1Y1VH

Refined rna polymerase ii-tfiis complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II largest subunit
publication title Complete RNA polymerase II elongation complex structure and its interactions with NTP and TFIIS.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase/transcription
total genus 14
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2004-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1y1vH00
4LFBL 4LF4Q 4JI8Q 1HNWQ 2VQFL 5IYDG 4NB3A 3J80i 3HOVG 3S15H 3DLLA 2XGTA 3I2ZA 1EQQA 4B3TL 4A3IG 4DV5Q 4IPHA 1GD7A 1UE1A 2RHQB 5DLQE 1FVIA 1M1KC 4GLVB 5M3MG 2ZTCA 4IFDG 1UEBA 2OTJA 4NXNQ 2C35B 3CCJA 2HIXA 1PFSA 1YEZA 3TS0A 1J6QA 4H02A 2PNHA 2JA6H 5M5WH 4A3GH 2PQAB 1S40A 2KHIA 3EN2A 2JE6I 1CKMA 1NY4A 4DV4Q 3UDGA 1QZGA 1G291 3HKSA 5GADC 2JA5H 4L5SA 3I4NH 3CXCA 2CWPA 4B3MQ 4ALPA 2E5LL 3J81j 3D0FA 3GTKH 4GNXB 4XIGS 4X64L 2JEAI 3HOWH 5AJ3Q 4A3FG 4O2DA 3WWVA 3FP9A 2RCNA 2Q2IA 4IPDA 4JBJA 1E1OA 1VCIA 2YU9H 1HJPA 3GD7A 4JI1L 2JA9A 1VQ9A 3M3YH 3RZOH 3D31A 1I5FA 3A5ZB 2V1CC 4JC0A 2LSSA 2ZJRA 4DUZL 4JI7Q 2CCZA 3K0XA 4LUZA 1HNXL 1ASZA 4LF5Q 4P74A 4A3BH 1SR3A 1YZ6A 2E8GA 1A8VA 3G4SA 2B63G 4IPGA 3NBHB 1V43A 3CMEA 4BBSG 3CMAA 1VQ7A 1K8GA 3CPWA 2WFWA 2B29A 2KENA 3L7ZC 4LW1A 4JI2Q 5LMUQ 2JJQA 4DK3C 4QIWE 3DM3A 4A93G 4DK6C 3PGZA 4EX5A 5M3FH 1PH8A 3UDIA 3CCQA 5M3MH 3L0OA 4YWLA 1MIUA 1EWIA 4A4IA 4GKJQ 1YI2A 2JA7G 4A3MG 3GO5A 4JI5L 5LMNL 1UWVA 1KRTA 1IL2A 3A0JA 2MO0A 1VS0A 4A75A 2AMCB 4B3SQ 1IYJB 5IYCG 5C4XH 5EAYA 1G51A 2ZTDA 4JOIC 2UXDQ 2N3SA 4TVAB 4DNIA 2OWOA 1N33Q 3MEFA 3KDFA 1PYSB 4BBRG 2EXDA 3G71A 3T1HL 1TWAH 3I55A 3GTMH 2Q2HA 4NPSA 4QJFA 5FJ8H 2F52A 4HJ9A 4FDBA 1JE5A 2AKWB 1I50H 1KAWA 2K50A 4R4TA 1YHQA 4B3RL 4WJ3M 3J81i 4OXPA 3J81c 4DV7Q 1Y1WG 2D62A 5IP9H 1VQMA 4ME3A 1X3FA 5C0XG 3ULJA 1X9NA 3I56A 3S1RH 3JAMi 3JAMc 4R4CA 3PV0A 1LTLA 4GLAC 3GTJH 5JJIA 2Q2TA 2ZJQA 2B63H 2I5MX 2I5LX 2ZM6L 1VQ5A 4YCWA 2UUAQ 4UP9A 3K80C 4GLXA 3KFUA 3CCRA 5BR8Q 4YCUA 3FKIG 1PH4A 3H0GG 2AWNA 1VQOA 2WP8J 4LF9Q 5K36G 2ALYB 4A93H 3S2HH 1IBML 1M90C 4P71A 4OONA 4X66Q 3CQZH 1YHAA 1MKHA 4DR6L 3Q8DA 1BBUA 2R93G 3KF8B 4JCVE 1XMQQ 3ULPA 1WYDA 4UPAA 4HIDA 1HZ9A 2R6GA 3IRBA 2I0QA 4GN3B 1YITA 1VQCA 2JA8H 4UP7A 4RMFA 5IYCH 4GKKQ 2UXBL 5GROA 1SRUA 2NVYH 3BZKA 3CP0A 3T1YQ 3PUXA 1L1OC 4K0KQ 