1Y1SA

Crystal structure of the uridine phosphorylase from salmonella typhimurium in complex with uracil and sulfate ion at 2.55a resolution
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
250
structure length
250
Chain Sequence
SDVFHLGLTKNDLQGAQLAIVPGDPERVEKIAALMDKPVKLASHREFTSWRAELDGKAVIVCSTGIGGPSTSIAVEELAQLGIRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASLHFAPMEFPAVADFACTTALVEAAKSIGATTHVGVTASSDTFYPGQERYDTYSGRVVRRFKGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQQEIPNAETMKQTESHAVKIVVEAARRLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structures of Salmonella Typhimurium Uridine Phosphorylase in Native and Three Complexes Forms - with Uridine, Uracil and Sulfate.
rcsb
source organism Salmonella typhimurium lt2
molecule tags Transferase
molecule keywords Uridine phosphorylase
total genus 81
structure length 250
sequence length 250
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2004-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1y1sA00
1A9OA 4JP5A 3LBAA 3BL6A 4TS3A 3EUEA 1Y6RA 2A0WA 2I4TA 5CYFA 4DAOA 1JE1A 2OXFA 4KN5A 1ULBA 1I80A 1Z38A 4U2KA 1PK9A 4H1TA 4WKOA 5F7JA 3MMSA 3FOWA 4LNAA 4M3NA 1QE5A 3OZDA 3KVYA 4GLFA 3IOMA 1T8WA 4R2WA 3NM5A 1YBFA 1PWYE 4DARA 4YNBA 4E1VA 1RR6A 1OUMA 5F73A 1V3QE 4LKRA 2BSXA 3FNQA 1RFGE 4YMLA 1LV8A 5F7ZA 5CCEA 3IEXA 5F76A 4D8VA 4JWTA 3DF9A 4L5YA 1V45E 1Z39A 3SCZA 4F3CA 1T8RA 1Z35A 1ODKA 4QASA 4DA7A 1PK7A 4OF4A 5CXQA 1TCVA 1JDZA 2ON6A 4D98A 1Q1GA 4MCHA 5ETJA 1NC1A 1V48A 2QPLA 1V41E 4EARA 4MARA 1B8OA 3OF3A 3P0FA 1JDVA 4X24A 5B7NA 4PNPA 3U40A 2QTGA 2OC4A 1PR6A 5KB3A 5FAKA 1RSZA 2A8YA 1SD2A 2AI3A 4FFSA 1JDSA 4BMZA 1T8YA 4R2XA 2ISCA 2HRDA 4QARA 4BMXA 2HSWA 2H8GA 3OCCA 5CCDA 4LDNA 2AI1A 4TTJA 5B7GA 4OY3A 1RXCA 1WTAA 1PR5A 1G2OA 4DABA 4TXLA 1A9PA 3BSFA 2QSUA 4D8YA 3EUFA 1TGYA 1PBNA 4OGKA 3TL6A 4ECEA 5DK6A 5IFKA 1Y1TA 4QFBA 1U1CA 1CB0A 5K1ZA 1PW7A 4PR3A 1ZOSA 2RJ3A 3KVVA 5EPUA 2HWUA 4F1WA 4D8XA 1U1GA 4GMHA 3GB9A 3E0QA 1K27A 3D1VA 3FWPA 5F78A 1U1EA 3K8QA 5F7OA 3FUCA 1M73E 1PR1A 1V4NA 4TYMA 1SD1A 3KU4A 4G8JA 1PR2A 4JOSA 5B7QA 3DP9A 1Y1QA 4TTAA 4TTIA 3OPVA 1OTYA 3FB1A 1Y1SA 1A69A 4YJKA 1TGVA 1RXUA 4NSNA 3FAZA 4IP0A 1XE3A 4QAQA 5I3CA 5F77A 3OZCA 1ULAA 3E9RA 3ONVA 1Z5OA 5IU6A 3C74A 3F8WA 1RCTE 2A0XA 3OZEA 1K3FA 1RT9A 3NM6B 4TXHA 5EFOA 3PNPA 2XRFA 1SJ9A 1PR0A 1Z5NA 4F2PA 1JYSA 5EUBA 4MCIA 2OC9A 4P54A 3PHCA 1N3IA 3EEIA 1YRYE 1Z34A 1VHWA 2GUWA 4G41A 5CXSA 4M1EA 1SQ6A 3OOEA 3UAWA 1PKEA 4DAEA 1T0UA 4WKNA 1JPVA 1LX7A 4L6IA 3DJFA 4G89A 4WKCA 4TXMA 4L5AA 2QTTA 1OV6A 1JDTA 2P4SA 1NW4A 4TXNA 4GKAA 3BJEA 1Y6QA 1JDUA 1YQUA 1JE0A 3UT6A 5CYGA 3EMVA 4QATA 4LZWA 1FXUA 1TD1A 4UC0A 3ODGA 4OGLA 3KHSA 1YR3A 3QPBA 1A9SA 1ZL2A 2AI2A 4RJ2A 1C3XA 1Z33A 4DA8A 1OVGA 3O4VA 2A0YA 1VHJA 3INYA 3P0EA 4WKPA 1RXSA 3DPSA 3LGSA 1RXYA 1LVUA 3LA8A 5JPCA 4DANA 4F3KA 1ODIA 1A9QA 2I8AA 1V2HE 2PGAA 2QDKA 1ODJA 1VFNA 1JP7A 4OEHA 3NM4A 5B7PA 1Y1RA 1A9RA 2Q7OE 1A9TA 4NY1A 3UAYA 1OU4A 1VMKA 3UAVA 3K8OE 1Z37A 1PF7E 4K6OA 3E9ZA 1ECPA 2IQ5A 2OECA 4QEZA 4BN0A 4LNHA 3OZBA 1U1DA 1YQQA 4L5CA 1RYZA 4R31A 4L0MA 1Z36A 4EB8A 4NS1A 1U1FA 1PR4A 4M7WA 3ENZA 1TCUA 1ODLA 1OTXA 3DDOA 4OJTA 3UAXA 4DA6A 2HN9A 3GGSA 3KUKA 3PNSA 4I2VA 3O6VA 4GLJA 4WKBA 4DA0A 1K9SA 1NC3A 1Z5PA 3NBQA 1T8SA 3OOHA 3PHBE 4YO8A 3T94A 1CG6A 2AC7A 3UAZA 5C80A 5F7XA 4D9HA 3BGSA 4TS9A 1B8NA 3MB8A 4F2WA 2B94A 4BMYA 3KVRA 4TXJA
chains in the Genus database with same CATH superfamily
1KSFX 4J7XA 2ZBRA 1JDPA 3N86A 5CTJA 1G7RA 3C3YA 1XTZA 4G1BA 1XK7A 1JXMA 1TEXA 4ZVOA 4RVCA 1OBFO 2XX3A 3CEJA 5I5GA 3HNPA 2CDAA 3R9XB 3EWIA 4WZBB 2PWAA 4WOJA 1RDFA 4PLGA 1SUFA 4E13A 1OXSC 2VDUE 4IINA 1DUIA 1ZEMA 2A0WA 2H5LA 2X6QA 1DAIA 2PGXA 3KUDA 1ORWA 3G02A 4OH1A 3RU9A 3LC0A 3DOJA 2CHUA 2DTDA 3PUZA 2YW2A 4BAGA 1WKBA 2Z6VA 3BMQA 4P3XA 5JWRA 2GTIA 3DQQA 2H7XA 1QM5A 1XDUA 3BTUA 4J6FA 3FNRA 4YLEA 1QHGA 3BL5A 5IKXA 4Y9DA 3V4OA 3ZR4B 4PTYA 2Z5LA 4EJSB 1P1RA 1Y8CA 1A1SA 2R5NA 4MHOA 2D2EA 3WBKA 1N5MA 2IY8A 4HH4A 4TRRA 1MENA 2YQ4A 3W7BA 4ASUA 5KTTA 3I3OA 1ZNXA 3UJ3X 2WPDD 2QM0A 2D6FA 2O1WA 4ITVA 3T7EA 5EGNA 1IN7A 2FEMA 2JEOA 1C1HA 2GBLA 3TEMA 3R5XA 5C8YB 1K8XB 3R5SA 2Y2VA 2Y6UA 4PWYA 3E5HA 2P2NA 1GAWA 3KSZO 1DRKA 2NSHA 1I3MA 2A6PA 4WA7A 5BV8A 1I2MA 1ZH8A 3ECAA 2NVBA 1B4DA 3NVMB 2GJSA 4MWEA 5IPFA 4FI3F 5CEEA 4D4IA 2V9PA 4MQFA 2JAWA 4JLWA 3WQBA 3B70A 5FI5A 1IIRA 3FCXA 2H4ZA 3IIMA 1FFDA 3PTLA 3EPJA 4A92A 1DKLA 1OLUA 1BXRB 1M83A 5K2OA 4PYQA 1V3VA 2AMYA 3IJEB 2V0CA 3O7WA 5E95A 2JKYA 3QEAZ 1BWPA 5ALLA 4UUBA 2LBPA 4TKVA 4FOSA 1DKRA 2VRCD 2ZB2A 4RIHA 1YONA 2VTBA 1JWLA 2PS1A 4AICA 3N9IA 4WXPA 4KE7A 3I6MA 4O4IA 1NBOA 2I34A 4RIEA 1YB6A 1UJ4A 2XITA 2KHZA 3CSUA 3LQYA 3BHMA 4M46A 4YMLA 1FTNA 3CWZA 3O9ZA 1ZUIA 3QWBA 3NOQA 3L7KA 5EHIA 4ITUA 4MWZA 1ZK1A 5F7ZA 2D5BA 3USZA 4ARZA 1Q16A 2J7KA 4FDVA 2UXBB 1RPTA 1I0ZA 1FQJA 4A6XA 2VO1A 4O2LA 1VA4A 1XZFA 4N0QA 4G1VA 4B40A 1Q74A 2BKXA 2WWHA 4MICA 1OGJA 1O94D 1BX1A 2DQSA 3ANTA 3RYFB 4INOA 1GZUA 4LE1A 2K87A 5HTOA 1TX4B 3WMWA 4DA7A 4DDVA 1OIVA 1LTQA 3PFKA 1K8QA 2CVQA 3SKXA 3U44B 1GQSA 1VSVA 5IN4A 1E9BA 1JQDA 4RIGA 2O0MA 3M4YA 5FUVA 1XYGA 2FZEA 