3GLIB 2BMVA 3H04A 4EQ6A 4JYPA 1KK1A 1RFGE 3EE6A 3FI9A 2Q27A 3MCTA 1EXWA 2X2EA 1G41A 2D54A 1FJXA 3VV2A 3WMEA 2UVQA 4F8YA 1Y9JA 2ZI4A 5K6TA 1QC5B 3A58B 1A72A 3ZTWA 4RD1A 3ILVA 4DJEC 2PUFA 2HB6A 1E6CA 2BHTA 2X3UA 3R3ZA 4UXJA 4XIGS 1YS4A 1SEPA 5EJMA 4CLHA 3EY4A 3ONEA 4Z4IA 2OPHA 4BZWA 1RSZA 3TTTA 1GPAA 3LU1A 2XVYA 4FDLA 1U2GC 4OXIA 2QDXA 4EYQA 5K8VA 1SZJG 3I4LA 3RHZA 3SIPA 3OM8A 4D0GA 4L73A 3HEAA 5E6RA 5JE8A 3QX7A 5KVQA 1GL6A 2VJPA 3IBGA 4TRJA 2BN4A 3M6UA 1GQSA 4RJJA 3RPEA 4CIYA 3RBXA 1KMHA 1KQGA 4A0GA 4KQWA 3OF3A 4PPNA 1ZD4A 2I4OA 3MZ0A 1O3YA 4IDHA 3UMJA 3H99A 4E5YA 4Y0NA 3V8EA 1ZY2A 1U5CA 2B1GA 1G5PA 4JL5A 4ZVNA 1JFTA 3RAJA 1J21A 4IZOA 5DXAA 1C7IA 2ZYIA 6ADHA 1Z8DA 3OIFA 3EGWA 4UEQA 1Y7LA 5KYVA 3EXEB 1BU5A 3KP1A 5JU6A 2Z2ZA 4FYMA 3PEUA 4GYJA 4FP9A 1N2SA 1SOVA 5EE0A 4FOTA 1MZVA 4NIMA 4CRWB 4HI0E 1T3TA 4WESA 2QMQA 4L74A 4DYHA 4KXMA 4BE4A 2XF8A 3TZQA 4DVGA 2DLNA 2I6QA 3VDRA 1G2QA 2QG6A 2WQ6A 1E3SA 5JMOA 1ZESA 4A6XA 3V1LA 3DDUA 3QVXA 2CNLA 4Y6RA 1DEKA 1RHRA 2VNHA 3WRYC 1E8NA 2I29A 1KKUA 2RJNA 1P2GA 5LZ5A 3SC4A 1C7JA 1Y8QB 3OX1A 3AP2A 4F38A 4GRIA 1P0CA 1P62B 4R6WA 1ZUHA 1CB0A 2H7VA 4MJXA 3HJHA 2X2OA 3K73O 5GZ1A 2YHIA 3PNKA 4FNMA 4C0LA 3HVUA 4QX6A 4UAVA 5DI3B 5CAEA 4WBSA 5AW5A 3I05A 1P7CA 1JKMA 1AT1A 1WD5A 4Y9RA 3EZ2A 2F3PA 3F3YA 4GKKB 3WKEA 4R8MA 1RR6A 4ETNA 5KCZA 3SX2A 1Z15A 4N5LA 1S7GA 4KLRA 2AI2A 3D3NA 5E9QA 4JCOA 3L0DA 3VC7A 1ZSNA 9LDBA 3LY8A 1GCAA 3LUHA 1NRWA 3CZMA 2BMFA 3DDNA 5E3IA 3CLUD 4EG0A 1VYTA 1KEEA 3U6KA 1Z07A 1ZVJA 1JX6A 3RQIA 2YASA 3NH6A 1P1BA 1CEXA 4F97A 3HHPA 5U4QA 1BVRA 1RYEA 2PGAA 3A9WA 1D6NA 1X86B 2FXIA 4PIPA 4BJ1A 4E33A 3EHDA 4KR3A 4IICA 4AROA 2B6NA 2DR3A 1Z5ZA 4DMUB 1MQAA 1DAKA 2QGNA 3R7SA 3ZU6A 4C2AA 1IHXA 5ADUS 2D74A 5E0KB 1UBOS 1EQAA 1X0XA 1HEIA 1TVKA 2PJDA 3GYGA 4RPCA 4C5AA 1PT9A 4RL6A 3SPXA 4BVJA 4CM5A 4YXWD 