4HJAA 4JYAL 4DR3L 3E9HA 2F3IA 3PSIA 2CQOA 1PH2A 4YY3L 2JA6G 2MQHA 4DV3Q 4LFAL 5IP7H 3CC2A 3S2DH 3PIPA 4DR4L 4UY8C 1RIPA 2NZHA 2JA5G 1FJGQ 3I4NG 1W3SA 2B3GA 2NVQH 2E2IH 1N34L 4R4QA 1AE2A 3S24A 4GN5A 3TEHB 1QUQA 1VQ4A 4QY7A 4HJ5A 3HOYG 2IX1A 2VS1A 2WAQE 4QL5A 4X65Q 2EIFA 4MTNA 3W1GA 4GOPC 3CCMA 4LF6Q 4GS3A 3RLOA 4A3DG 3FKIH 2R7ZG 1EIFA 1E7ZA 1S3OA 4MZ9A 1YIJA 1PH1A 4A3BG 4AQYL 4LF7L 3PF5A 1P16A 3AEVA 1QUQB 1Y1VH 1HNZQ 3CD6A 4NXMQ 1VQBA 4DV6Q 3PUZA 4JV5Q 4WJ4A 2OQKA 3E9IA 1GO3E 1SROA 2R93H 1I6HH 2K5HA 3S14H 4LF4L 4JI8L 3J80c 4A3CH 1WI5A 1D8LA 2Z6KA 4P75A 3PUWA 2PQAA 3RR5A 3S1NH 4DV2L 4HIKA 5M3FG 2UU9Q 1VQHA 2QGQA 1YVCA 4DR1Q 3CW2C 2BH2A 3ERSX 4X6AH 4DV1Q 4GNXA 4LFCL 2K4KA 1Z9FA 2E2JH 2VZAA 3MXNB 5M5YH 1NJIC 2BA0A 1KD1C 5HY6A 4IPCA 2Z0SA 4L5QA 3A5UA 5C4XG 3GTGH 3S1QH 1IZ6A 2QEXA 3H3VH 1TWHH 1XMOL 4LFBQ 1QVGA 2OCEA 4DUYQ 5HGQA 1WCMG 2VQFQ 1XNRL 4KHPL 1TWGH 4OX9L 1HZCA 1CSQA 4B3TQ 5FJ8G 3CCLA 1SFOH 3HOXG 3PUVA 3HOYH 3AFQA 4RG1A 2JK8A 5IP9G 1IBLL 1XJVA 4L5RC 4JI3Q 3CC4A 4A3DH 2ES2A 1A0IA 2R7ZH 5IWAL 2D0OA 3FHWA 1L1OB 5FLMG 4OO1G 1N36L 3GDEA 1JMCA 3NEMA 1X65A 4BY1G 3UE1A 2JQOA 1I94Q 1UE7A 1JJGA 2E5LQ 1E3PA 1VQEA 1VQPA 4LF8L 2N8NA 4J15A 4LNQA 1W2BA 3SGIA 3F2DA 1J5EL 4A3KG 1K9MC 1BKBA 2GN5A 1QVCA 3OW2A 3CCSA 3OTOL 2NZOA 5JJKA 3CPFA 4JI1Q 1MJCA 3AFPA 4C3IH 2IHFA 2ATWA 3PF4A 4Y52H 1T9HA 4R1JA 2Y0SG 4DUZQ 3M7NA 1HNXQ 2K52A 2KCMA 4AYBE 1KQSA 2JA8G 3U4VA 4DR2Q 3S1MH 4X62L 2BA1A 4DR4Q 2K75A 2LXJA 1CKNA 2VQEL 1WCMH 2WB1E 1N33L 4JG2A 1VQFA 4YCVA 3I4MH 4A3JG 2F4VL 1VQDA 3K7AH 1SE8A 4DAYB 2IY5B 3EBEA 3K7UC 3HOXH 5IP7G 2UUCL 3VDYA 2YTVA 1OXUA 1CKNB 2OTLA 4DV7L 4JI5Q 1X54A 4KHZA 5LMNQ 1Q12A 4JBKA 4POFA 1HZBA 2R7DA 4IFDJ 5FLMH 2A19A 3CF5A 5LMNW 2PI2A 1K83H 1XPRA 4IO9A 4BY1H 3ULLA 1U0LA 2VY3A 5JEAG 2VNUD 3KJPA 1C7YA 2LXKA 2OQ0A 4PZ6A 1V1QA 5BR8L 2K5NA 2DGYA 3E0EA 4BA2I 1EUJA 4C2MH 2A1AA 4MNOA 1Y1VG 5C44G 4A3KH 4LF9L 4B3RQ 2UUBL 4JI6L 4X66L 1OXVA 3PO3H 2YV5A 1N8RC 1Q81C 4YWMA 1K8AC 2AHOB 1JB7A 4A3CG 2GVAA 1LUZA 3PIOA 1HR0L 3PO2H 1TXYA 1EOVA 2RHSB 1YJNA 2ZJPA 4OWWB 1NMGA 1N32Q 2A8VA 4BY7G 1OXTA 1X3EA 2ZM6Q 3AQQA 3RZDH 2Z6KC 4OWXB 4DV0L 4K0KL 3M4OH 1B8AA 4C3HH 4A3JH 4QQBX 1VQKA 2XTIA 1NMFA 1FL0A 1E24A 4JI4Q 4YHHQ 5GAEC 2H5XA 3HOZH 4DR6Q 3GTOH 1PH5A 3HKZE 2ZTEA 3NELA 3UE0A 1GKHA 3TQYA 1GM5A 