1KNXA 2IYWA 3BXGA 3DZGA 2H4JA 4P84A 4UOZA 1Z0ZA 3PFGA 3V7NA 2HT1A 5C1BA 3TSYA 4ZKDA 1IBCA 2IYSA 3PJFA 1KETA 1USKA 3RS9A 3OLQA 2ONYA 5G0TA 3S8YA 2RKBA 4R2HA 1ESEA 2JK1A 1F48A 4US1R 3TZ6A 4BNIA 3CLSC 1Z06A 2H2DA 1BVYF 1ZY2A 2ZJYA 4FFNA 5L3VA 4Q4JA 2W2PA 1J0CA 3KB1A 1DIGA 3EDCA 3EZNA 3R3WA 1XU4A 3GUZA 1EVIA 1IWOA 1P5ZB 2ZB3A 3D7RA 4EHJA 4QQRA 1HPLA 4PQFA 1Z12A 3VPHA 1NJ8A 4XFJA 3U39A 1KRWA 1CUAA 3Q4GA 2M2IA 5BN4A 3ILXA 1KQOA 4UEOA 1P4JA 3JQCA 4JIMA 3ZX4A 3K16A 2I80A 3RVSA 3U0BA 4E03A 1TCAA 4L73A 4YRBA 2CJXA 3OQBA 3R3SA 1FP6A 3GH1A 1Z47A 3NNDA 3OZGA 2BE7A 4G4SP 1U9YA 3WGYA 4FYXA 1JFFA 5KNBH 1QHHB 4YJ3F 4E08A 5HJ7A 3KFLA 5FUYA 3FTPA 4L1KA 4ZYLA 5H9WA 3PT5A 3OOWA 1CSEE 2JBAB 4Q47A 2AE2A 4Q37A 1J5XA 5C53B 2FMKA 2H4HA 2GN1A 4KPYA 4NBUA 2CW5A 3GAAA 1KHHA 5EHNA 2I7XA 1EK2A 1ZN9A 3A8TA 3HACA 3NYQA 4IMJB 4ME6A 3M4NA 4Q7MB 4G09A 1NATA 4AXXA 3ECSA 1U0NA 3W2TA 4F5WA 1A8IA 4EHLA 5T67A 4JL8A 2V5VA 1QDUA 2OMEA 3Q0IA 1E1RD 1JEEA 3R3XA 4KC0A 3VYVA 1PZHA 1T6YA 2JIPA 2P0AA 1PNRA 4U2DA 4AMYA 4B3IA 2DXIA 2JVJA 4XAQA 1EGAA 4Q66C 2HZBA 1ETUA 3H6HA 5DBFA 3ZG6A 3UJAA 1UF9A 1Z6YA 3FCCA 2O8FB 4EMUA 3JD4A 2P6UA 2DH5A 3AWDA 2OCXA 2ZKLA 2F9MA 5FUBA 2IOHA 3GG2A 3IE2A 4OXXA 3NHMA 1YZUA 4ZQGA 3G3EA 1UZUA 1H85A 4I5FA 1DT5A 4OLHA 5C8VA 2OVBA 1OI2A 2RJNA 2VWGA 4OYYA 1NONA 3K0FB 2GI4A 3CV3A 3E1KA 4KQCA 4IRXA 3ILVA 2A4KA 2EYUA 5F35A 5AT1A 2AN3A 2D00A 3PLRA 3ADKA 1PRYA 3PC8A 2K7ZA 3ZZUA 4UKDA 3IR6A 2J0QA 1I2CA 2HBQA 1ILEA 1YS1X 3F2IA 1O6ZA 1PFYA 3E82A 3P9NA 5AQ1A 1V4VA 1X8JA 2AR0A 4PZUA 1Z2CA 2X2EA 1UKEA 2FSVC 3E81A 1YC2A 2KX7A 1A71A 4IGKA 4LMPA 4MI1A 2YZMA 4X92A 2HWUA 4M1MA 4I1IA 5FFFA 4J43A 4Z51A 2VWHA 2WM9B 1MEEA 4B81A 2BGKA 4XPZA 1SY7A 2D59A 4OXRA 1CS0A 1DRWA 4PRZA 5E2AA 1B42A 3HGTA 2GPAA 3ELWA 4H6VA 5EPEA 4UPEA 2DUMA 4CETA 2Q21A 4KJXA 2DWPA 1EAMA 1IN1A 4URFA 3MQ2A 2BM1A 2I4IA 2YV3A 3OQIA 3VSAA 2ZI9A 3TKAA 1C41A 1ULSA 5CIYA 3QG5A 3QFHA 5CGQB 3WB0A 3HB0A 2REQA 1IQ0A 1K6IA 3O8NA 4HB3A 5D85A 4N7RA 2FYTA 3I9FA 1KDTA 3JYQA 4XWGA 5LYJA 4XXHA 5KYVA 4C4YA 5FV4A 5HP4A 3BMQB 2AYYA 2F9LA 3CLRD 3UQZA 2VJOA 2BLNA 3WL8A 4HNTA 3OBIA 1V4NA 2NLOA 2VAPA 1LWNA 2FW6A 4G4SO 2L0XA 4IIVA 3THRA 4BLPA 4RHXA 3QOXA 5IKMA 3WO0A 3HJHA 2BFMA 2VRCA 3GIDA 4RH3A 3PTAA 3ZV4A 1B0PA 1R0KA 5K3CA 4MKRA 1E3TA 2VP4A 4H7KA 4Q15A 1N8TA 5DTIA 1BN6A 2XUKA 3Q41A 1Q6ZA 1DQNA 2ZVQX 4HRAA 4RKWA 4CHGA 1NQXA 3WIOA 4KL8S 1UK8A 4EGCB 4CMIA 1LC0A 2IEZA 1XZBA 5F51A 2R6R1 1SVIA 2B5OA 3FJ1A 5CLHA 4U7DA 2XB2A 1KK2A 1NBWB 4ISBA 2HA7A 1K8RA 3ESBA 1O95D 5DYNA 3LKVA 4EYEA 3H1AA 4JBLA 3LF1A 3WWPA 3EXAA 3OM1A 1FUUA 2Q7XA 4CMKA 1KZ4A 3ND6A 1PK8A 4HQLA 4R84A 1H2YA 5I5EA 1SCDA 4UARA 1NJFA 3Q88A 1IU9A 2L17A 4X1YA 1XELA 4QJ4A 5LP6F 1JVSA 1VG0B 2FSHA 1PJAA 2NSYA 3BB1A 3MJDA 4KXFB 4Y98A 3EW7A 2HF9A 3ZJ4A 4M0CA 4R8VA 5ENZA 1H1DA 3C1OA 1P2BA 2I7TA 2GZHA 4XX0A 2C8KA 1RJGA 1T6ZA 4QUJA 1E3MA 1XROA 5IM4A 2RAPA 5G4LA 2ZRBA 4NU5A 1RWXA 4OREX 2MSDB 4RS4A 3V3TA 2JFFA 2GUGA 2QROA 2CUKA 5BV7A 2HL6A 1BYIA 4DVGA 4R69A 2IDKA 3ILYA 2XF8A 1BCSA 4RS3A 1JW9B 3WSVA 2VHVA 2DPMA 1JAXA 1MLDA 4PLWA 3IERA 5EE1A 1HDGO 1Z3CA 4Y9SA 3IBSA 2WTAA 5CMLA 5E7IA 3RC2A 4MCIA 2OO3A 1Y3DE 3UMCA 3ONFA 1JNXX 3IGFA 1CQPA 1KYQA 1H5UA 3QHAA 4NWIA 5KHAA 1IMJA 3LBNA 2JGFA 1MOPA 4A16A 3AFGA 1QAMA 3MJFA 4HATA 2W2LD 5FOXA 4QJIA 3K9GA 5IH7A 1BNCA 1KEZA 2QQ0A 4AJKA 2Z3WA 1DQSA 2RC5A 5EJIA 5LUAA 4K46A 1KY3A 4CCSA 3G0IA 1TJNA 3QP9A 2Q5FA 3HJFA 4D56A 2GAOA 3GZTB 4YRGA 1GCIA 1NI3A 1TU3A 2I3ZA 5JRJA 3SC4A 3J80A 4UOQA 1NN0A 4NJMA 2W2XA 1BVRA 4S1OA 4AAYA 1UT8A 1ULHA 4X94A 4GMGA 2P9QA 3KL4A 4B33A 5B6PA 3A4VA 2ZRAA 2OWDA 2QAIA 1JVBA 2QSJA 1MC4A 2IXAA 2O1EA 2QN9A 3PPVA 4LPSA 4AD8A 1WETA 2OYCA 1RNLA 3RODA 2EERA 4DCUA 1NNEA 2QBYB 1BJRE 1SCUA 2R8XA 5HOEA 2EFHB 3PX7A 5EOVA 1JDTA 1PLKA 5DH9A 3T9DA 2XUZA 4G0VA 1WEHA 2C1ZA 3BTVA 4YUVA 1XTTA 3SG0A 1XCPA 4OXQA 4QT0A 4QEDA 3WDSA 3L6RA 2BBWA 3GMDA 2F3RA 3LQRA 1E4EA 3PC7A 4PW0A 2BM9A 2X8JA 1G19A 3I9OA 3AZQA 3OA0A 3RM3A 5FI3A 5LDGA 1Y8AA 3WLTA 1ZGCA 4IDNA 5LSAA 1RVV1 4A73A 5I7RA 1X1EA 4QU0A 3AF3A 4U8GA 4YBZA 1FX0A 3D1JA 4QRHA 2SCUB 5A04A 1QFJA 1EGHA 3ILSA 1EDEA 4YUAA 5JJCA 4CT5A 2GN9A 1HGXA 1XD9A 2K2WA 3GBVA 2PVCA 3DM9B 1C4KA 2HCJB 3H7IA 5D5HA 3ZDBA 1GSOA 2GCIA 2PV0A 3G23A 4UXJA 1D2HA 1UPTA 2YZKA 5FB3A 2I87A 4CHTA 4JI0B 3GDGA 4JZYA 5LLTA 2HA6A 3D1LA 3UUFA 3WGMA 3H5RA 5BOVA 2AVNA 1DEXA 1W0JD 4H59A 4PX5A 2WF7A 5CM8B 3KEQA 1A7JA 2QTNA 1TRKA 2ZAGA 3V4FA 4BV2A 2OFFA 2AL7A 1HV8A 1PTJA 4ZU3A 2O8FA 1AGXA 1D1PA 3ZWWA 3KWMA 2A0YA 3KZNA 3CLTD 1TQ2A 3V2IA 2PRYA 3DKPA 3OI7A 5KREA 1XCBA 3L1IA 4WSOA 4CT4B 3RVPA 3SLRA 4DXDA 2WR8A 1R12A 2ZSKA 1RXSA 3BS4A 3AF4A 5EQFA 1YT5A 1SOVA 2H7CA 2VDLB 4P98A 4NZNA 3KNZA 1QBKC 4RH1A 3RC3A 4CG2A 4DV6B 1A4RA 3E3OA 4PLTA 4ZEOA 4XWTA 4N5NA 2YYSA 4F5ZA 3MGGA 1D03A 1VIDA 4E09A 3G2IA 2QRPA 4C4ZA 1P0FA 4BO9A 5EJMA 1WULS 1SZCA 4RK5A 2ZJ2A 3NRJA 3F6RA 2LNDA 3FGPA 3RWMB 1TLFA 1HKHA 5TGDA 3RV3A 1JH8A 1ZW6A 2EJBA 1UZAA 5B36A 3QPUA 4C07A 4AYWA 1F4VA 5KTRA 3BH7A 4MRPA 4JB2A 4CL3A 4ZQHA 5LQNA 4ENPA 2QMOA 3JWIA 1PWHA 2PGNA 1YO6A 1C0LA 2AA3A 1ZM4A 3JQ7A 4FLEA 3OJCA 2NXEA 4QOFA 5A9SA 1Z18A 2PX6A 1B0ZA 3L4SO 1C29B 