2MDTA 5KYXA 2ZB4A 2JK0A 3KDSE 4GOMD 4B6JA 4FFVA 1RZRA 2WWRA 2P62A 2VBIA 2L18A 3PRKE 4EK9A 4B0PA 1V6AA 2RG7A 1WXIA 3N6XA 2VYFA 5JMPA 2OL4A 2GJKA 5KWIA 5KSOA 1YACA 1X15A 2R6ZA 1WXWA 1RJ9B 4RKRA 4B31A 1WKCA 2EG5A 1W0JA 1UMDB 3IULA 3DLHA 1Y1TA 1C2TA 1Y3CE 2H2AA 3AJEA 4KVZA 5HBGA 1T9HA 2OCBA 3N2NA 2R47A 4NMMA 4Q4AB 5HJ2A 3DULA 1ZD5A 3B3JA 4TKLA 1HMYA 3IDZA 5F5LA 1GZDA 5FHRA 2LNDA 4ASUD 4P3XA 1MD9A 5SZJA 1UXGA 1G8HA 2PO7A 2QLTA 4Q3LA 4CG1A 3IUJA 2AG0A 3W5IA 2XUOA 5IKEA 2V7QD 3INRA 3NRBA 4UKDA 1TMYA 1OILA 3NRCA 4NE2A 4QYMA 3JATB 3LA8A 3LHKA 3WIVA 2GK7A 2XDQA 1XXHA 4NAHA 4V0SA 2BM0A 3FNHA 3W79A 4NONA 4RULA 1TAUA 4N3BA 1R12A 3KJZA 1GN9A 2AYXA 3W5JA 1IZYA 3AGPA 4IV0A 4BQIA 2WYIA 2YN2A 621PA 3T5BA 5KQSA 4HVTA 2YV4A 4UJ5A 4K6KA 1B41A 2IV3A 3O75A 3GG2A 3ZJ4A 1ZOSA 3A3NA 3K15A 3OJXA 5CITA 4GX1A 2JJ1A 4ER3A 1TVCA 2B4RO 1OA0A 1CERA 2NO7A 4IVPA 1L7EA 4MP6A 2R97A 4BMVA 1BEUB 2JASA 2LIVA 5ELXA 5DMHA 2I62A 4F4IA 2Q5JA 1NJ8A 2R8ZA 3QWAA 1LK5A 1CP2A 1N5IA 5JC8A 1T8RA 1SXJB 1Y5LA 3D8NA 5C1IA 3W5AA 4R3WA 1KBQA 3K32A 1VLHA 2GD1O 2VTDA 4GYWA 4AULA 3GEEA 1FS4A 5DE3A 3RS0A 1B1AA 4Q4HA 1SH7A 4MVJA 2JB9A 2QX7A 1QVWA 3D7KA 4IQ0A 1DXOA 4Q9NA 3KU1A 2AC7A 4HMOA 3WMXA 5A2GA 1EX9A 2XWQA 3RHSA 7GPBA 4CEIB 2XTAA 1ID1A 2G0TA 2OEPA 3AINA 3HDJA 3RVMA 3UJ3X 1Q0UA 2J9YB 4HDSB 1N8SA 5JS8A 5BN5B 1WZUA 4N1AA 4RC9A 3HJRA 2XLBA 3OZFA 4Q66C 2LVBA 1U3VA 2WMDA 1E96A 5LUBA 3QMMA 2GN8A 2X13A 1BG6A 3CFYA 1MB0A 4JUBA 3PDIA 3R41A 2P69A 2HMVA 3LBAA 4BO7A 2JC3A 2YOFA 3QA3E 4U9IS 2Y66A 3TLGA 2GK6A 1BKDR 1GFZA 2HF7A 3OLZA 4QG7A 4E70A 1FLNA 5FOXA 5EEGA 4OKNA 2CWWA 2N3ZA 3B6KA 5EQFA 4NHOA 1TF7A 1T9GR 1FDUA 4XVQA 1MV8A 2WW8A 3FPGA 2I4NA 2XIJA 2PPLA 2XMGA 5D00A 5ESDA 5J2UB 3U2QA 5IKXA 4OMFG 2J3DA 4MDHA 3GHHA 4BMZA 3ZQUA 1OIVA 5L45A 4FQ5A 1JBKA 2AK2A 4LKRA 4DUZB 3FG9A 4QSMA 4S1TA 4FILA 