1I3QH 4GN4B 4APVA 2PMZE 3G6EA 3RN5A 3EIVA 4DR5L 1XNQL 4JOIA 1A63A 1X55A 1NE3A 3S17H 2HQLA 4JBMA 1Q1EA 2IHEA 2NVTH 4JI0L 4A3LH 2UXBQ 1GVPA 3OYYA 2HHHL 4HIOA 2FXQA 1YNXA 4JYAQ 4DR3Q 4DR7L 1C9OA 4R4OA 4A76A 2UXCL 3GTPH 1IBKL 4YY3Q 4HIMA 1K0RA 1DGSA 1OXSC 4C3JH 2AWOA 4LFAQ 5H1SE 1VQJA 1Q46A 3NENA 4KLKA 3TREA 2KCTA 5IYBH 5C44H 1TWFH 3F2BA 2QA4A 1HH2P 3AYHB 5J3BA 4NXML 3PUYA 4P72A 3G48A 1LYLA 1N9WA 1O7IA 1N34Q 1HNWL 1YHBA 1NBWA 5E7NA 5ELNA 5C0XJ 1CUKA 1PVOA 2YYZA 3RNUA 3HOUG 4BY7H 1YBYA 3KOJA 4DV5L 3KLWA 1KC8C 1Z47A 2NN6G 3STBD 1G6PA 4DR1L 1QZHA 4NXNL 1PV4A 3I4OA 4DV1L 4BXXH 2PI2E 4AQYQ 1P8LA 2ID0A 2KBNA 1JJCB 3ER0A 4PMWA 4LF7Q 1VQGA 4DV4L 1PH7A 2IT1A 1WOCA 4IFDI 3STBC 3RN2A 2N49A 4B3ML 1WJJA 4DKAC 3M4QA 4DUYL 4UP8A 3I4MG 2WAQG 2VW9A 3LGJA 1L1OA 5AJ3L 5ELOA 3CCVA 4Y7NH 2CKZB 4DV2Q 3S16H 1U5KA 4O0AA 2HIVA 4OWTB 1IXRA 2I5HA 1B70B 1EQRA 4JI3L 5C4JH 1MJEA 4LFCQ 4IOAA 3TRZA 3W1BA 4JI7L 1FGUA 5GQOA 1ASYA 1XPOA 4LF5L 5C3EG 2K5VA 1YJWA 2Y0SE 1VQAA 3L2PA 1XMOQ 1CKOA 1XNRQ 1XTDA 3BU2A 4IJHA 1I94L 1QVFA 4OX9Q 4KHPQ 4X64Q 2JEBI 2VUMH 1BVSA 2MO1A 1Q1BA 4OO1I 4JI2L 4GOPA 5LMUL 3HOUH 1SN8A 3KYHC 3ICEA 1VQ6A 3B6YA 3RLFA 1XPUA 1E22A 1Q82C 1IBLQ 3PO3G 2D0PA 4GKJL 1KL9A 5IWAQ 4IOCA 4TQUS 3PO2G 2RF4A 1UE5A 4GOPB 1N36Q 4B3SL 5FLXc 1B7YB 2DUDA 4DR2L 3H15A 1KIXA 3CCUA 4LF8Q 2UXDL 3GTLH 2CFMA 4A3EG 3CAMA 5JJLA 1C0AA 5IYDH 1VQIA 1L0WA 3HOVH 2K14A 1J5EQ 1SLJA 4AIMA 1PH6A 1AH9A 1L2FA 1A62A 4A3IH 3HOZG 3OTOQ 1X6OA 2ASBA 1X3GA 1KRSA 1E1TA 4PZ7A 3I7FA 1K73C 1Q8KA 3HFZB 3W5OA 3M85A 4A3LG 5C3EH 4X62Q 1OTCA 2VQEQ 2EQSA 3GTQH 3F8TA 4P73A 3U4ZA 2HT1A 5C0XI 2UUAL 1H95A 1EFWA 3T1HQ 2F4VQ 3BZCA 4A3FH 4QGUA 2UUCQ 5IYBG 1PH9A 1PH3A 1Y14B 2YTXA 4AYBG 1AE3A 1K3RA 3KDFB 1XMQL 4POGA 3U58A 3U50C 3JC66 2CWAA 2WB1G 4GKKL 1N32L 3F1ZA 4HJ8A 1LM0A 3K8AA 1EIYB 1PHJA 2R92G 3K81C 3KF6A 3T1YL 4BBSH 4L5TA 1UE6A 1HZAA 4LUVA 4AH6A 4A3EH 1VQ8A 5GAGC 5IE8A 4BXXG 1KXLA 1EYGA 1NTGA 2GVBA 3J7ZC 3A74A 2L15A 4DV3L 1IBMQ 1BBWA 4GNXC 4YHHL 4HJ7A 4JI4L 2UUBQ 4YWKA 4JI6Q 5IY0A 3KF6B 4LUOA 1FJGL 2JA7H 1R9TH 4A3MH 1HR0Q 1D7QA 4DPGA 2VL6A 3BJUA 3UDFA 2MNAA 1HR0W 2E2HH 1V9PA 3H3VI 4X65L 3J7A5 1TWCH 4DV0Q 1VQLA 5GAHC 4LF6L 3CCEA 4BBRH 3F2CA 4JBWA 1YJ9A 2N78A 3M4PA 4R4IA 1SMXA 3CC7A 4A3GG 1OXXK 4LWCA 3RLNA 1HNZL 1PYBA 1Y1WH 2MFIA 1KHIA 3M9BA 4DV6L 4JV5L 1JT8A 2BH8A 2YTYA 1RL2A 1WFQA 4DR5Q 1XNQQ 2NVXH 2VUMG 3HOWG 3ZJYC 1Q86C 2Q2UA 2R7FA 1VQNA 4JI0Q 5IT9c 1X56A 4IJLA 2UU9L 2HHHQ 3TS2A 2R92H 4BA1I 4XTCS 1CSPA 4DR7Q 2KHJA 1Q7YC 3UDXA 2UXCQ 1IBKQ 3PCOB 2IX0A 3H0GH 5JEAJ 1S72A 1JJ2A 4PG3A 1PA6A 3HKZG 4PZ8A 3KJOA 4KI0A 4DAMA 4EQ5A 2NN6I 5M5XH