5KKAA 5E9AA 3T4XA 5DGHA 4HC4A 1U65A 2ZWAA 2RHCA 1INLA 3HZOA 3LC1O 1LPNA 3QLUA 4KAFA 5LQSA 3ZWOA 4RGYA 3KVOA 5B30A 3IALA 2CZQA 3A1WA 2VOJA 1APBA 2I7CA 2XB8A 4ER6A 2POQX 4YRLA 3JY6A 4O4IF 4S1PA 1U7UA 2CNLA 1UDXA 2VF4X 1QKKA 5JC8A 1W2GA 2PGIA 4LK3A 1U1FA 1S2DA 3M6XA 4URZR 4CKCB 3EEYA 5L4LA 3D3EA 5DU2A 1YNSA 2JHPA 4LBVA 1T9DA 2DY0A 4QXPA 1ND5A 3IUBA 2XJ4A 3W5HA 3TXXA 5B12A 3SHOA 3DDOA 3OIUA 3QMWA 4PHFA 5TR9A 3DOUA 4E22A 4F6RA 4IY1A 4RULA 1OAKA 1W94A 1SB8A 2QRLA 1J97A 2EU8A 2HRCA 3HV0A 2XWSA 3OQVA 4IH4A 4CDMA 1P77A 5HEKA 2W71A 4K6MA 3ZY5A 5DLQC 4ML3A 1N9ZA 2R8YA 3INNA 4TKMA 3MAAC 3U4MA 4WQMA 3GVHA 3DDSA 1ZMBA 1B1CA 2FMHA 2R86A 2X7XA 3EGXA 4DDWA 5JS1A 3GFBA 4E4YA 1RCUA 3C48A 3OZRA 1G2PA 4R1LA 4UM7A 5GINE 4F92B 2Q2QA 1ZQ1A 3KR1A 1CNEA 1JSXA 2E48A 3ESZA 5AKKA 5HCUA 3ZLBA 3EH1A 2WA2A 4K1XA 4PLCA 5K0GA 3JATA 1N2IA 1XLTA 3A4MA 3ILHA 4TMZA 5T4EA 3TDKA 1UJ5A 4N01A 1B26A 4UUQA 4UZSA 1IOZA 1LPAB 2FWMX 5IJ0A 3NIDB 2R6ZA 3C7TA 4MP8A 1G3UA 4J90A 1DCMA 2B94A 2FPLA 3G2QA 1C8VB 3QUSA 1O0SA 4Y2XA 5HCIA 4E32A 1U0GA 3BN3A 3C4QA 3AW8A 1ATZA 1SOMA 1DB3A 3QLJA 3L8CA 4DSTA 5B57C 4JP2A 3E5RA 5I3ZA 3QKWA 3F49S 5I4KA 2QD1A 3LZDA 2AFIB 1SBHA 4UOEA 3GQBB 2BFFA 4Y0VA 1GUYA 5CJJA 3KQOA 3JQFA 3TQRA 1Y6RA 1E1RA 4CR6A 1FP2A 3UMRA 3RS2A 1VLLA 2IYQA 1NPTO 2XNCA 2LDBA 2O3QA 2XA1A 1HI9A 4P83A 2COEA 1Q0UA 1XQYA 4MA5A 2Q5OA 1F2TB 3ZBUA 4KN5A 4IZHA 3AV3A 3B1KA 2NTNA 4XZ3A 1KZYC 1X7WA 2G9QA 2R7MA 4WTOA 1U8UA 5I9TA 3VV2A 3PYXA 5BNTA 4G86A 1PX0A 3CYFA 2A5FA 3JTEA 3MWKA 4R1TA 5AXBA 3SHFA 1E2LA 2F2TA 4RCVA 3K0SA 2C9OA 2OZPA 3LQQA 3T12A 3DZKA 3HXPA 2O2CA 2YIMA 2W2TA 1RYEA 3ZV5A 1BA2A 2AS0A 3OCXA 4QVGA 4D99A 1UINA 4P4TA 1KH2A 2ZLBA 1Z6XA 2ANCA 2ZB7A 4HI0E 2ZTMA 4PO8A 2NU7B 3KVYA 1KFEB 2JJ1A 3FHLA 1XK6A 4E2FA 5LLDA 4L27A 3B1YA 2JJ1D 4LRSB 3WK8A 4DV7B 1ONPA 5H5JA 3F7NA 4PIPA 1UBLS 3SHVA 5KSWB 3QXGA 2X2FA 1TQ8A 2YY6A 2ZP1A 4CODB 5A0VA 2IHBA 1MXFA 1OAOA 1SCBA 2M9MA 5DT2A 4IOMA 1NJGA 1XIVA 2F1OA 4DIOA 2CN1A 4MV8A 4TGLA 5LJIA 1H2XA 3GROA 3ISTA 4HX9A 4R7ZA 5DIFA 3ZU5A 3TXYA 4RYDA 4E94A 4B4DA 1NQVA 2C84A 1R2QA 3WYNA 2I78A 1OF1A 5DXFA 5KOYA 2PGJA 2YH2A 3D6NB 3R3HA 3FMGA 5KYNA 4MPTA 4Z1MA 2C2WA 3HO1A 1X1DA 2HLHA 2QTWB 2Y1LA 5FBQB 4XUCA 1PG0A 1CZLA 2G6TA 4CR8A 1U0EA 3E3AA 3M2TA 4G85A 4KZPA 5BNZA 4XYEA 2DSNA 3KE8A 2UKDA 1N6RA 3UHAA 3OX2A 5L4NA 1CRZA 4D0LB 4M7OA 1TQ4A 3DL7A 3WGJA 1CHNA 1T3HA 2NO5A 3DCJA 1TKCA 3FRHA 1N32B 2IPAB 4KPUA 4M1QA 2ZRPA 3SQMA 5CXQA 4U63A 3IE0A 3M9XA 4DADA 1GKIA 4L75A 2FVXA 2O8VA 4EI9A 4B3RB 1XVUA 3CX6A 3LT1A 4LJYA 2PD6A 5A4IS 5IANA 1N2OA 4Q1BA 5EEGA 5BR1A 2AG0A 3AT1A 2JPDA 2ZU6A 2AJ8A 2O5VA 3JVEA 4KPFC 3ZXIA 4DZTA 2ALJA 5C8DA 4KR2A 3WNCA 4JGIA 3ND9A 5MGBA 2Y1DA 5LOVF 2PQ6A 1EFKA 4G07A 2G80A 5AICA 1NP6A 1DXQA 1I5EA 1M34B 4R1UA 2DHCA 4FDMA 3H9UA 1Y48E 3E4DA 4TWZA 1RSZA 2A8YA 1OA0A 4AZSA 3M82A 3QPWA 1JH9A 4Z6KA 3PKZA 3L8GA 4W5QA 4BP1A 1AUVA 3WSWA 4ATNA 1AUPA 1SN7A 4MYTA 2JLCA 1PGQA 5CLJA 1OILA 1QG6A 1SBYA 2C8VA 4QXMA 2YVLA 4TYPA 1JYFA 5L3RA 2H1VA 2IYLD 3OLXA 2ODQA 2H1FA 4ASUD 3V2GA 1T3TA 4WT7A 1SUSA 3K6SA 1GUFA 3RRJA 3GJYA 1RHQA 2JAOA 4R2XA 3IPLA 5AJXA 4ZEVA 2WIFA 5JDCC 4Z4QA 3ESXA 1EDOA 4GZLA 3AINA 3S2YA 1KI2A 2FZWA 3MJHA 3TUJC 4HUTA 3WB1A 1NJ2A 3L8HA 1G20E 1JYEA 4ZT4A 4S24A 2BSQA 2JD1A 1AN0A 3E2MA 1GPKA 2SBTA 4FMDF 4QSHA 5C7LO 4LWQA 5JLJA 3I4FA 4AQ7A 5HTKA 4RSGA 3I32A 2DTEA 1OFUX 1K7SN 2F8TA 4BNWA 1XEWX 5JI2E 1DKQA 3K5PA 4MW9A 2D7CA 2ZBPA 1E6KA 4FMDB 1HWYA 2PUTA 3UMGA 4EY5A 3TJRA 2O54A 2NZJA 5FV7A 1D6SA 3E23A 4R1NA 1X42A 1M9NA 4OGKA 3TL6A 3CLUD 3L6OO 1XPRA 1U8XX 2P27A 5KPDA 1XA4A 3L92A 2OSVA 3BSWA 1LY1A 4CNQA 3GG9A 5JSZA 4CDNA 1V96A 2AZ4A 1C80A 1QG0A 1QIDA 1V8PA 2DUJA 2V4MA 2V6BA 3C41J 3GLKA 3ZD8A 2UYHA 4EENA 3FPCA 2AMVA 3GEIA 4Z3OA 1IPFA 4F1JA 4CTMA 1KFJB 5JXWA 3GPDG 5HJEA 3IHKA 1VECA 4D3FA 1MO3A 1W49A 3IQDB 1Z62A 1QFXA 1G20B 2J32A 4IH1A 1RKBA 4IL5A 4EKGA 5B6IA 1SHZA 2D1SA 2OT3B 2GJKA 1V8BA 2IITA 3EQ6A 3LYHA 4V3BA 4DLBA 1AS3A 1SG6A 1WP4A 2PWYA 4NPCA 5EJ2A 1O5OA 4PX3A 1NUSA 5A0FA 3ZEAA 4BASA 1BU8A 1QKIA 1WEKA 3S8MA 2XE8A 3D8SA 2G8LA 3L01A 1N8NA 4EELA 3LWBA 3ZE2B 2B5WA 4DJJA 2ATIA 1MB9A 3JWEA 4GNKA 1Y1KE 4E5DA 5BRJA 3EQZA 2ZUVA 4QDKA 1IHPA 1JT2A 3B6KA 2GKSA 4N6NA 4KNYA 2ZI7A 4EJFA 2GILA 5JH7B 3AX6A 4Z9XA 3ZNQA 5HBGA 2RAUA 4ZQBA 4JELA 3KB2A 1E77A 4M4SA 1EM8B 3C3JA 1YE5A 3KQWA 1SEVA 4GS5A 4Q93A 4QTTB 3FZGA 4FMBB 4RF2A 4DMMA 1EXDA 2MR5A 3CR8A 2BEUB 4LY9A 3E22A 3HV2A 4D9IA 5CVEA 2F1JA 4ZV7A 4JR2A 1C9EA 3Q2IA 2CJWB 1Z56C 4Y2RA 2FH5B 3LLSA 2JFPA 5I7UA 2F1HA 2ZS8A 2P9JA 1ZVMA 4F9EA 1B0AA 3TLXA 5HQTA 5DHFA 3C8HA 2PKQO 2V4UA 1EUCB 2E4XA 4QJBA 3U7EB 1B1AA 2OG1A 4JGBA 3RUAA 3IX7A 4KBYA 4TTIA 4MUAA 4F45A 2V6GA 4L4SA 1RWMA 6AT1A 1I7QB 3BVPA 2JFHA 5GZ6A 4BAUA 3KSRA 3V00A 2D1YA 3C70A 2Y71A 3AHJA 2XGMA 3WLIA 2BP7A 3MFQA 2H51A 2DWCA 4BQOA 2CXSA 1TZBA 5BYAA 2JF0A 2WEKA 2VK8A 1KJJA 1QYWA 1OASA 5DBIA 2UAGA 3NV7A 4HN9A 3E9RA 1LZKA 3NQ41 3FFWA 4BNZA 2IYYA 3EXFB 3NRCA 4DF3A 4I46A 2C7RA 4QQKA 4M53A 1B41A 5KYYA 2XHEA 2XTNA 1PTKA 4BKPA 1KS2A 1G1AA 2JJ2D 5AHKA 2WHEA 5H1YA 2JLBA 1P75A 4BB0A 4CF7A 1CJCA 4Z4HA 3C3EA 2XT9A 5MN4A 3A6FA 5FTMA 4BLRA 3ZOZA 1FRVA 1BE0A 