1PL8A 3QVWA 4LPSA 1M8FA 4KFRA 2Q6OA 4DDTA 3CCCA 4RSGA 2ADOA 4QRDA 5CMLA 1NQOA 1TU3A 3EXG1 4IDEA 5IT9A 2H4HA 4NYIR 3W78A 3ZQ4A 1OLSB 2RHCA 3ZIAD 4PCAA 3MCZA 1E5DA 5AK0A 5FLXA 4HFMA 1SKMA 1JQJC 4CKCA 4M2LA 3TOSA 3WKBA 1QFXA 4AMUA 2YC4C 5DW3A 1FY2A 5AJZA 2C9BA 1DKNA 5DK6A 1BXKA 1HNWB 3V4OA 3QVOA 4DAOA 1FU4A 2WYWA 3HCOA 1QHHB 4FWBA 1GZUA 4DWOA 1DTEA 2ECQA 4B74A 1XQYA 2WIDA 4I1PA 1P5ZB 1W59A 5EWJB 3VGJA 3EK2A 2GJ9A 1CUYA 1FFBA 3ROXA 3HYSA 2ATXA 2JFUA 3V3TA 1EVIA 1EJ6A 4HD8A 4UUBA 2JHCA 4XYEA 1DUIA 3O1IC 3VSEA 1K4YA 3LQFA 4PFKA 1MRSA 3TKAA 3WGJA 2C7PA 3THXA 3CWCA 2VEDA 3HKBB 5BMOA 1KAGA 3UV6A 4YAJA 3ZCSA 2P2SA 1XD8A 3E8XA 4ZZ3A 2ZDGA 3PITA 1K92A 1BSVA 4NOKA 2CBGA 1CC1S 1ZJJA 2FPWA 4QJIA 1HXHA 4HEA1 2JATA 3JWIA 3GELA 3VGPA 4FLMA 4YIKA 3TM5A 3PCXA 5CTAA 4NKRA 5AQ1A 2GD2A 5IDQA 2CFSA 1DJQA 4DXHA 2BKUA 3PKZA 2FLKA 3PR3A 3IDQA 2HADA 3DXXA 4V2UA 1ZMTA 5LKRA 1W35A 3DEKA 1G4UR 1ONOA 5DM60 3DKPA 3IJEB 5ELMA 3SIXA 2IOHA 3ICWA 4G1EB 4OFZA 3W2FA 1U7OA 1U5BA 4B3GA 1Q0SA 4NJEB 4QULA 3U6BA 1I2DA 3CZRA 4C4TA 1VLJA 4QM7A 1GQ2A 4XQGA 2GRUA 5AHXA 4Q9JA 1ANKA 5HNKA 3TSAA 3VZPA 3QPBA 4ZA2A 2W2XA 4Y2XA 4K9KA 3OICA 4PZPA 2XGJA 3BMOB 4LXHA 2B37A 2AC4A 2OBLA 4QUKA 2G4VA 2VHZA 2VH1A 4RK7A 1X19A 4ZMBA 2Y1WA 1EX7A 1G20E 1RWMA 2DU8A 3EWNA 4LC0A 2BELA 5DNUA 5EJ9A 3AR2A 4UNIA 4ZHQF 1EZZA 2YWCA 4MCIA 4MI6A 4X0EA 5FI0B 1OLUA 5EE9A 4BMPB 3HN6A 2ZPUA 5KQLA 3SBDA 3JX9A 1ESDA 5F2EA 2Y1FA 3FZNA 1YZQA 1ZH2A 1F2TA 1P9OA 1LPMA 2II6A 4XWTA 1XTJA 1H94A 3D0QA 4MI1A 2NU8A 5IVHA 2FUNB 4LZNA 3MT7A 1TYCA 1NN5A 3FHOA 5DDIP 1SCJA 3FUCA 5IDWA 3F0TA 1AMNA 1L3CA 1ZJZA 4X60A 4E31A 2V74B 1MT0A 2C8VA 4JJAA 3L0ZA 4D56A 4KRXA 5JPDA 1Y1KE 3CQ9A 5ERXA 3GVPA 2HMYB 3ES9A 2R9VA 4E14A 2JGMA 4FYWA 3T95A 5IASA 1KERA 4CLOA 1OXBB 3CEHA 5BV2P 1NJ5A 2B35A 3BCUA 5JMWA 4U39A 4IUYA 1DAPA 1PYGA 3E3LA 4JI1B 