chains in the Genus database with same CATH superfamily
2PO4A 2VQFL 5IYDG 1SNMA 3HOVG 1DOMA 3DLLA 2XGTA 4B3TL 3I91A 4IPHA 5DLQE 4GLVB 4IFDG 2Q8RE 4ILWA 1JE4A 3D4DA 3TS0A 4FF1A 3CKIB 4H02A 2JA6H 1SBBB 4A3GH 2PQAB 1S40A 3WOFA 4DV4Q 1VQNA 3DHQA 1G291 3I4NH 2CWPA 4ALPA 1D5XC 3BDCA 3D0FA 3GTKH 3TBIB 4QUCA 5AJ3Q 1HXYD 3OOCA 3WWVA 1PRTD 4JBJA 3K5LA 2BOSA 5IOCA 1O7LA 4JI1L 4CJ2C 1BCPD 3D31A 1I5FA 3DM1A 4JI7Q 3K0XA 4LUZA 4A3BH 1W6KA 1YZ6A 2J7ZA 3G4SA 5FO9B 1V43A 4QF4A 5NUCA 4BBSG 5JPMC 3CMAA 1LTTD 1WTRA 4QIWE 4J8QA 1D1KA 1PH8A 2RCFA 3FRPB 3D6CA 4A4IA 2QW7A 4GKJQ 4A3MG 1VS0A 4B3SQ 3H09A 3SEBA 5EAYA 2NWGA 3HOVB 1ZKOA 4DNIA 3FPPA 4BBRG 3I55A 1QWYA 1SYEA 1JWMD 4R4TA 3VR3A 1I50H 1YNND 3TP6A 2V4DA 3I56A 3HZXA 3JAMi 5C3EB 3JAMc 5C4HA 3SDZA 3S1RH 3PV0A 3GTJH 1DXMA 2ZJQA 2ZM6L 1EY6A 5FK9C 4YCWA 2UUAQ 4FF3A 3K80C 4LAAA 1QILA 3W3AA 3H0GG 2AWNA 5A2QL 1CT1D 1VQOA 3S2HH 4DXGA 4OONA 4X66Q 1MKHA 2VB3X 3C2PA 4KKSA 3R8BA 4JCVE 1XMQQ 3AMUA 3ULPA 1HZ9A 5IT9L 2I0QA 4BBSB 1TVXA 2NVYH 3PUXA 1L1OC 3BYYB 3PSIA 2B2WC 1PH2A 3TP7A 4DV3Q 1BCPF 3PIPA 1R9TB 4A3MB 1TS5A 1ZYRD 2D9UA 3S24A 3TEHB 1QUQA 3F2UA 4QY7A 2IX1A 2VS1A 4BBRB 3W1GA 3CCMA 1PMRA 1CK1A 1YIJA 1PH1A 1QUQB 1Y1VH 1GO3E 4QUFA 2R93H 3S14H 1D8LA 4P75A 1HPCA 1SE3A 3RR5A 1C8CA 3S1NH 5M3FG 4L63B 1V1PB 2QGQA 1YVCA 1EFID 3CW2C 3H0GB 4O42A 2EE1A 4X6AH 4LFCL 2K4KA 2FMCA 1SMYC 1MSGA 5IT9E 1QE6A 5HY6A 5CBAE 2EDGA 3OW7A 1AP0A 4KKUA 3GTGH 3M4YA 4DUYQ 1T5EA 2VQFQ 1HZCA 4E6IA 1A6XA 4B3TQ 3A7AB 2B8GA 4JI3Q 5IWAL 4IZ8A 4EGVA 2F0KA 2D5DA 4OO1G 1N36L 1X65A 3VA7A 4BY1G 4LF8L 1E3PA 1VQEA 4J15A 1DOLA 4KK7A 3F2DA 1GUOA 2A6ED 3J7YW 1A3UA 4ZLTF 4R8IA 2GN5A 1QVCA 2NN6H 5JJKA 4JI1Q 4C3IH 3PF4A 1T9HA 2EY6A 1SE4A 2IL8A 3W2DA 4UAIA 3M7NA 4AYBE 4FVMA 2JA8G 3U4VA 1DOKA 4HTHA 2LXJA 2VQEL 2B2TA 3QWNA 2FJ2A 1N33L 2OF1A 3I4MH 3VR6A 5M3FB 2F4VL 3I70A 1MGSA 3K7AH 3QOJA 2Z9HA 3QR8A 4DAYB 3K59A 5M3MB 5E4WC 5IP7G 3WOEA 3VDYA 3TSSA 1SSOA 2HDMA 3L9AX 4X3TA 5D65A 1UUPA 4POFA 4IFDJ 2NTTA 