2QL6A 4NYMR 2WJZB 4YI5A 4HDSB 3O1IC 1X70A 4WOPA 3EIEA 3HA5A 5EESA 5FUQA 3IT2A 3AVTA 1UP6A 3A9UA 4F2PA 2WB2A 3JD0A 3ML1A 5CFLA 4UW9A 4R5MA 4Z5XA 3W8NA 4R8LA 5DM4A 1FFGA 4OGGA 5TJ9A 4EFKA 1YVDA 1IHDA 4RK4A 4RPJA 5MFZA 1YSCA 1OH7A 3TH5A 4ZI3A 5ISMA 1EHYA 4AWXA 2VNSA 4LG1A 1KC1A 2A7XA 2XUJA 2J5XA 3B5JA 3RUDA 1W36B 4ZYXA 3PEWA 3ABQB 5ULLA 1TD9A 4R3NA 2PNJA 4CL2A 4OD0A 1U0SY 4EY8A 4ER7A 1MDBA 1WXGA 1SAYA 3GEHA 4Z99A 1WW8A 3STHA 5LCXA 3QFFA 5EKXA 3COPA 3FG9A 3WHPA 4DCPA 4P3YA 2GCGA 1X80B 2ACVA 2GGSA 2CJFA 2VBFA 3NJ4A 3TZLA 5A3RA 2WC1A 1GFZA 4H7PA 3O3OB 2PRIA 1GRQA 1RJ9A 2FOXA 1RAAA 1T13A 3D8TA 4AMGA 1ZKMA 1H1LB 2WKPA 1VPWA 5JCZA 5LKAA 3IUSA 4XJTA 1KYWA 2AFIE 3MIZA 4TT8A 4TOIA 3WY9A 4C05A 1WMBA 4LZAA 3RFFA 2MJLA 4DOMA 3HP4A 4TVKA 4R2IA 5EGSA 1IZ9A 2HMVA 5G0WA 3TFOA 1VIYA 4JMPA 1BJKA 4GKAA 2G5TA 4I5EA 4XASA 1GG9A 3NX4A 4KVAA 3TLMA 3O8BA 4W1SA 2XYVA 3OM8A 4F4UA 3L8EA 4AB1A 1WU7A 1NURA 4O02B 4PLHA 5K03A 2VHCA 2Q45A 5CYGA 3TD6A 1J5PA 5B2FA 2YR0A 2B4TO 1QV7A 4O4JF 5EKDA 3TRKA 4TKUA 5G0SA 2VL7A 2XVXA 2H92A 3AR8A 3FMVA 5HZHA 1OX4B 1DVRA 2OUKA 3F6SA 2R00A 4NJOA 1PWZA 4F9FA 4OHOA 1GY8A 2CCKA 5IC6A 1AD2A 3QPBA 2JHCA 2W6IA 4XD7A 4AUMA 3AM4A 3LPNA 2O9JA 1X7DA 3IUPA 1USIA 2JANA 3DLIA 1LRJA 2I3DA 5E6UB 3LOUA 2NO0A 1IDN1 4DSAA 1N57A 3B9RA 4ZO7A 4QT4A 1O03A 4GZ6A 4IHJB 3ESDA 3EARA 2O3SA 1O6GA 2P2CA 3FDZA 1Z0SA 3AFMA 3EODA 3NGMA 5FIUA 1TVEA 3DPIA 2AG1A 2JFWA 4QBFA 4QDUA 5M3BA 2CLMB 2PQ2A 4LDJA 2VYVA 2FN7A 2NV6A 4H17A 3A1CA 3X1WA 3QOWA 3ASZA 2HPZA 2P4UA 3G6WA 4P38A 5HIAA 1QHFA 4YIHA 1XEXA 4DZRA 3EXG2 4JEHA 2HWKA 2VSYA 1SRQA 2OCDA 2PBRA 3NOVA 1AO3A 2IEIA 3LIPA 2HQRA 3QVOA 5I7HA 1N6OA 1AKNA 3PGLA 4G4GA 1X9GA 5SZKB 3EJWA 2Q0SA 1JIJA 4OEHA 4J7UA 2Q07A 4OI0A 4ZVTA 2DBQA 2I6GA 3PGKA 1BEZA 4RDXA 2OHJA 1D2AA 3LYAA 1JZSA 3ZQ4A 3QE9Y 3TG2A 4EPVA 1MO2A 2X23A 4FSHA 5FNVB 3UYKA 4DM4A 3GLQA 3SEAA 2XT0A 3H17A 3NDPA 4J1NA 1DC8A 2CMHA 4EPTA 2ZYTX 3H83A 1SUEA 2X8AA 2XLCA 3PXAA 1HQYE 3IQEA 3QEKA 4P7KA 4TN5A 5CNMA 1XHEA 2J0UA 4QEZA 4YQYA 3JR7A 1JXQA 4DPLA 5FJIA 5C32A 4MRSA 4ZI2A 2CXUA 2G71A 1SPXA 3BXEA 4RHCA 2PMCA 1SKMA 3M2PA 4L5CA 1NSFA 1MFPA 2I3GA 1J2EA 2EKDA 5EIEA 3PHLA 3WXMA 10MHA 3S55A 2G8NA 3DR5A 2IS1A 2BEUA 1PZNA 2CFOA 1U11A 2KW5A 4P22A 5KVVA 1ODFA 4UNQA 3DWEX 2WABA 2VSOA 5KTMA 4IO0A 3KM0A 2WWYA 3CRRA 3G8CA 1A50B 4FEEA 3CUWA 2O8EA 1EQ2A 1M2GA 2AXQA 2OHIA 3CEHA 3EEFA 4IX1A 1OTXA 1FK8A 2GR9A 2NX2A 2W0MA 1EFPA 4OJTA 4ARCA 4ZVLA 1X14A 1AF7A 1Z6QA 5FA5A 2C3YA 2A92A 1TYCA 3KZKA 4RW0A 3GGSA 1ZXXA 3PNSA 4FKBA 1DWUA 3GLGB 1Q1EA 2JI4A 2ZYSA 3LY7A 3FOCA 2WF6A 3WIEA 4JQCA 2LGJA 3G88A 1QG4A 1T3GA 1XN1A 4OAQA 4J2HA 4PC6A 4HS9A 4XVQA 1XMSA 1JIXA 1G3MA 1Z5PA 3SY8A 3WDKA 4ND5A 5LQUA 5DP2A 5H3LA 1U4SA 3NBQA 3AVXA 1W59A 3UKOA 1E7MA 3NBAA 3L79A 1LPPA 1XQWA 2C3UA 3M4JA 4DWWA 1KDPA 4PAQA 4YCSA 4YYZA 4LYJA 1YVPA 5AKEA 5B58C 3AM3A 6GPBA 1FNMA 5HSGA 5HVNA 3EF1A 3EXFA 2F59A 1AUOA 3A4TA 3OPXA 2DSTA 4EB6A 4CN9A 2VYQA 5ERYA 1N25A 3VPBA 4OG2A 1E98A 2TSYB 3VKVA 1XZKA 2OGUA 5J4VA 4DKJA 3DAPA 4WCDA 3TLCA 4V24A 4MR9B 1IAVA 1CZNA 2DWOA 3WIBA 4FU0A 1COZA 5KS2A 3HUUA 1JG7A 3LX8A 3DDCA 3HSKA 1BIFA 3WKDA 2E6UX 2IYPA 3ZQKA 2C2YA 3W3ZB 2CXTA 2VWPA 4ND7A 4YH1A 4G56A 1C30A 1O77A 1ZGAA 3SZLA 2IA5A 2LR0A 2ASEA 3BL6A 1NZDA 1EE9A 2IZ0A 3FSGD 3U09A 4OXNA 1IWPB 2JBWA 1XRSB 1LBIA 4M8SA 3B13B 1D7AA 4PSKA 4Y6SA 4YMWA 4F8EA 4ZZ3A 3ZJUA 1JBEA 2BMEA 2Q5LA 3EWAA 1G59A 2IHVA 4KDRA 3VDMA 1ISHA 2AKYA 2ZJ6A 4Q00A 3PC2A 4ENTA 4PM4A 1XZLA 2EHDA 2W8ZA 1WUIS 1G21E 1Q1QA 2HMWA 1R00A 1CQWA 2FZVA 4GPD1 1KEUA 1XLTC 4IHKA 4MIOA 4R9RA 4RKRA 4UAUA 1ZIPA 1EZ1A 2XECA 3MCWA 4OLFA 4TN1A 1Z63A 2HHAA 3CLSD 3VJMA 1Y9JA 3WGGA 1TZCA 4KAAA 1HUQA 2ZWPA 4KIWA 5DMXA 3VZDA 4MYUA 2YRFA 3G0GA 1DINA 1G5PA 4HAOA 3A6LA 3FOWA 1M1YE 1QVVA 4HJRA 2JRLA 2NT3A 1QE5A 2YUTA 2XWQA 4PHTA 1KE1A 3PR2B 1HEYA 2WHXA 3BF8A 4OUDB 1XZMA 1CVRA 1W4AA 2BJHA 1V5GA 5EUMA 5HFJA 5KOHB 4KI7A 1A9XB 1S02A 1S9DA 3FCYA 1VGVA 3NB0A 4EI7A 4PRLA 2VLBA 2F3SA 3F5FA 4N3NA 3O0TA 4WECA 1SRRA 4QUIA 4BNHA 3MOIA 4F2GA 3E3NA 2EKZA 1SOAA 4G81A 3ABSB 4PGGA 1P74A 3K3PA 2FGJA 1RZVA 5AKHA 1CIPA 4PHGA 1ISSA 1SU6A 2CK3D 4PICA 2H7VA 5NULA 2F43B 1FFYA 4B09A 3QUQA 4LCEA 3H42B 1Q1ZA 1ZZGA 2J87A 4DA9A 5A6SA 1TC1A 4X44A 3FZEA 3K4PA 2PUHA 5IZCC 3EUAA 1KEEB 4DPMA 1KOGA 2O57A 3K9BA 4KLRA 1CQIB 1QIHA 4GUDA 3BKXA 3SYMA 4ESVA 1RADA 5JJKA 1AG9A 3RS0A 3R0QA 4TLAA 1UPBA 5DB4A 1EWTA 2MT9A 2H1CA 4DR4B 1FDVA 1ZM2A 1B3RA 1M8GA 3GXOA 3GZ4A 2VT6A 3SX2A 2XMPA 5JD6A 1I5RA 1YCDA 3QWFA 4KWTA 3DTVB 4KWCA 5FPKA 3EC2A 3S2FA 5E6SB 1ENZA 1Q7RA 2WY2D 3R0JA 3IAXA 5FPHA 2HA5A 1NM5A 4B47A 3OZVA 1AKEA 2XMGA 4R81A 1P6XA 2JC3A 3LUFA 1CD5A 4DIDA 5JCXA 2QZZA 2EARA 1Q0QA 2ASVA 1I1HA 4DPKA 4KR3A 3M6IA 3ES9A 2IZ1A 4RM3A 3MTAA 3T7CA 1O97D 2XXBA 4BTLA 1Y4AE 4CM7A 4LFCB 1OLXA 4ARAA 8OHMA 5GVSA 1L4MA 1R74A 1PBTA 3CHYA 2Q8NA 1EIZA 1XTPA 5EXDA 5FBHA 3R7LA 4V2UA 4D82A 5DNWA 3K9NA 4PNPA 1GL9B 2JAQA 1LU9A 3E35A 3PXBA 2D5CA 2X2PA 1AHPA 2QT1A 3GLIA 5KSZA 3IBCA 1U4OA 4X20B 4JWKA 4M1YA 4L4RA 1RZUA 2BF7A 4OJQA 1CCWA 4Q02A 2AIRA 2OXTA 3RT9A 1L4UA 1TXGA 1TIKA 2YXBA 5JNRA 5KVCA 3LRPA 1Y42X 1VG8A 2O2DA 4RPLA 4OL0A 4YTEA 1FDIA 