3KJGA 3FE2A 2IX9A 2WJJA 1M34A 2CSUA 4UM9D 2A1UA 4KRFA 2Z8YA 1ID8A 1GPBA 4R68A 5CDSA 1VKOA 5ULLA 1NUHA 1L4YA 5ILQA 2X3YA 3DTVA 1R0BA 5HDQA 5CP8A 1TCUA 1UM9B 2IU3A 1S3SA 4LC1A 5GZ3A 1BCSA 1JS1X 2FW8A 1GLNA 2F43A 3F97A 1DX4A 4HLCA 4QPNA 2ZT7A 2YVAA 2JD0A 3TRDA 4I4NA 2HV9A 5LCXA 3NEAA 3R76A 4IH9A 3L6UA 3ZJYA 4IDAA 1XMPA 4S2UA 1SU8A 1UXIA 4Y6OA 2QN1A 3EUWA 1A8SA 2AFIB 1MB2A 2JZOA 3CZ5A 3H0KA 2BFNA 1Z0ZA 3JQRA 1SQSA 4HAYA 2IDKA 5BT8A 5CCXA 1BDIA 2AKEA 3PDCA 4XVCA 1MX5A 4V0NA 2DXIA 3IEKA 1DEOA 4KYTA 4JAVC 1U3TA 5IVDA 5A4JA 4ILKA 4L4YA 3ESZA 5IWCA 5ARDA 2GEDA 2BEWB 3GA5A 3RAGA 1FFXA 4UBKA 3L8HA 5GM1A 3RS2A 1MAUA 5B7NA 4WNCA 3W77A 3LKZA 1PF7E 3ZDEA 2J31A 3LE8A 1M6VA 4LHSA 1BHQ1 4L8GA 4LXQA 3FOEC 1U0LA 5TB5A 2FA9A 2PT9A 2ZS8A 4G0VA 5JHHB 3E0QA 2PMCA 1YT5A 1YR2A 1M1NA 4FZRA 4IHJA 2C9CA 4RF4A 4W7SA 1QYRA 2LWIA 2ZJ5A 3VR4H 2P35A 4CV0A 3AKYA 4JJ7A 3X1ZA 3ZHOA 4DGQA 3H11B 3OESA 4DJDC 1UC8A 3B48A 4MIOA 1JH8A 4WZAE 1GQYA 2Q4EA 3TW8A 1ULZA 2C07A 3KEMA 3KDAA 2DBRA 4AJ4A 4BIIA 2PZAA 3EVCA 3QEBZ 3LWNA 5B2EA 5DHRA 1QG6A 1JDUA 3D1VA 2RH8A 3MBKA 3MJ4A 4FDMA 4GM1A 4JT4A 3RREA 5INTA 1YZHA 3WJ2A 5ALJA 2Z8ZA 1Z5VA 3M33A 5DRYA 1JWLA 1WCV1 3HE3A 3FYUC 4GKBA 2JK1A 3VPDA 2PWYA 1AQ6A 5K6AC 2DLDA 4BP1A 5REQB 4GPD1 2ORVA 4RTJA 1BN7A 4A15A 1V5EA 3KYDA 4OBBA 4JP3A 4EABA 1A4RA 2G4CA 1IZZA 4HXGA 3U17A 2EFYA 3AHCA 4GLLA 4CMEC 1Q74A 3FPKA 3DOHA 2Q5OA 1CTQA 2QPLA 4K88A 3M81A 3ZCQA 2ZSIA 4HDCA 3WNDA 1TZMA 2A94A 3O8OA 6NULA 4AJPA 5JV5A 1KH1A 1SU4A 2FZEA 2RIPA 4B17A 3TEMA 2VXOA 1KAQA 2J6BA 2BF4A 3RKUA 1MJFA 5KIAA 1SOUA 5LN1A 2R48A 4EAAA 3NFYA 2H1FA 1TL7C 4HXYA 3RYFB 3NBAA 5C7IO 4J1TA 3ORSA 1QWSA 3G0HA 1XC7A 2VDUE 1KMMA 1N3YA 1LTQA 1W0JD 1PSDA 1TTPB 2H17A 2RK6A 3NM5A 3QSGA 4RU1A 3L92A 1KH3A 2DH5A 2FMIA 3LPDA 4GS5A 4RD4A 1FEZA 1PJBA 3PUIA 3KCQA 3TMYA 2GBFA 5EC8A 3U37A 