3A7LA 3NWTA 2PI2A 2K33A 2VNUD 1HFGA 1RKNA 1LTRD 2PZWA 4R8NA 4PZ6A 1ZEQX 2DGYA 4FXGC 2IX3A 2A1AA 4A3KH 2NBFA 1H9RA 3PO3H 1SXTA 5EKKA 4A3CG 1LUZA 4B9XA 1EOVA 1O7ZA 2RHSB 2TMPA 1N32Q 4KKTA 3V2TA 1FGBD 2ZM6Q 2JSOA 3AQQA 2PPBC 3H3VC 2R61A 2SDFA 3M4OH 4C3HH 3EA6A 3CQZB 1E24A 1V8QA 4ZK9B 3QB3A 5GAEC 3HOZH 1PH5A 3NELA 1GKHA 3TQYA 2JA8B 1C4QA 3RN5A 2PMZE 3K5OA 4DR5L 2OT2A 4JOIA 2IW3A 1NE3A 2NZ1D 3S17H 4JBMA 1Q1EA 4A3LH 1GVPA 1BDOA 3IL8A 4LK1C 4GZYC 2A74C 3PIO3 4A76A 1ICWA 1IBKL 3UI2A 4HIMA 1Y1WB 1XTCD 2PCFB 1TWFH 1J9OA 1GUSA 1KABA 2K5QA 2Z1CA 1N9WA 1O7IA 5DM63 1SJED 4K5WA 1HNWL 1Q3LA 5E7NA 1JOOA 3R2TA 3RNUA 1F9RA 1PTOB 3KLWA 3FKIB 1I4PA 1LT3D 3STBD 4G57A 2L1BA 1PV4A 2SOBA 2F0VA 4DV1L 1P8LA 3HS0C 4PMWA 1JJCB 4ZYSA 1SYCA 2IT1A 1ICFB 4IFDI 3KLSA 1LTAD 1WJJA 4DKAC 2WAQG 1GJXA 2KHSA 4KD4A 4K2LA 2HIVA 5KNDA 2I5HA 1B70B 5M5YB 1EQRA 4LFCQ 5BN3A 3KBGA 1FGUA 1TWHB 4CJ0B 1CHQD 1D5MC 1TWGB 2Y0SE 3D3RA 4ODGA 3NTHA 1XTDA 1QVFA 2JEBI 5JAVA 3KYHC 4U68A 4A3DB 3B6YA 3CHBD 4X3UA 4ZUIA 2X6LA 5IWAQ 2OXPA 3TP8A 2CH4A 2RDFA 1N36Q 3KUPA 1GUNA 3T4AC 4DR2L 1H9SA 3CCUA 4LF8Q 1IW7C 2PYKA 4N8FA 1C0AA 5IYDH 1L0WA 3HOVH 1V1OA 2K14A 1STBA 1SLJA 4RGTA 1EIHA 1B2TA 1A62A 2LS01 2ASBA 3G6JB 3TZUA 4PZ7A 4ZKCB 3S1MB 1Q8KA 3HFZB 3MXGA 5ELEA 5I6WA 4IALA 5C3EH 2VQEQ 1HRJA 1EQVA 4IUUA 2JYOA 2HCCA 3F8TA 4OIKA 2F4IA 4DFAA 3T1HQ 2F4VQ 4C3JG 4QGUA 3K0YA 1X3QA 2QDLA 2QEJC 2O5IC 1NSNS 3KDFB 2WKCA 1M4VA 2WB1G 4GKKL 5IGFA 2EJGC 2AQ1B 1PHJA 2R92G 3T1YL 1AEXA 4BBSH 4PNYA 4C2MB 5GAGC 5IE8A 5C4ZA 1VF7A 2GVBA 3A74A 2L15A 4GNXC 1GOZA 4HJ7A 1FJGL 1R9TH 4A3MH 1YNJD 2DJFC 3RUZA 1D7QA 5EJWA 3T13A 1GHJA 5EGTA 3RZDB 2F0JA 2OEOA 3H3VI 2F0EA 3CCEA 4BBRH 3F2CA 4CDCC 1YJ9A 4L8JA 1D5ZC 1TY2A 1ENFA 3VR5A 4NW2A 1LABA 1I3QB 2XWJB 4YIJA 4DR5Q 5A35A 2NVTB 1LT4D 3K58A 4H44C 1QG7A 3TS2A 4BA1I 3LX0A 4C3JB 4CJ1B 1KDCA 5C44B 1IBKQ 2E75C 4HCEA 3H0GH 2LFNA 1I4RA 4KI0A 4DAMA 2H4OA 4OGQC 4LFBL 2BE5D 4JI8Q 1HNWQ 4NB3A 3J80i 4BY7B 3I2ZA 1DYQA 1SAPA 1GD7A 1I4HA 1UE1A 3K5MA 1M1KC 2ZTCA 2C35B 3CCJA 4DK1A 4FP5D 4KN4C 3UDGA 1CKMA 3CXCA 2E5LL 2LMCB 1Z6HA 4Y7NB 1NCVA 4X64L 1NR2A 1AZPA 4IPDA 3SK6A 1E1OA 1UAPA 2KEDA 2V1CC 4JC0A 5J39A 1SEBD 1GXDC 4K8IA 1HNXL 2K28A 1A8VA 1PRTC 2WV6D 2B63G 4IPGA 3NBHB 3IAYA 1VQ7A 1PDQA 3BG3A 1BCPC 3HOUB 2B29A 2JJQA 1RTNA 3DM3A 4A93G 