3ENWA 2R00C 2YBEA 2ZCUA 3GRAA 4S0ZA 3RYIB 1ECJA 2AG6A 3DO5A 3A9CA 3N8GA 4ZXPA 3SEFA 5DM0A 1GA6A 1YOVB 4GPAA 5BVGB 1UPXA 3QX9A 2B35A 2WICA 1NNSA 4CIYA 4GSKA 1ANKA 3BM5A 2Q3EA 2WVAA 2XVMA 5D01A 1PV2A 1U0JA 3KC2A 5C8ZA 2I6FA 2I6XA 3AKEA 1XRMA 3AFIA 1CWUA 4LJKA 5DCYA 3I1IA 4MV1A 4TQUS 1YU6A 1GZSA 4UJ5A 2QVXX 4BJ1A 1ZX1A 4LFBB 3GFQA 2X8WA 3JW8A 4PHCA 3HBFA 3K1ZA 3NASA 2OCLA 2AVDA 3KSDO 2HWYA 4HXYA 3AVVA 2YVUA 1UJBA 5CBKA 3AM5A 4A2CA 2OCYC 5A0TA 1IHOA 3R20A 1TF5A 3V97A 3RSZA 3OZTA 5E3JA 3EUFA 1DAFA 2UXCB 4ZTBA 1DPFA 4QGHA 3KV1A 4RTSA 5EJ8A 3T38A 3OZSA 1G8JA 1H8HA 2PV7A 3CONA 4XM2A 3ZQUA 4HGPA 1E9SA 4OAOA 4KWEA 4YVFA 4F4HA 5EP1A 2XA2A 4JQZA 4B8YA 3NHAA 3GFGA 4X1KA 4A8PA 2XTZA 2JI8A 1FMJA 2PY6A 3ZVLA 4DILA 2Q9UA 3AUJB 2R44A 4XDHA 4MMZB 1OLSA 2A4MA 2WFLA 3VGJA 2ZS9A 1SQSA 5LBIA 5EJGA 4J1TA 4RZQA 1L5FA 4MS1B 5AI8A 3R7DA 3F6EX 1ZU4A 2FMXA 3UXHA 4PPGA 4N47A 1E1YA 1U2RA 2BI8A 4BMNA 2R79A 3A58B 1QH9A 1D09A 2VLIA 3AR6A 1DKOA 3KPYA 2AW3A 3AESA 4MKIA 2DRIA 5IBCA 1VRWA 3IPXA 3DBVO 4KR7A 1TZ2A 3R0VA 2Y1XA 3MD9A 3NEYA 4XJXA 1OFUA 5ELMA 1FP4B 4Q4CA 1KEPA 4YT8A 2HREA 1EHCA 1R9JA 4MQFB 3JASA 5CRIA 1S2MA 4OIFA 3EQ8A 4B3JA 5SYMA 3I0NA 4N5IX 3ZXUB 1HQKA 1Z15A 3NHUA 4JXZA 1QIMA 2QPTA 4RV9A 1K88A 3BJMA 4ZAZA 2YS7A 5JZMA 4HTAA 3AY6A 3LUHA 5AI6A 5I4CA 1J70A 1K68A 5F78A 1HNNA 2A33A 1F6BA 3SJZA 1MT0A 3ELBA 4TKVB 3GPCA 3P1JA 4NK4A 2JLYA 1Z6GA 4NOJA 2G36A 3DZIA 1J99A 3BBLA 5FBWB 1U3TA 4I5IA 1DO2A 1P45A 2PGDA 3GJ5A 5K0LA 4C4RA 2SECE 1KVTA 3O8OA 3AKDA 1BJTA 1I6WA 5KC9A 2ZVJA 1ZCAA 1XCJA 4LZPA 4LJAA 4TKZA 2FPPB 1Y6GA 2B69A 2FUEA 5CU7A 3JALA 4TLEA 1Y1QA 2OE2A 3V4LA 1YIOA 1JHYA 1W85B 3PWZA 1M72A 1SXJD 1RHKA 3FFAA 3MCZA 4UMEA 1AA6A 1G64A 2DFNA 4MV9A 4QULA 3X44A 1SQFA 3EDOA 4AO8A 1T36A 4UQLA 3A1TA 5KMGA 4HDAA 1UPUA 4NJEB 2CUTA 3K09A 4BNLA 1Z08A 4JT9A 1QDLB 5TS3A 3PK0A 3PDHA 1YQ9A 3W4IA 1UKVY 4GM0A 4S1WA 1FYXA 1WDKA 3ZLVA 3FBTA 4NRDA 4YMVA 1XGKA 3F9IA 5DX1A 4ZWNA 1JDJA 1K66A 3U1VA 2O8CB 4YIKA 2DTXA 1XCOA 3IXQA 3ZGNA 2IY7A 3F8WA 4OHCA 3U7FB 1JJ7A 3TE7A 3RS4A 5ABPA 3DEYX 3E6AA 2HCRA 4IZOA 2G07A 2JI9A 1ORTA 2VKTA 4RJTA 1FFSA 1YVRA 1BDIA 3JVVA 1E7QA 2FFBA 2TRSB 1TJ3A 4TVSA 5EKUA 4JKYA 1T2CA 1UEIA 2ZPUA 1VMDA 3QBDA 3RQIA 3L7AA 2RHMA 3IP7A 4BX2A 1T4MA 3VC3A 2CNKA 3KT6A 1DOAA 1PR0A 4AMUA 1ULZA 3WWCA 4EMSA 5IK2D 1JYSA 1UQRA 3A3PA 3N0TA 2A30A 4MZXA 1BO6A 4UHEA 4RNCA 2W6ID 3E8XA 1N3IA 2IIPA 3QJ5A 4D9NA 1T8UA 1YRYE 4PCAA 3N2YA 3I01M 2W2QA 4WWHA 5IARA 1WQ4A 3DE2X 3F46A 1A27A 4EW3A 1PZEA 4RHTA 3WJ2A 2H5IA 2QI9C 4GZMA 4E2WA 1IUOA 3LXMA 1V1MA 4X95A 4EABA 2PJUA 2VZ8A 3PQ2A 3V4PB 4C2BA 2W00A 3GFTA 3HMKA 1JWBB 4XWWA 3BRCA 1CU1A 4ER0A 3OOEA 1ZUD1 3ZD6A 4TM8A 4DQXA 4EO9A 1BMDA 1GNRA 3UJPA 4P08A 3OCYA 3WTBA 4QZVA 2NPOA 2I22A 2WAXA 4N0EA 3VTKA 4C0QC 2HU5A 1A9YA 1R1DA 2LKCA 4YX9A 1J1UA 5K51A 4JJ6A 2PZ8A 4H7FA 1GTG1 2ZUWA 2OZLB 2OGWA 3KE9A 2D2IA 4RANA 3COJA 3QJYA 4G4JA 2BTQA 3HJCA 2ZATA 3D8NA 5IXJA 3I4LA 1V39A 4GVLA 3RTEA 2H1HA 4BDTA 2V1UA 2PMEA 3RVMA 1GGKA 5DK4A 3U9SA 1CP3A 2YHUA 1A8QA 3HA3A 5SY4A 3AHCA 5J5CA 4IXDA 4NI5A 4PBTA 1Y9EA 3EXIB 1YS4A 4M36A 5K3AA 1H4TA 4ALJA 2IZ5A 3NW9A 1A2BA 3GA7A 4G0QA 4NFLA 5ER9A 3P0IA 1PCXA 4L5IA 2FPMA 1DIRA 2DKFA 3NKLA 4DLSA 1W4LA 1RYFA 2C9YA 3UHJA 4DZZA 3BMCA 1GLGA 3S2UA 3WXBA 2XAUA 4L0QA 4KLCA 2CLCX 5TVGA 4KQXA 3P9YA 2CJPA 4HX2A 5DNVA 4ZRMA 3L0BA 2WZBA 5JMPA 3BJIC 1F3LA 4JVSB 5HK8A 3UVEA 1V11A 4G97A 1SIOA 1FDTA 4RLQA 4WESA 1E6WA 3D0QA 4QXQA 1Y37A 4RF3A 5JU6A 4TYWA 1NQTA 2QTLA 4ZVSA 2C1EA 2UYCA 2FX2A 3QUBA 5DW3A 5JSUA 4RL6A 1ORDA 3DHVA 2J9XB 3K0AB 2NAFA 1BGWA 3N39C 4JVLA 2B36A 2ODEA 3GEGA 3O4VA 1SGWA 2GHRA 2AX4A 2Y4OA 3B52X 4RKYA 4A2WA 3W6ZA 4FOOA 3T3GA 3ZBTA 4X0EA 3RRXA 3UJHA 1VHJA 4JC8A 5JT1A 3L07A 4UTOA 1KZ7B 2ECQA 4G8CA 4WKPA 4KNVA 3EIQA 4E0BA 4R16A 1E59A 1WHTA 4WY2A 2KMLA 2PYZA 3C2QA 2O8DB 2O3RA 5BQFA 1CRWG 1ZD9A 2J1LA 4BAZA 2QLFA 5FOQA 1MPXA 1X8LA 5EC8A 3NDIA 4HEHA 4HMOA 1TUIA 4MHTA 3BRWD 4OHFA 4Q7EA 2WFLB 1GG5A 2ZEJA 1I36A 3CUYA 4MUHA 4ZT7A 3X1YA 2I8AA 1E5DA 2PGAA 2RI6A 3NWPA 3SQWA 4WV3A 4YGXB 1SG0A 4Q4JB 1M7HA 1SUAA 2ERCA 4TT3A 3ITNA 3TGWA 5JMTA 3S2GA 4K2HA 2HYIC 3QPAA 3LXRA 1ZN2A 1O6BA 1WKCA 2CL0X 2RK3A 4H4CA 4PSAA 4CMIB 4DG5A 2XGOA 4XRGA 2P2YA 5JE8A 1NVFA 1CUGA 1R9GA 1SCQA 4MVJG 2QENA 4V39A 2VK2A 3EVAA 1IB6A 3OWXA 2NG1A 1O54A 1HDCA 5DKFA 1L8LA 2JAXA 2ZUCA 2YMMA 4HS4A 7ADHA 5JYDA 2OHOA 1QZUA 1JFFB 1JR3E 1WDLA 3M4ZA 4D92A 2MHCA 1KDOA 2H00A 1L8QA 5DNEA 1VC2A 5FADA 1NW9B 1OOEA 1UOPA 2WTUA 3FBGA 4UD6A 1HYGA 2BWJA 2GEVA 3CVVA 3K70C 1F0PA 4DXHA 1LEHA 5AUPB 1T9GS 1ZCBA 1YMVA 1C5KA 4YREA 4DYDA 4IV5A 1JR2A 3WMFA 4NKRA 5IUNC 4PPNA 2ZXUA 3BE8A 4V1CI 4WXEA 5IWAB 3OTIA 3UK7A 4PPFA 2JCBA 5EJ5A 3KTAB 1TTPB 1PEAA 3KXDA 2QE7D 5CUQA 3V1LA 3HM9A 1R5JA 4I9HA 5KYXB 3K1AA 2FW0A 3BMNB 1KFCB 4UULA 5HF6A 3TW8A 5IEBA 3AR9A 3NXKA 2DLCX 3MCAA 2PZKA 1KMHA 2XAAA 3KXLA 1W35A 1WBDA 3D64A 3AVQA 1U2DA 1ZVKA 1PYDA 4G0OA 2MIIA 2QY6A 4XYGA 4E5PA 4ZDJA 5DOZA 1D0IA 1XKTA 1D1SA 1JJAA 3VHXA 3TS1A 5IWCA 2OLEA 3LV8A 5EY5B 4BCBA 5B1YA 5DGXA 5HUJA 2B1GA 1E66A 1FJXA 4H18A 3O1HB 1EE2A 4I4TB 4LECA 4HH0A 1Q22A 2QN3A 1UXJA 4PSCA 1XLWA 3G79A 3P7MA 4HH3C 3RAEC 3L40A 