4NZMA 3OLQA 1DPGA 4J1SA 4ND5A 5DO9A 3ZJTA 3JQAB 1E6LA 4JD5A 4KX3A 4TYMA 2FOXA 3SC2B 2X41A 3GFVA 4LV6A 3RF7A 4B35A 6LDHA 1V3TA 2Q46A 1LD3A 3D6AA 4M1WA 5IW8A 3HB7A 3CH6A 3TLCA 4AU1A 5LLTA 3HGMA 3NHYA 4LZZA 4XSGA 1R0XA 3WSWA 1B0AA 3VA7A 3HUEA 3R3JA 1PQWA 4CDGA 2GS9A 3QE0A 3S40A 4ARBA 1RS0A 3VYVA 1XCJA 2G88A 3JWJA 4BFYA 2DG2A 2P2LA 2VA8A 3KR0A 2ZQZA 4GMFA 1JI3A 3DJFA 3PQFA 4JLKA 3ZLBA 4JI8B 1WPQA 3NAQA 4MW1A 2H8GA 2EFCB 4ENRA 2P3SA 4C0WA 1FRVA 1A9RA 4CKEA 5J9FA 1M83A 2VL7A 2CMHA 2JJ1D 2E4VA 3C3MA 3GBVA 3U80A 2IVFA 3GJSA 2WUEA 3KR1A 5HCIA 4PC3A 3VPSA 1U7HA 1X7YA 3K30A 1DC8A 4HAOA 4R9NA 3GMTA 1X7GA 4QUBA 3KQUA 4DR3B 1LU9A 3ZPXA 1Q1NA 1YS2X 3H6GA 1JV2B 4U6QA 1RYBA 1XDGA 4WJLA 1CY6A 2AUMA 1Y1PA 3IB6A 5JSKA 3GZJA 4MVJD 4P5PA 1CE8B 2PK3A 1QIHA 1H2FA 2KHZA 3W9BA 3GWGA 5FOVA 3O1HB 1E79A 3MINA 4KQMA 5TQ2B 1RBQA 3PKIA 3ZHUA 2OZPA 4HQOA 2R6FA 1YCFA 3E53A 1VE6A 3KPJA 2MSKA 4IQGA 4O25A 4N47A 4TQ9A 3T06B 1VDMA 3KT6A 2CFRA 1AK2A 4Z9XA 1U90A 5G0VA 1IYZA 2JPDA 2V4MA 1EGHA 1L8LA 4RELA 3LTNC 1CEEA 1VJTA 1PKEA 1G64A 4B3MB 2B1RA 2XB4A 3TZLA 2YINC 1XTIA 1OVGA 1JXAA 4E07A 2O1WA 3TQIA 2GNOA 4WKNA 4P98A 4BMXA 3CX3A 4OPMA 2Z43A 1L4UA 1OI2A 3EVTA 2XOEA 4B3RB 5FTMA 1GAXA 1M2EA 3LDUA 4I6GA 4Q05A 4PSVA 3LOUA 3TZKA 4N39A 3BWBA 2FX2A 1RXEA 4QDTA 1CRWG 3ZCTA 5J4YA 4PN7A 5K1ZA 2VPPA 3QPVA 1C81A 1T9AA 2WIAA 4TSFA 3A14A 2AN3A 1QJCA 4LZPA 3CLUC 5FPHA 1YR8A 3HSSA 2WV9A 3OEWA 1K98A 1PO7A 1AMOA 2O5EA 2O57A 1K4KA 1U7XA 5TEVA 4YP5A 1PLLA 1W75A 2IIBA 2ZBDA 4GYKA 4UOEA 3M89A 4C78A 4DMKA 1SBNE 3WLKX 4TV9B 4XEUA 3HVRA 3UO8B 1SIBE 4HAVA 4M8KA 5JVDF 1ECPA 3X1YA 1ZNQO 4MAAA 2GA8A 1YA6A 4GM4A 5B3AA 2W6OA 3PJFA 5HDBB 4HLUC 3ROGA 2XZDA 1YXMA 4FGUA 2YWGA 1U99A 2HNBA 2V9CA 3AZOA 3EMBA 4IINA 1NI5A 3H7IA 3I5UA 2F9FA 1W34A 2V7WA 3DL4A 5AKGA 3OF2A 3ZZUA 4MS1B 1D7OA 2O3QA 4KNYA 2WJ3A 2QV0A 