4EX5A 5M3FH 3J81L 3CCQA 4UHVA 3NE5B 3L0OA 5M3MH 1MIUA 4JI5L 5LMNL 4JW0A 4KMUC 4JK1C 1KRTA 2MO0A 4A75A 2AMCB 1RD9D 5IYCG 2F1MA 1G51A 2ZTDA 2C9OA 1JOKA 2HQEA 2X69A 3EROA 2OWOA 1Z7TA 1PYSB 1PTOD 3H6MA 3MC0B 1HQRD 2Q2HA 4QJFA 5FLXE 3EFXD 3FVQA 1JE5A 2AKWB 1YHQA 3J81i 4OXPA 3J81c 4RGNA 4KY6A 1B3AA 1VQMA 4ME3A 1SNDA 1STYA 5C0XG 2MHVA 4FF4A 5IGEA 1LTLA 4GLAC 3GTQB 4OO1H 2RSOA 4RA8A 4ZRZA 4KY5A 1DZ1A 2I5MX 3O13A 3MHBA 1YNNC 4NDXA 4RCNA 2Z4IA 4UP9A 4GLXA 5BR8Q 3K57A 2RKSA 1KTKA 4LF9Q 2K05A 1QNKA 1M90C 4P71A 1PZJD 3CQZH 2LY7A 2Q8TA 3C1FA 1WTQA 1BBUA 1WYDA 4HIDA 2R6GA 3NBIA 4GN3B 2JA8H 3BVZA 4UP7A 4GKKQ 3J81E 1U4PA 2F0WA 3CP0A 1F2YA 3T1YQ 4K0KQ 1H9JA 4DR3L 2HUGA 3HOZB 2F3IA 1Q90A 2DNCA 4YY3L 3E3XA 5EBDA 4LFAL 5IP7H 4UY8C 2JA5G 1FJGQ 5BN5A 4IURA 2RBMA 2B39A 2E2HB 3CRKC 4R4QA 3D8GA 3KK7A 3HOYG 5C6AA 4QL5A 2B2UA 1ZYRC 4GOPC 1PTOH 2GA4B 3FKIH 2R7ZG 2B2YC 1EIFA 3NUCA 2BCOA 4AQYL 4HEDA 4LF7L 1WTHA 3I4LA 1ESRA 4NXMQ 1VQBA 4KJNA 3PUZA 1SROA 4A3CH 4LF4L 2J0TD 1WI5A 4CDEC 2Z6KA 2PQAA 3PIP3 1PTOF 4RGOS 4DR1Q 2WINB 1NAPA 1Y8NB 4MIUA 2ENBA 5I2YA 2VZAA 5M5YH 3IFDA 1SYGA 1KD1C 5M5XB 1ZXTA 2MJ8A 2Z0SA 4L5QA 4N8X1 3A5UA 2KQ3A 1IZ6A 5C4XG 1TWHH 1XMOL 3S15B 2MUYA 1XNRL 1BXTA 4LFBQ 1WCMG 3DWPA 4KHPL 1TWGH 1CI3M 5FJ8G 3CCLA 5CV8A 3HOXG 4IUQA 5IGDA 2TSSA 1Y69U 3AFQA 4RG1A 1IBLL 1XJVA 4A3DH 1LTBD 1A0IA 2RA4A 2JA5B 5FLMG 1L1OB 2K32A 2G5DA 4IUTA 3Q23A 4XQNA 3UE1A 3HOWB 1UE7A 1DD2A 2E5LQ 1HHVA 2YU9B 2PZUA 4WFN3 3NTKA 1K9MC 3QOLA 4G4KA 2NZOA 1AW7A 5IODA 3HKZB 3JAML 4Y52H 1CA6A 5FO8B 1HNXQ 2K52A 2A6EC 3FPUB 3OWEB 2A6HD 1CHPD 3V96A 3S1MH 4K6LA 1HTLD 2K75A 1CKNA 1WTWA 2ZXRA 1RDPD 4JG2A 1VQFA 1B9NA 3E6ZX 4H0LC 4A3JG 1VQDA 4RHRA 2EY5A 4F7XA 2HDLA 1H9KA 1OXUA 1CKNB 1VF5C 1EY4A 3A54A 4DV7L 2OTLA 4JI5Q 4KHZA 5LMNQ 4JBKA 5C4XB 5LMNW 5EBCA 4HCSA 1XPRA 1PFBA 3ULLA 1TWAB 3I72A 5JEAG 3GTMB 2OQ0A 4HMJA 1R4PB 4BA2I 1EUJA 1EYAA 4C2MH 4MNOA 3MFYA 1OXVA 3QJYA 2YV5A 1Q81C 2AHOB 1HR0L 2L12A 4L6TB 1YJNA 2ZJPA 1OXTA 4DNRB 1X3EA 3RZDH 2Z6KC 4FF2A 3JAME 5FO7B 2XTIA 4EQOA 3R2IA 3ND9A 3C1EA 2H5XA 1LT6D 1EWHA 1GM5A 1I3QH 4APVA 3G6EA 2HQLA 2NVTH 3OYYA 1B3QA 2FXQA 1B1ZA 1STAA 4DR3Q 2CQAA 2FFKB 2UXCL 3S2DB 4YY3Q 4MTKA 1OXSC 4C3JH 4M1UB 4LFAQ 3TREA 1Q46A 5C44H 1QZGA 3F2BA 1V1PA 3PUYA 1IYVA 3LWEA 1LYLA 2O5JC 4XXEA 4KV6A 5A2QE 