3QEBZ 4YO8A 4NBLA 4IIDA 3ISJA 2Q1TA 3M1IA 3ND7A 3T94A 3UFXB 5CA0B 7MHTA 4FR5A 2P4EA 4DY4A 2AFRA 3OFSA 1UKCA 2GAJA 2PH5A 5JDIA 3CW9A 1UK9A 2MSNA 4KR6A 2C5HA 4H4EA 2WAMA 1XQXA 1XR3A 2VQ6A 2QUZA 1VIAA 1YXMA 2XBLA 1YBHA 3I09A 5CURA 5ES4B 2H65A 1L5RA 3TBKA 2PJRA 1GJRA 5AM3A 1ISFA 1BXGA 1W5BA 2QBYA 1DSSG 5CVDA 5DNDA 2LCIA 2Y1GA 3JQEA 2QMZA 2DQYA 3FHJA 4TXJA 1U8EA 2IW3A 1J09A 3LBAA 4IUDS 4OTZA 3ZE9A 4M1KA 4K6GA 4NLLA 2ZI3A 1YB5A 2OORA 3WYFA 1FYEA 2HV9A 4HK4A 4LXUA 5KAPA 1U3GA 3HKCA 5SY9A 1N2BA 4EF5A 3G8AA 4ESHA 4XUDA 3RSOA 3GJZA 4HNSA 3WRYA 1X9IA 1IZZA 4ID9A 4BFSA 3VR0A 4LE0A 2NWQA 3T9CA 3F5QA 4F5EA 2SCUA 4IIXA 1BS9A 3EF0A 5ALRA 1QCDA 4MZDA 1J8QA 3W5JA 2WJPA 1K6JA 2DUUA 2P1RA 2TMYA 3FNBA 5T8KA 4JODA 3VHRA 5C1OA 3V4RA 2XZTA 5TT0A 4D81A 1XWWA 1AKQA 2EP7A 4IUCS 2GVNA 2X6TA 2QMQA 4X8MA 5GMOA 1Q12A 3GJXC 3N0WA 1QDEA 4RFSA 1IBSA 2NUPB 3ZE7A 3OIDA 3JWPA 4KG7A 3KVNA 4EM6A 4G67A 2FHPA 1BXZA 2X2OA 3FLMA 3TCNA 5FNZA 5LDHA 1ZMOA 2CMKA 4M3NA 2FA9A 1EEXB 1DKPA 3CT6A 4IS3A 3SOPA 2BTQB 1IN5A 1X0XA 2O8BB 4YAFA 2GOYA 3I58A 3NIFB 2BD0A 1QP4A 2ZSHA 1A4XA 4N5LA 5AVXA 1ZICA 3GBPA 3NLLA 3C14C 1Z5UA 5IT4A 1OBVA 3H8WA 3HU2A 3NT5A 1Z13A 3JWJA 3JPYA 3WMEA 4MDFA 1JHQA 1QNFA 1JBKA 4FZ5A 3U62A 3IRVA 4KGZA 2B5VA 1EG7A 5H82A 2BFDB 1B3BA 4W99A 1AKUA 2X4DA 3FFBA 3NDJA 4NG5A 4X65B 4GLLA 2MINB 2QSZA 2VNJA 5JO0A 5K8CA 1MIOB 1FPMA 2BMFA 2JLAA 2Q8QA 4P3KA 2X7JA 5FR1A 1MAAA 3KALA 1YC5A 5I7SA 2GWRA 3GFVA 2QPOA 3OZ7A 2OZEA 1ES9A 2DHEA 3DVRX 2VHYA 4GIBA 1GR1A 1E7SA 1S9HA 4HRYA 3DYVA 3LFTA 4RMHA 1HLGA 2JLUA 4JFAA 1EFRA 1NDQA 2DVMA 3L8DA 3QLEA 4R1PA 5FOUA 4D8VA 1S2GA 4NQZA 4WGGA 2O52A 1RIFA 4MIEA 4JEUA 4PPYA 3A31A 1D2NA 1P7PA 3L7NA 5CVJA 1NMEA 4LF6B 1U0BB 3STUA 4DV2B 2NYVA 1GPMA 1QQ7A 4WADA 5A9SB 2FZKA 5JO9A 2VUSA 2Q6VA 3OIVA 1ZBQA 3TO5A 3QENA 2G4VA 3LS2A 3OTOB 2H06A 4LHVA 1EIWA 4HLCA 4Z0PA 2RG7A 3ESCA 4REMA 1YQDA 2Q5CA 4NABA 3W78A 1G38A 1VL8A 3B38A 3PX2A 1JDZA 2J30A 4LMRA 4RKQA 4WFJA 1KTIA 1WB6A 2VDQB 3RBVA 4YROA 4KXVA 4D42A 1WY7A 3LAWA 3TMKA 2Z1MA 3KQTA 1EQUA 1ESNA 2HO4A 3N76A 3VR5D 1R0BA 3ND8A 4HDKA 2Z9DA 5JNVA 2AMLA 4EX7A 4ZOAA 2DWUA 3QQ5A 2NZVG 3MA0A 3HLKA 2ERYA 3KKQA 3U40A 2VXBA 1XDBA 2QTGA 1ONNA 1KL7A 4Q1DA 2PE5A 4GYWA 2I4MA 1QYRA 1OYOA 1IZYA 3QVMA 3BFXA 3Q8XB 4TZKA 4LOHA 5HKKA 1BH2A 4M6WB 1YZLA 2EGUA 3TQFA 1OI3A 1G4AE 4QUGA 2GLTA 1FFXA 2QTMA 4RORA 4Z9YA 4D4MA 1X2EA 3NGXA 3CPEA 3LY9A 3R76A 3AERB 4GSLA 2BR3A 1ZUWA 5ALEA 1UPFA 2H4FA 1ZIOA 5D3KA 4BUCA 1X19A 2A9RA 2YC2C 4OK6A 1R4MB 1UM9A 4JI4B 2NUTB 1G9SA 3DDZX 4QBKA 1CHDA 4TL8A 2FKAA 1PW5A 2OQIA 4QUEA 4X1OA 1U0FA 1W6UA 2Z4SA 4DUGA 1BAPA 2C95A 2LTAA 3K0BA 3NTQA 5KNDH 4L8VA 1S4MA 1T2NA 2GAIA 4R1MA 3MMXA 4KLNA 4KGDA 4UQPA 1MU0A 1PVVA 5ER6A 3Q87B 2X0DA 1TEVA 2FV8A 2AW5A 1XJ0A 4G5FA 1K86A 3O8DA 1PU2A 4Y9RA 5KU1A 5F4BA 1VSTA 5H83A 3G2HA 2CVHA 1C1DA 2QG6A 3KTFA 4FOPA 3PNOA 1YULA 5B3AA 1VB5A 4K6HA 5JALA 1FP1D 4U7WA 3D8UA 3ZGZA 5B4VA 4DABA 2BMWA 1KH3A 1CTQA 3OU6A 4FVTA 2XCUA 2ZJFA 5BSGA 1P1JA 5KQSA 4QDOA 4MXDA 2AFIA 4DWJA 3DEKA 4GOLD 2JIMA 3E3LA 3ZU4A 4OQPA 2MSWA 2Z83A 3FVWA 4ZAVA 1MTZA 3UV3A 3VHXB 1DKMA 4NBWA 2WSMA 4F2HA 2V3CC 5KNLA 4IIYA 2CWDA 3DZDA 4XYLA 5FWYB 3AG6A 1PFVA 5JAQA 5JZBA 3U4HA 5C4GB 2GM4A 3GQVA 2R2AA 1ZYUA 3KD3A 5EIWA 4G2TA 5GTDA 1GSIA 1SCKA 3VOAA 3L4KA 1TLTA 2XKBA 5IJAA 1W2HA 4TMYA 4PTLA 4A0SA 3OF5A 3EDRA 3AEKB 4OLBA 5EJAA 5I4IA 1NA5A 1I51A 3TOSA 5K20A 1GYRA 5FL7A 2QT9A 1GFWA 3U5ZB 2ZE6A 4QYIA 2J4CA 4MKZA 4ZI7B 4V0LA 4AJIA 4JDUA 5M7EA 2ID9A 3O2QB 3T4PA 2QRJA 1W5FA 2QU8A 3DMYA 3WRXA 3SVLA 4HQ0A 1JHXA 3COYA 2BFBA 3LNCA 4MAAA 5ERGB 3NC0C 4KGVA 1IB0A 1OREA 2WJJA 1JBQA 3NAGA 3K0CA 3OTWA 4I99A 4MCJA 3B1XA 2Q62A 1JKFA 5F4ZA 3V80A 1TKRA 1QS0A 3KP1A 1WS6A 2R6CA 3D1VA 2ZBDA 3OZIA 4BLVA 4YFVA 1I6MA 2F4NA 3R77A 2ZXFA 2ILTA 3G2MA 4CVNA 3ZE1B 1H0RA 1P18A 1I1OA 2YCBA 3L41A 1RJDA 4IIUA 4JSRA 4TL7A 4GMDA 4DSUA 2HQ1A 2NZ2A 7REQB 3BWVA 4LJ6A 3FOEC 1NG1A 2ECFA 4LYHA 5BP7A 1NAIA 4JXJA 1MV8A 2P0EA 2A78A 1QHEA 3TW4A 2PLAA 3BJRA 3NVAA 1G18A 2BN4A 1MO5A 1JALA 2V7PA 1RWVA 2VHWA 3DBOB 3K2EA 3LLCA 3M6MD 3NAQA 1Z88A 2VPXA 4EG6A 3CKLA 5KPJA 3GJRA 1DO0A 1VJ5A 1YBVA 3MTBA 3W79A 1MW8X 1IBKB 1NOIA 1RBQA 1XTVA 2HMTA 1BE1A 3CR3C 3BL8A 1M6VB 1YDMA 3BWCA 4FT2A 4XQCA 1OPRA 2BW0A 4F11A 3HO6A 4PYIA 1QP7A 3OC6A 2V9CA 1UC9A 3WWDA 3ZJYA 2F67A 2B30A 1U8AA 4IP0A 3RVBA 2NQTA 5A5EA 3OQ1A 3CE6A 2DEUA 4PPQA 1U0TA 3EDQA 2DC1A 4FKMA 2GZDA 2PGLA 3L49A 4F3RA 2WMDA 2GD2A 1V9SA 3UGTA 1FNBA 4RC9A 3WLQA 2LWIA 1L6IA 4LXYA 5HKKD 1L7EA 3GJ6A 4PHHA 4Q7LA 2AN1A 1T91A 4P81A 1YHZA 3AB8A 4CLOA 4D25A 3PUHA 3ZWDA 1RYYA 4A3SA 3NCTA 5JR3A 1Z2AA 1TJ4A 2RHTA 3NKVA 2O59A 1XRQA 1RKUA 5EFOA 4JEIA 1C3VA 1HLFA 1L1QA 1XZDA 4DBVO 3EEBA 3T0FA 4Q1EA 4LVOA 4NMWA 5FQNA 4MVJP 4EJMA 2HHHB 5TNXA 2ORVA 2GXQA 2OV8A 2QTHA 2R7LA 3D7MA 2RG1A 4FCCA 4ZCPA 3DMRA 2HYDA 1JEQA 2BKUA 3MINA 2BZGA 1XXLA 3NDBB 4K0KB 1XCMA 1GPDG 1R6TA 1NDUA 1VIVA 2LRHA 2ZRHA 3AWIA 4KFSA 1KOFA 3F5DA 4P54A 3EIWA 3SSNA 2HD4A 2ATCA 4Q6BA 4B3XA 4YAGA 1RQNA 3WGTA 3U4QA 1SOWA 1Z75A 3FF1A 4J0JA 3KT0A 4BGEA 3TG8A 3RIGA 3U5TA 4L6AA 1VG9B 4QUDA 1ZO8A 1RPAA 1ZA2A 3MJEA 5EIAA 4BQQA 3NT4A 4J1TC 5BXYA 2Q3HA 3GYBA 