3KYIB 5AUQA 4P6VF 3HZZA 4QDJA 2EFDB 1JYSA 5DX1A 1J23A 4ONEA 1UMCB 2QVGA 1V4NA 2YC2C 1ZI9A 3C70A 3QH4A 2OHHA 5KUTA 5FNVF 4KKXB 3LGXA 4KV9A 1IEVA 1MA0A 1OTHA 1SUDA 1TUGA 4JP2A 1NVDA 4FIDA 2A1IA 4CT4B 4JKYA 5EKTA 3LPNA 1P29A 1J9ZA 4BVHA 3PQDA 3MYRA 2G72A 4L5AA 2QRUA 3A6KA 1QH1B 1W88A 5A1JA 3B2EA 2WABA 4QJBA 1FL9A 2FN4A 5BSWA 2GM9A 1NYLA 2CLLB 3B51X 2AQIA 3K5HA 4FONA 4O1HA 3M3PA 4TUYA 5G1NA 2FJUA 2YUIA 3NHWA 4PFQA 2GSWA 5L3ZA 4LFCB 4RY9A 4MZXA 3SI7A 2OCKA 2QW1A 2FQWA 1ISHA 2C4NA 2YZGA 4HP8A 5CEEA 3F46A 2EL7A 4K9DA 2LXNA 4GOND 1P4JA 4QODA 5FP0A 3FPHA 2FF5A 4D7AA 1LV7A 1V2GA 3BXEA 3TRIA 1HKUA 3RUFA 3NW9A 4OHCA 1W4ZA 5K8UA 3U49A 4HJRA 4ZANA 5K0GA 3TOXA 4N4AA 3U61B 1PS8A 3FCYA 5DP1A 1OMOA 3KZCA 3CE9A 1VYVA 4OKIA 5COAA 5G4KA 4BLQA 3D4LA 3FGOA 3L0YA 5MGBA 4FYJA 2Q8NA 1NUTA 4OQFA 4U6SA 3TFQA 2IP2A 2CL7X 4X6YA 2OORC 4V3BA 2G0NA 3W3ZB 3T12A 4TQAA 4IW3B 1ZN9A 5IMBA 3F7NA 5GTDA 1JA9A 4PRLA 2I3AA 1XQ1A 1AHPA 3GRVA 4C0AC 4DNPA 2UUBB 5T3YA 3NTUA 1EDDA 3LUCA 4CQLA 2UXCB 2QQFA 2ZWPA 3IHLA 4F5EA 4JWTA 3IX7A 4D4MA 1P5RA 3D7LA 3IP8A 4MW2A 4QAQA 4WK0B 4Y1RA 3S81A 1C30A 2MOKA 4ZARA 3V4LA 5I6DA 2QE7A 1Q84A 1U28C 2P2DA 3NCHA 4J0KA 1C3EA 2RAFA 2YV2A 2R68A 3DWGA 3PGVA 4ZDJA 3UHFA 4MW5A 5HFJA 5FWYB 1IUPA 5EJ8A 1M1ZA 4G8DA 2CF6A 1GKUB 1XD9A 1Q1BA 1Z4LA 2VH2A 5FNZA 5TQ0A 3JYQA 4BU0A 4UNRA 2QV7A 1IMOA 1TVMA 3MCVA 1NOJA 2VIIA 5BMVB 1KKLA 1D6MA 4KREA 3U3ZA 3JARB 5JSZA 1DHTA 4JOSA 4BN0A 2ATCA 4D9NA 1YK1A 3T52A 4EW3A 4OJTA 4LHVA 2NU7A 2CV0A 2WJIA 2F1KA 2NTNA 4KDEA 3ZOKA 4EF4A 1H1LB 1M8PA 2PX0A 4R2JA 5KYWB 3QNWA 3SBOA 2E4XA 3VKGA 4L3WA 1NIJA 4DA4A 2ZRJA 1A4IA 5L7YA 3OTOB 4XB1A 3KAKA 2FEKA 3CKMA 3DTVD 1AQLA 3EH1A 3QKRA 4D5EA 1XBTA 2WSBA 1MRNA 2JHAA 3M5PA 4HJXA 3V4ZA 2GA9A 1PEKE 3BK1A 3KEGA 2ZB7A 3MNFA 4MVXA 3S1AB 4B3IA 3ESXA 1QZXA 5C34B 1H69A 1PD1A 2P77A 3QFTA 3AVOA 