5ELNA 5C0XJ 1CUKA 3Q24A 2KECA 4BY7H 3KOJA 1KC8C 5IGGA 4DN4M 3I4OA 3T16A 2PI2E 4AQYQ 1XWEA 4LF7Q 2IJ0A 1PH7A 2A69D 3GV6A 3STBC 4OIJA 4DU9A 2F3VA 3M4QA 4IQZA 4PMBA 4LJZC 2VW9A 4IUPA 4Y7NH 2CKZB 2L55A 1BQQT 1STHA 3DXJC 5E4XA 1BR9A 4OWTB 1LTSD 3NPPA 5C5MA 2E2JB 4CKBA 5ELCA 1ILPA 3TRZA 3RMHA 3W1BA 5GQOA 4OL7A 1XMOQ 1XNRQ 1I94L 4KHPQ 4C1NK 3X3NA 1SFOB 4ZKBB 4JI2L 2XSCA 2E76C 3OIQA 4ME5A 5LMUL 3HOUH 2SNMA 4Q0FA 1DONA 3VYUA 4WORA 1B4OA 1Q82C 1IBLQ 5T1GA 2EYOA 1KL9A 1L0XB 4TQUS 4CKCA 4DAYA 1UEAB 1UE5A 3NSWA 2DUDA 1U4MA 1FNUA 5KYIA 4XYQA 3BZDB 5KNBA 4A3EG 3CAMA 3OSOA 5JJLA 1VQIA 1PFMA 3DEPA 2F03A 2EYPA 1BUVT 4PMCA 1X3GA 1KRSA 1E1TA 4EVOA 4B08A 4M8AA 1OTCA 3GTQH 2SNSA 1AZQA 1X3PA 5C0XI 2HD3A 2X6GA 3GV3A 4R9WA 5CV6A 5IYBG 4PV1C 3EJIA 4AYBG 1IKMA 1AE3A 1K3RA 3V05A 4BY1B 5ELFA 2F0FA 3JC66 4HJ8A 3K8AA 1A15A 2NB0A 3K81C 4L5TA 5ELBA 1UE6A 1HZAA 4AH6A 1MI2A 1VQ8A 4BXXG 1KXLA 1EYGA 4LMQD 3J7ZC 4H13C 4P2CB 4YHHL 3Q0AA 4JI4L 3J7AF 4YWKA 5IY0A 1HR0Q 1S5FD 3C3LA 3UDFA 1HR0W 2L4NA 3S9WA 3OIPA 2E2HH 1EU3A 3J7A5 1VQLA 5GAHC 1YNJC 3NTIA 2WIIB 2N78A 2H1EA 4A3GG 1SMXA 5L37A 2K5WA 1CA5A 1JQYD 1Y8OB 1RL2A 1BBXC 1WFQA 4DXFA 2VUMG 3KBXA 3ZJYC 4ABNA 2Q2UA 2R7FA 2HCIA 1C48A 5D14A 1VMCA 1X56A 2UU9L 3GTPB 3E0JA 4XTCS 3MXPA 1TY0A 3UDXA 2UXCQ 5JEAJ 3QO2A 1PA6A 4PZ8A 2K1BA 1JICA 4EQ5A 5M5XH 3U9SA 4N9PA 5LL6X 3S15H 1JC7A 2B2TC 1EQQA 4EQPA 2KEEA 2C5CA 3ND8A 2BE5C 2HIXA 1J6QA 1ENCA 2PNHA 3VYTA 3MXUA 2K6AA 4ULLA 2KHIA 2JE6I 3GP7A 2OTJA 2JA5H 1VDZA 4L5SA 4XQJA 1A2TA 3C46A 3J81j 4GNXB 2JN4A 3HOWH 4A3FG 4O2DA 2Q2IA 2XIWA 4DGZA 5J22A 5C4JB 2YU9H 3P1HA 1HJPA 1RCVD 3GD7A 5G3LF 3VYRA 2ZJRA 4DUZL 2CCZA 1ASZA 1SR3A 3IKJA 1SNCA 1RF2D 2VUMB 3CMEA 4I65A 2RQXA 4KY7A 5C5LA 2KUMA 3CPWA 2WFWA 4JI2Q 2E74C 2L9HA 5LMUQ 4FNFA 1FNVA 1GUGA 2EY1A 4IFDH 1YI2A 2JA7G 3A55A 3BS1A 5DEHA 1IL2A 3A0JA 2F0GA 3RD4A 3GTLB 1IYJB 5C4XH 1RHPA 1I4XA 2WAQB 4JOIC 1GUWA 1N33Q 3MEFA 1VMPA 1PXUA 3KDFA 2ZT9C 4NKLA 2EXDA 1TWAH 3GTMH 4NPSA 5E3FA 5FJ8H 1O7YA 4ZAIA 1KAWA 2K50A 2Q8IB 4B3RL 4RKBA 3BYTB 1RTOA 2F0QA 1X3FA 1RODA 5CV9A 4C1NI 1X9NA 1PTOC 4R4CA 3U9OA 5C3XA 2CH4W 2Q2TA 4IN3A 1WD1A 5LL6S 1D1IA 3IFTA 1EL0A 2SEBD 2QILA 4A3FB 4K8JA 1DCZA 3NP8A 3K6OA 2VB2X 3CCRA 3KFUA 4YCUA 1SNQA 1GHKA 1IBML 1F2ZA 3Q8DA 3TP5A 1LACA 5I2XA 2CW0D 2R93G 1A3TA 2MGSA 1YITA 