2GBLC 3ICCA 4CE6A 3W1EA 4JQOA 5E4FA 5A6VA 1E2FA 3OHPA 3RFXA 4I1PA 4KNWA 5BSMA 4U2BA 2FQ1A 3U4CA 4Z49A 5IS2A 1X6VA 4MRNA 2CFIA 2KSQA 1AHHA 3QUTA 1Q3TA 2UYOA 2UV8A 5KZMB 2QMEA 1PD0A 3IJ5A 3QF4A 1LLFA 2PBLA 3ZJ5A 4WKNA 2J9ZB 1CFZA 5E9QA 3MWYW 3CSDA 1GQYA 1U7XA 1XWIA 3T5DA 4RCYA 1AZTA 5HIKA 5LZ2A 4ZTZB 2ODNA 1L5QA 1DIOB 3LBFA 2BHRA 4IS2A 5BSUA 1XTBA 2BTOA 2UZ0A 3B7WA 4L5AA 1O5TA 4UCFA 1OV6A 2C97A 1F1JA 2BKLA 1Z4LA 5LZ9A 4DEXA 3MWJA 3H5AA 3BCSA 1FFXB 2GRJA 3F8SA 521PA 1E3JA 5H59A 3PKJA 2VAXA 5E1DA 5DO9A 3ZCQA 1R9NA 4Q3BA 5K99A 2WSSA 3CE9A 2BF4A 3H4VA 1YAJA 1GP2A 5KYTA 3MQ4A 3T3PB 3KQVA 3COWA 1M1UA 3A1NA 4O4LB 3ZH9B 4XM1A 4L74A 1BA3A 1RTKA 1VL6A 1JN0A 1B8PA 3NHWA 1JQEA 3O92A 3ODGA 4LY0A 4NNOA 2VT2A 1UBKS 3RRFA 2P91A 2VA8A 3VPSA 1OZ0A 5JJBA 3RYCA 3PXXA 4JA0A 2PZAA 3IEPA 4FCWA 4JKOA 4ROTA 2Y05A 1VSUA 2HA4A 2PGOA 4XSVA 5CJPA 4ZVNA 3WLSA 1PTJC 2FAXA 4CEIB 1AQLA 3CFYA 5HFAA 5LQJA 2C4HA 3INRA 4MVJM 1FUEA 2YINC 5JY6A 2YRWA 4ZVQA 1GZ5A 4KE9A 3RG2A 3ZU6A 4E5MA 5AK5A 4ZYVA 3OE5A 3W77A 3DUFB 2PZLA 4LXQA 4NBTA 3TM5A 4G9EA 4KSBA 1LBEA 4BMPB 1Z0UA 5B3JC 1JIUA 1GZ3A 2FUG6 5ITVA 2EBFX 3DLTA 2QJTA 1KEKA 3KBOA 3PRHA 3ZLJA 1UEXC 1NF8A 4KDCA 4C6TA 2QUJA 3WADA 4BQIA 5K3OA 4LIPD 4L50A 1VRVA 5B3KA 1JJBA 4MVJE 2GPNA 4RETA 1EFVA 5DYYA 4HH1A 4CDGA 1PGOA 4O33A 2RGNA 2XMZA 2F1IA 4G1CA 1B93A 1FMTA 4YPVA 2A9QA 2AXPA 1CF9A 1T2EA 4LA4A 4D0NA 3V4SA 4WZBE 2GEJA 1LQTA 1I8TA 5CYOA 2ZJ7A 4Q03A 1M8PA 3X1KA 1YH3A 1A9RA 3PE6A 4UM9B 3IEMA 1CPYA 3SK0A 5TXGA 1T1GA 4KQHA 3U7IA 5B1SA 1A9TA 2K6GA 4AT1A 4A0GA 3ZY4A 2PUCA 2FWIA 5CB8A 5GWXA 3IIEA 1DE0A 1DXHA 3PIDA 2J6HA 1XNGA 3EZGA 3LL4A 1W25A 2WTEA 1TK9A 5I9MA 4CEHA 3E9MA 3ABRB 4K6OA 4KO2S 3T1TA 3HCOA 3OE4A 3NHYA 4TTTS 3ST7A 4K9SA 2JLZA 1C9NA 3QVGA 4QG7A 4HD8A 2FZLA 4PYOA 2E49A 2EQAA 3FIJA 4QHYA 2RDMA 2GK7A 4L8YA 4LMAA 2LCFA 2ZWMA 3LT2A 3H2GA 2IWHA 2XE7A 3FPEA 2NOAA 4OI2A 1QYDA 1ZOOA 3PG5A 3T95A 4L8LA 4W5TA 3T0IA 4DIEA 4DMFA 5AM4A 4QAJA 3HVHA 1W4ZA 1GGMA 2IYEA 3ICOA 5BW5A 2C9BA 1PR4A 3FCUB 3LQFA 3DFMA 3NBMA 4JBGA 4LJ5A 5DPMA 3RW9A 2AX3A 3CZ5A 4DV5B 1HTWA 5FX2A 2JARA 2PRZA 5ILOA 2BGTA 5GQSA 4D44A 2RHBA 4FT4A 3DBLA 5IDVA 1E1MA 1ITZA 1AN9A 2WMYA 4PZZA 1GNSA 4A8JB 3VPXA 1T6NA 4EFNA 2HN9A 4NZ9A 3V7WA 1Z7EA 4N03A 2JFOA 1GKUB 3FDIA 1TM2A 1M6VA 4DJEC 5M04A 1NMXA 2BHTA 2JFZA 2FJ0A 2GD1O 2PVPA 3UNXA 1NQAO 4DN6A 2DBYA 1VCMA 4YAUA 3MWDB 1ZC3A 3VUEA 2QTAA 4CDRA 2BKAA 1OYYA 3KLMX 3TVYA 4O0MA 3I39X 3F6CA 4MGYR 2CLDX 3EA0A 3SGLA 3B36A 2YW9A 4DRXA 2Z2ZA 4QDZA 1QRTA 4DMKA 1T3SA 1AS0A 1II8A 3DE6X 3QLUC 5AWFC 2BZ1A 1L4LA 1P9RA 2B61A 2XB9A 1RQXA 2BGJA 3CT4A 1SIWA 3WGUA 4BVBA 2DP4E 4DG9A 3TFQA 1G2IA 4RWEA 3E7XA 2C98A 1XJCA 4UHKA 3FRIA 3ZW8A 4ETWA 3O38A 1Q7EA 8GPBA 4RL4A 3TR5A 2ARKA 2Y9MB 1E9EA 3JWGA 1ZKDA 4BMYA 4C7MA 4QXRA 2GD6A 3LQKA 3ERCA 1NR7A 2BR5A 1ONSA 1A9OA 4KXQA 1U7DA 1L5VA 4JP5A 4OH7A 2UZ1A 3UJDA 4MP6A 3L1JA 2QX7A 2ZFUA 2WDZA 4M87A 1NXQA 5KX5F 3STYA 3U6KA 1I33A 1NUAA 1SELA 3UGKA 1IL0A 1NYQA 5HS6A 2IYUA 4MKGA 4YDHB 5CA1B 1ZJ5A 2C88A 5DHSA 1PUIA 5GAJA 3I52A 3U4QB 3B1FA 4WBNA 4MQEB 1XI2A 1LZLA 4X84A 1K98A 2OXFA 5KSYA 2CF5A 3K71B 3JQ9A 3TKLA 3DZCA 3LHFA 2NO7A 1UDCA 3IOYA 4OQLA 4UHHA 3AOEA 1CQJA 1AKWA 2R11A 3H8JA 3BXPA 3L3BA 3SQOA 3DOOA 3OOYA 4TKUB 2D13A 3W4KA 4AZVA 1NWCA 5K8VA 2GCNA 3HBNA 3N2KA 2C2ZA 4BECA 5AUOB 1CY1A 2HFJA 3ZH2A 1YE3A 3D4IA 2EG9A 4NJMB 4ISCA 4DT1B 3G0CA 5JLAA 5C31A 4MULA 1Y4DE 1U3WA 4J03A 1IZ0A 3NUGA 1CR0A 2MDTA 1KZ9A 5I47A 2QRQA 2PANA 2ZUUA 1SXGA 5BOSA 1UWVA 2RB5A 4PTZA 1P0PA 1KVSA 1MCZA 3ED1A 3FLEA 2BGWA 5AO9A 2M6KA 4AX4A 4KMSA 1DHRA 4EGQA 4QA9A 5G4KB 2PMWB 4QVKA 4QU5A 1GDHA 1X74A 3R5HA 2UVQA 4E30A 3BFKA 1U28C 3C5EA 1RBYA 5AR1A 5DM1A 1C9JA 2Q1WA 4OHKA 3RREA 4BCCA 1K4MA 5LKRA 2LVBA 1A5AB 1V0JA 621PA 2C4UA 1FDUA 3C3XA 3LUCA 4D2IA 1UKBA 2NO9A 4RLHA 4BUZA 3KQLA 3IHTA 2WG2A 1QHSA 4LHYA 3TB4A 3DHWC 1KF0A 4RJLA 1LV8A 4PQYA 3G2PA 4FSDA 1H4QA 1QAOA 1DXYA 3LDUA 3RYCB 5KCZA 3FPLA 5FWDA 5CFMA 4LAFA 3DKKA 4BY9E 4XCQA 2XTJA 1J0DA 1O94A 2PLRA 3K9HA 1EFDN 1IJFA 3IP6A 4E6EA 5BRAA 1Z35A 3DOHA 2VDVE 4HP8A 2X1MA 2ZR7A 2ZRLA 1GKKA 5F2EA 1O9BA 2WHRA 3GR6A 4FGWA 1AV7A 2ATVA 3QMVA 1U2GA 3VZPA 1YZQA 1E4VA 2QG4A 3M5DA 5E4JA 4ZGGA 2R65A 2VTDA 4HWSA 3E9DA 3SXUB 3UK1A 2Z8YM 5IAKA 2XKAA 2XW6A 2E1RA 3H8SA 5F21A 3OTHA 1F7UA 4MCHA 3PHIA 3VGPA 1LV7A 5HZKA 4ENSA 2X5NA 1IY2A 4GF5A 5E1OA 2XUOA 3EMDA 2NXCA 2XDQB 2OV1A 3P0FA 4LI3X 2NU6B 4HNAA 4X24A 3V8MA 3C4VA 2ZTUA 3OMXA 4WLEA 1A0OA 1KBQA 1Z2PX 1D9XA 2IHKA 3IAUA 5ALGA 5H16A 2GEBA 4QGSA 5KYWB 4QDTA 3WYDA 5IAOA 1NAHA 2RBGA 4XB6B 3OH8A 3WLEA 2W2VA 1UMCB 3L04A 4ABYA 2OFWA 3KQNA 1ML4A 5FWXA 4BS9A 4CQNA 3R0ZA 2HAEA 4NR0A 2HH9A 3ECCA 3AUYA 2I2WA 1KP3A 2I1VB 4MRMB 4X93A 1U7TA 3DVAB 3WL3A 3NZEA 1T8YA 1VM6A 5JQGF 2EKPA 2E37A 1T3ZA 2RSLA 4QSMA 1J00A 3QU4A 2I2AA 4MJ7A 1V7PC 2Q4EA 2YWCA 4P2GA 3UMMA 4MI9A 1ZD1A 4HGOA 5ESWA 3SVTA 3HCAA 3KYIB 3OCCA 3QEMB 4GX2A 3SLGA 3RLIA 1MAVA 3IODA 5AJWA 1MX1A 4HHEA 2I3BA 1WUHS 4MKXA 6ABPA 1Z5ZA 2F8MA 1G8PA 3AVOA 4IFBA 4MR7B 5KYUB 2PA3A 3BDIA 3PA6A 4C87A 2SHKA 1QNLA 3LF2A 3AI3A 4Y1GA 2J3HA 3N28A 1DL5A 4MR9A 1PE0A 3SKVA 3SZMA 4KO3S 4Q21A 4R2MA 4YHHB 1ENOA 1T25A 