2AI1A 3GGDA 4KU4A 3RVLA 3O94A 2E2WA 5TX7A 1OXTA 1VHJA 4BNDA 1GT91 1Y89A 3V8NA 4D4HA 5BN1A 4NCHA 3UV3A 1T43A 3DTNA 3HV2A 3L6OO 3WL3A 2JH9A 1AKMA 2X77A 2XKAA 4TKVB 3EUFA 3DEJA 2QU8A 3NO4A 4JBWA 3TB6A 2REXB 1FSFA 1NXXA 1F2UB 1GG9A 2CSXA 3FB4A 5CNJA 1ZM9A 2VEOA 1JMVA 3OQ6A 2FJ0A 5EPEA 1BEZA 4ZN6A 3PJRA 2I2DA 4HDKA 1UJNA 4I5EA 4LRXA 1R0WA 2X76A 3QBEA 4FFNA 3RODA 3SQLA 2PFGA 4DDWA 1MHTA 2OGTA 1H0SA 2DUUA 1IY8A 4URWR 1M2NA 1D6JA 2GJ8A 3DP7A 4KMSA 2B3TA 2DHRA 2ZYSA 1JDSA 1T5SA 1VCHA 4EHFA 4DABA 2PUHA 3E58A 3N8HA 2B99A 2FLVA 2QK4A 1DWPA 1XTPA 3C1AA 3D4IA 1E1KA 2IU4A 3OJOA 4CQMB 5CYGA 2IYZA 2PLFA 2ACKA 1GG8A 3Q3EA 5MFPA 5T41A 1J90A 4B09A 3IAEA 3LS2A 3MAGA 1KDRA 4NG5A 4RLQA 1LLCA 2VSXA 4L0CA 4KP7A 1NFRA 4Z4GA 3OM9A 4URYR 1ZK3A 2UYYA 4MKFA 1J8DA 1W4CA 1P5HA 4MRPA 3IE0A 3FWNA 4J0IA 3N2IA 4BO8A 1B76A 2AOWA 3ZKAA 5CDHA 3EIEA 3KAJA 3N2EA 4FMPA 2GAOA 5CA1A 2FDCA 4AJLA 3HPQA 3PGMA 4WINA 5EJ7A 2B98A 4RHEA 3U4QB 3MILA 3ND5A 4Y0VA 4R6XA 1YNOA 1S3GA 2BGUA 3H5IA 3K2BA 5F52A 5J4HA 1JEAA 3B36A 3TINA 2LIPA 4PLWA 2BEUA 4L51A 1R66A 1CY7A 1YQQA 1FNCA 1HQYE 3SHWA 5CYOA 2WWVD 4OQQA 1LZLA 3CTPA 1AKWA 2Q5LA 1BYIA 1X94A 3TQOA 3DR5A 3UMSA 2NV2B 2ZRDA 3K7EA 3A6GA 4JT2A 1FTSA 4LBYA 1YZVA 2QYOA 4CTNA 4E4YA 1NHGA 1HSOA 2ZRMA 4EPTA 5J47A 4KZKA 4IOLA 2ID7A 2PX6A 3WG9A 1FP2A 1XP8A 5ADWA 3O4JA 4MQFB 1M6YA 2WLSA 3KWJA 3GCWA 3P4UA 1QZ3A 4YGYA 4YP1A 4F5DA 4WSOA 1Z0IA 1S6YA 3S2EA 2A4MA 4UZFA 1LK0A 5EPUA 3U44B 2WHYA 1QE5A 1V5WA 1ZC3A 2JF0A 1II8A 5H8WA 1MEJA 2WFAA 1G20A 1I2ZA 1T0IA 4TS1A 1HPLA 2XUGA 3NUQA 1U1CA 4G36A 3N3AC 4B45A 5B7GA 5CK5A 2OCGA 3ZZTA 1OD6A 3EBLA 1HYEA 2CUNA 2JLSA 1IN5A 3DFFA 1C7FA 2WEKA 2HWWA 2QENA 4MYTA 3UYLA 1CUZA 1VSUA 2XZPA 2YUTA 3IJ5A 1WE2A 2R25B 2ZCJA 2V3WA 3UAVA 2EG9A 3G8BA 3WYEA 2WTUA 1P1HA 3RTGA 5NLLA 4DV2B 2XUKA 1WSWA 2R8RA 5GJCA 5AVUA 3IDOA 1GAJA 3D59A 3LUFA 1UEIA 2CFTA 5TSDA 4G9EA 1GO2A 3C8ZA 3D7NA 3I01M 3JD3A 3N7UA 3C3KA 4P92A 2AUNA 3KR2A 1XZJA 2CLFB 1EP2B 4EHAA 2NZWA 1C4XA 2VDOB 3IJPA 2GZ1A 3LWZA 3RS8A 4LOLA 5AT1A 2I0FA 4RCVA 2BSAA 3OBBA 3PE3A 4Y9DA 5IUKC 2GSDA 2EW8A 3BWEA 3SN6A 4N0EA 1JBQA 3L07A 1P81A 1KVTA 2GAIA 4TTIA 2O3TA 2QR2A 3KAPA 2QMOA 4R1QA 1E79D 4HTAA 1XRLA 2G06A 4GW3A 2OBFA 3A4NA 4J4TA 4H0FA 4LYJA 3ZGZA 3T5PA 1VKNA 1XP5A 5EG5A 2IGBA 4R8KA 2QGFA 3PL5A 2O7SA 1ITZA 4P36A 3Q12A 3RJMA 4BVGA 5I9NA 3KUCA 2ADMA 3F5SA 2NAPA 4K28A 5J63A 2DHQA 3TCKA 1W93A 1WULS 2DR0A 2X0KA 2Z0MA 3C7TA 3R09A 4IDFA 4IVQA 4ISCA 1MCZA 1Z26A 2OOSA 1EUCB 4YMSA 4L0QA 3R9IA 3KLBA 3MRSA 4CKWB 3X1WA 1ODJA 2FPIA 2XCLA 3I23A 3I8XA 3WFJA 1WXFA 3PX3A 3W6ZA 3HA2A 3KPYA 3T1TA 3DAGA 4EPVA 1F7VA 3MT9A 2PA0A 2VUUA 4M1MA 4TM7A 4OUDB 4CDRA 4RJTA 2X7HA 3PXDA 5HK8A 4ZTUB 2HPAA 4MINA 3A4VA 1UCFA 3LQKA 4FT2A 4JU8A 5EP1A 4EA9A 4S12A 4MKZA 4PZ0A 3R7WA 5EUCA 2WUWE 2IP4A 1KJ8A 1M2HA 3NTRA 2QTCA 3UMFA 3WHIA 4TSFD 1XHFA 4UU0A 4H7FA 2CJPA 2VTBB 2Y1CA 4Q02A 3OKCA 4R8LA 4LNHA 3C74A 4YUVA 2GK4A 2I6FA 3W2GA 1KI7A 2O4CA 1L8OA 4ZOAA 1VHWA 2CVFA 3BE5A 3S2SA 5IVPA 4CL8A 4YDHB 3QJYA 1D1SA 3Q72A 3KYCA 2EZ4A 4GMDA 2J3EA 1UWKA 1A9XA 1FJGB 3D6TB 4C7JA 2IKSA 1EDEA 2PL9A 4Y2VA 3B3QA 2NADA 4MWTA 2EX1A 4MQUA 5LU9A 4IXTA 1C7ZA 2XYGA 3OZUA 1OC2A 4H4CA 2G7MC 4HCJA 4R1OA 2MSNA 3KKPA 4I19A 4WZAA 4EECA 3JR3A 4H7JA 1LQUA 1RM5A 2YJ6A 2VKQA 1MVOA 3H13A 1TA0A 1MORA 1PZEA 4XWYA 4B3CA 5CCBA 4QVKA 2YVLA 2ZRHA 2B8EA 2IF0A 4RH1A 2NV0A 5CJ2A 3WA6A 2PJUA 3R5SA 1SZPA 1XCLA 4KQFA 3ASZA 4G37A 5A06A 4P83A 5D8DA 1W36D 4QQ8A 1T0PA 4JB2A 2POCA 1H8EA 3NALA 1QP0A 3X1DA 2ZFUA 1T3ZA 4R2HA 3AFGA 4FEEA 5AKLA 5HA5A 3UQZA 4YX9A 2VQEB 2B1QA 4OHXA 1UINA 1WPXA 2W0SA 4C6TA 2WU4A 3JWGA 3F6SA 2WDPA 5IC4A 3AY0A 4KTVE 1Q1EA 2HM7A 2HX1A 5EZ5A 3T4EA 1EINA 3E8MA 3G2PA