2EBWA 3BWDD 3FJYA 3MT8A 5CVVA 2IHNA 1P1KA 1U6KA 3F6PA 3TLKA 1N2CA 1C7RA 2I1QA 1QGUA 2B25A 3OOSA 4G36A 3WIDA 3PNKA 2QMUA 5BUZA 1G6OA 1QH1A 1WQ1R 2X9VA 1M7BA 1PDWA 2AGVA 3DKRA 4IZ6A 4RDCA 1X3LA 4WPGA 5BQOA 4EG7A 1TQHA 3UK2A 3PXDA 1N6LA 3EGXB 2Q1YA 1LDEA 1VBFA 2VXOA 1J90A 3HG7A 4F71A 4BPBA 1COWD 1VBNA 4JR1A 4LXXA 4ZV9A 2VDWA 3A05A 1XNJA 1VKJA 4D4GA 4QPPA 3SIRA 4M37A 4L4YA 4P93A 4FMPA 2QF7A 1QCCA 4DLLA 1C0IA 2HFKA 3P2OA 4PR3A 1ZOSA 1QVAA 4KXNA 4M8LA 2XSZA 1E62A 1TNDA 1QV6A 3IMCA 1J49A 2IYOA 1F7VA 3LUKA 3F67A 5JMWA 1GL7A 1AM4D 3W8FA 2R4QA 1YZTA 4LVNA 4IMIB 3SFVA 1E8MA 4MLZA 1GQQA 2IHJA 3I2JA 1K5HA 2E89A 4ND8A 3AKCA 4YMSA 5LQCA 3LUAA 1V7CA 4GNRA 1H2RS 5B64A 1M1NA 5DGCA 4L02A 5EJ7A 3VR3A 1OC4A 2G82A 2QXYA 3HJAA 4KOAA 4BBPA 1RJEA 4Z9FA 2WD9A 4H6PA 2IOYA 4S1TA 4PC7A 5CNIA 4MEJA 1V9LA 4YV2A 3T3DA 5IVDA 5JNUA 1GYPA 3HRHA 2O23A 1B16A 1XYYA 5DNAA 4NAUA 2YFHA 4FMCB 4YJHA 2PQMA 3MLAA 1Y4UA 1GA1A 1E79D 2FN3A 3W7VA 2ZS7A 3FHTA 1ZCZA 1P2UA 4KQFA 3VDXA 3VYTB 4A03A 3THYB 1CQJB 4ROSA 4JOBA 3BA6A 2P68A 4NU0A 4ESOA 5BWCA 3HL0A 1WPXA 3L0DA 3OICA 5F64A 3UAGA 3VNSA 3QNMA 4OMUA 5G53C 4I50A 3I9KA 4UCXA 5AOAA 121PA 1TUBB 3HM2A 2O8EB 2DPHA 2SKDA 3I5YA 2YJ6A 3VYSB 3UICA 2D4HA 2FQXA 3IHLA 1TAHA 4N12A 4RMJA 4XGIA 4ECAA 1DDOA 3SP1A 4DT1A 1JU9A 3DTVD 1Z7YA 4GOXA 4QQFA 1FXSA 4I1YA 3BFJA 1JAYA 1LW7A 3ETJA 4BGUA 3A1SA 4WRRA 3GLGA 1H65A 1TA4A 2B1IA 5T5QA 5EZ5A 4YJKA 4ZMRA 3U9TA 3V2UA 2VEDA 3C6XA 5FPTA 1JXAA 4G0ZA 1DJNA 5G40A 3HSSA 1JEAA 4TWJA 4XYMA 3RBAA 3CNQS 2HJRA 1HXHA 4UEQA 4EYQA 1JI0A 2G09A 3GRCA 3TTSA 2F3UA 5TRTA 3UJ7A 4BFTA 4RD0A 5EEHA 2IE8A 2R96A 4R6WA 1TO6A 3I6YA 1FJ2A 5KUTA 2FTKE 1PHPA 3HWRA 3ROGA 3AUXA 5KVSA 1OE0A 3GU3A 3TAHA 3JWHA 3TN7A 2A0XA 3B1WA 1P7WA 3U9LA 3PI7A 3HHPA 1RXWA 4WLUA 3E2PA 2X1VA 3UANA 2X0JA 2M6RA 3IAFA 4OI4A 5A5FA 5LNK6 3WGNA 1HFEL 1L6RA 5HE9A 1N0UA 5GPBA 1PWEA 2V59A 1FDOA 1G16A 1NVKA 1R5OA 2XRFA 4HGNA 4JKIA 2W4QA 1SJ9A 2QW1A 2QP4A 5AXCA 4NZMA 1RJWA 5TMPA 3AL3A 3IAS1 2WUVA 4B82A 2VK1A 4H7EA 4B6OA 2H2HA 1NT2A 3ANLA 1ZH6A 3KETA 1QUEA 3PV0A 1N9GB 1QTQA 4ZK2A 2QPAA 2Y1WA 3CBQA 5D51S 4FP9A 4MDHA 3TIIA 1VHWA 2ACEA 4IHAA 4YJ2F 4BRSA 1XRRA 1BH6A 1XHLA 2WHPA 5IYZA 1OBOA 3JQDA 2QRVB 2C5BA 5BR8B 4EHNA 3CIFA 2OBFA 2P3SA 3A70A 3F9RA 4URVR 5EUCA 4BLTA 1UJ6A 4MW5A 3WGVA 2GXAA 1LBHA 3ZU2A 5IDXA 1TUEA 3JAKA 4K9KA 1EK6A 1TM7E 5G3YA 3G0OA 4S1NA 3RFVA 1PKEA 3TYXA 2A58A 1OTHA 5BT8A 1WG8A 3QU7A 1L7AA 3UWDA 4DNPA 2OD2A 3ISVA 3D59A 3U81A 1RPZA 1P9NA 4FGUA 2DHDA 1VL0A 4G89A 3U3MA 4W5JA 4HNGA 4K9NA 4WKCA 5D7BA 4YMHA 3HN6A 2EBHX 3GLFB 3K1TA 4G24A 4KAXA 1UMKA 3KEFA 1RAGA 2XCQA 1MNQA 5AKXA 1XVVA 3KTOA 1JFVA 2NU9B 4HDMB 1EDZA 4Y1RA 1LLUA 3IHWA 4F6CA 5CFZA 1PHRA 1XZAA 4JP3A 1YKSA 1N4AA 5C7YA 4AF7A 1NR5A 2YY5A 5KYUA 3IQWA 5TIIA 3ZXYA 3ROPA 4LXGA 4P9NA 2AZTA 4YJ2A 1KORA 1IM5A 1O3YA 4N48A 4DYHA 1N8KA 3CRW1 4J76A 3IDQA 2WYVA 3QBTA 2PKXA 1P17A 3QVKA 1NMYA 4P58A 5C7OO 1EVJA 1V71A 1KO8A 1OMOA 1VHLA 1GNVA 3FLBA 4H35A 5DN6D 2Y1CA 3HXKA 3L6CA 2HDHA 1UPAA 1BD4A 2QXUA 5B5SA 2FE4A 5FBVB 4NXMB 2W4IA 1KOJA 3JTMA 2PL5A 3UN1A 1X38A 1AF4A 3LKZA 4QUHA 3QOFA 4EFDA 3KWLA 4Q01A 3KR0A 4MI3A 2X8LA 2D4AA 4R1SA 1T26A 4KTTE 5IKPA 3V1KA 3OO0A 5TPZD 4FFDA 3GT4A 3FSGA 1R4ZA 1RPNA 3BT7A 3KJNA 1LVUA 1OAOC 2GWHA 1ARZA 3OZWA 4JNCA 1P1CA 3C3PA 5BYKA 2XEDA 3VMMA 4L5JA 4DV3B 2QR2A 5A62A 2J46A 3SQDA 3AL0C 2K4MA 2DFTA 2Q4OA 1GTL1 3PFFA 3M5CA 4K8RB 3N5CA 4CBVA 2IPXA 3IT1A 2VTBB 1V2HE 2X9NA 2RKWA 3L06A 4O1HA 5JJ5A 5KWSA 1JLLA 3I4CA 3PGXA 1Q7TA 5A4FS 3KB6A 2OV4A 4U8HA 4ZYWA 1IG3A 1JP7A 3RUCA 3U1TA 4F96A 5IAEA 1K63A 2UUCB 4CUJA 3ZY2A 5B7PA 3T3OA 1VPVA 2BT4A 2FSSA 4CXMA 4J0DA 1GSAA 4AJJA 1DKUA 1QVZA 4XWOA 3MJVA 1SHKA 4XVCA 2Q5HA 4NJEA 3UC9A 5ITSA 4KFCA 3GCXA 2FUNB 4N8EA 2R6GA 3E4CA 1EFHA 3W05A 2ZRQA 1C7QA 3PVCA 2B78A 4UUPA 4QWWA 1MFZA 2QW8A 1P2DA 2VZEA 3H9EO 1YOVA 4GQIA 1FYDA 3E9ZA 1ZRMA 1OXKB 2H6EA 4QTZA 3S1AA 4BLQA 3OQHA 3RVQA 2IXTA 1XB2A 2O8CA 1L8OA 1XMXA 5TF4A 5JEEA 1LB1B 3GI1A 4DLXA 5BVHA 3R7SA 4BQEA 1RYZA 1A04A 4EUEA 1L1EA 1HR0B 1M10A 1M76A 3G2LA 3LDGA 3LU1A 4G1MB 1T29A 4P8RA 2Y3IA 4OHYA 1DEAA 3NOXA 3E22B 4DS3A 2VZ9A 4NS1A 3RAGA 4DLNA 3Q6NA 2BGIA 3B85A 4EBFA 1R6XA 4HAWA 1L7DA 4K6FA 1E6MA 3SEQA 4CL0A 3PDWA 1LTHR 1TCUA 3HN7A 1ODLA 3GA5A 2P75A 3L1KA 5KQRA 4EAAA 2H17A 2PAAA 3KJGA 2PUFA 4PZEA 2C03A 1LSJA 2LIVA 1KYTA 3EW9A 2X0FA 4BBZA 5KQPA 5J2TB 4BFUA 4TQAA 3K09C 1GARA 4BFXA 1E7WA 2FSVA 3O6VA 1NOKA 4UHFA 3KKKA 3R3JA 2COKA 4BUJA 2X58A 4Z54A 5A02A 4HDOB 4ALMA 4TTRA 5AW0A 5K4HA 4Z86A 4US0R 1MA0A 3CVXA 3D6UA 3FHOA 2HSDA 3RS8A 5CIQA 1Q95A 4DIUA 3L8ZA 2OLKA 4Y0NA 4OXIA 5HYVA 3LLUA 1E9RA 3JCZA 4P80A 1QGZA 4RTNA 3RYHA 2JBAA 1P4HA 4NZOA 4YQEA 2CDRA 5C1IA 3CZPA 5HUHA 1CG6A 3EGDB 1CX9B 1BROA 2QVGA 2HQSA 3D3NA 3GAMA 1YL7A 1GAJA 3LQ4A 2XZOA 3ZJTA 1NW8A 3Q98A 1F20A 2X9QA 4REQA 4UFPA 4D97A 3DDUA 4OJYA 3Q8LA 3K35A 2YNMD 3PQ4A 2QDXA 3GWZA 3N3BC 2DX7A 3FF4A 3HNOA 1KA9H 1M6NA 4BNDA 4EL0A 2X3YA 2XBUA 2I2XB 1T2UA 1XYVA 2GN4A 4WDQA 2Z6QA 2G0AA 1SQGA 3HPRA 5EJ9A 4BIIA 5FPYA 1ZM3A 1YRQA 2FZGA 1HZJA 3QEOA 3A2LA 3DFKA 3NC4A 3BIXA 1JTEA 2VF2A 1ZGBA 3M3HA 3VFDA 1GFIA 3HEMA 1R0LA 2Q4BA 3SC2B 3LHSA 2YX1A