1VQCA 4JYAL 1B9MA 1PRTB 3TMEA 1S5ED 2F0DA 5D3DA 2MQHA 1WD0A 4DAVA 3S2DH 1MHWC 4DR4L 2JA7B 3QIAA 3Q6SA 4OELB 1AN8A 2ZXOA 1G2TA 4K5VA 3J80L 3T56B 5CBEE 5I6YA 1KNAA 4GN5A 1TWCB 1X32A 4CHTB 1NNXA 1VQ4A 1HA5A 4MTNA 2KVMA 4GS3A 3SHLA 3I8ZA 1E7ZA 1S3OA 4MZ9A 1PFNA 4I7AA 1J8IA 1P16A 4F87A 4BS9A 2IPKD 4OHJA 4WJ4A 2OQKA 3E9IA 2N55A 2WB1B 3J80c 5IGCA 4RH6A 4ID6A 2QF7A 2R92B 3PUWA 4XT3B 4HIKA 2UU9Q 2PQEA 2BH2A 3ERSX 1TS3A 4DV1Q 1ESFA 1SYBA 1Z9FA 2E2JH 3MXNB 1NJIC 3S16B 2BA0A 4IPCA 1EU4A 4JPBW 5EQ0A 2QEXA 3H3VH 1QVGA 5HGQA 2L11A 1A3VA 4ZCKA 1SFOH 3PUVA 1W6JA 3NBHA 3CRLC 3A8KE 5IP9G 4L5RC 3CC4A 4TRDA 3J80E 5M5WB 1CFMA 3MA2B 2B2VA 3FHWA 2QDBA 3GDEA 1JMCA 1I6VC 3NEMA 3DMUA 5EKLA 1W2BA 2EY2A 1QB5D 2DNEA 2M00A 1KLUD 4A3KG 3RZOB 3M3YB 3OTOL 2ATWA 2IHFA 4DUZQ 1FR3A 1KQSA 4DR2Q 4QB4A 4X62L 4RHSA 2K03A 1ET6A 2KA7A 1SYDA 4C3HG 4K5XA 3EBEA 1SNOA 1ML0D 2A6HC 2IWHA 4WRDA 2YTVA 4EQNA 3MWYW 1HZBA 4X3KA 1STNA 4H7BA 2M9VA 1IKLA 4IO9A 4BY1H 1U0LA 1C7YA 2XN9C 2LXKA 3OPOA 2RSNA 1V1QA 2K5NA 4DAPA 3E0EA 3ERQA 4B3RQ 1IHZA 1I4GA 4JI6L 2NTSA 4X66L 4XT1B 1K8AC 1JB7A 2GVAA 4F8MA 3G7LA 2B63B 1TXYA 4OWWB 1NMGA 4ZUJA 1B44D 1KDBA 3QG1A 5CC4A 2EJFC 4OWXB 4DV0L 2I07B 4A93B 4QQBX 3PMFA 1NMFA 3NQTA 2RDHA 1S5BD 5I4DA 3NWSA 5LHY1 3OWFA 3HKZE 2MPMA 2ZTEA 3DWAA 3UE0A 3NK9A 4GN4B 1F2MA 3A8IE 3EIVA 1XNQL 1M8AA 4WJWA 2XRSD 2IHEA 4JI0L 2NUCA 1QOHA 2HHHL 3DEOA 4JYAQ 2JXMB 4DR7L 1C9OA 3GTPH 4KD3A 2CHBD 1K0RA 2O2LD 1VQ5A 5IYBH 1VQJA 4DR4Q 2KCTA 4Q5VA 2QA4A 1HH2P 3AYHB 2NVQB 2E2IB 4P72A 5FOBB 3PQIA 3D6WA 5EPLA 2YYZA 2F0LA 4O1NA 1YBYA 4DV5L 3BDOA 1Z47A 5EPJA 5DNFA 3R93A 1G6PA 4NXNL 3VA5A 4BXXH 1EZ6A 4CKEA 2ID0A 5I9PA 1NUCA 1VQGA 1LTGD 2NYZD 1I6HB 1WOCA 3R3OA 1TKWB 1KNEA 1Y8PB 2AQ2B 3OMCA 3RN2A 1E2VA 4B3ML 3ITPA 4DUYL 4V190 3LGJA 1L1OA 2F0PA 4RFBA 3CCVA 4BWGB 1ENAA 2XNAC 1U5KA 2B2WA 4O0AA 1IXRA 2A69C 4RKLA 2M2LA 4HAEA 4JI3L 5C4JH 4Z9CB 5BN4A 1MJEA 2ICIA 3S1QB 1ASYA 4LF5L 1XPOA 2F0OA 5C3EG 1YJWA 3L2PA 1CKOA 1II3A 2CVRA 4X64Q 3HOYB 2VUMH 3ONAB 1BVSA 2MO1A 1Q1BA 2LKVA 4JVZA 1XPUA 2R7ZB 5KYLA 2D0PA 4IOCA 3PO2G 5COYA 1KIXA 4HMIA 5CR3A 2UXDL 3GTLH 1TS2A 3HEJA 4AIMA 1PH6A 2A68D 1L2FA 4C56C 2XWBB 3SXHA 3OTOQ 1WTPA 5HGTA 1EOTA 2F0TA 1K73C 1FD7D 1MBYA 3W5OA 2RVLA 3NXWA 1U4RA 5I9OA 1WCMB 4X62Q 2A73B 1DM0B 2EQSA 1KAAA 3L3OC 2HT1A 1EFWA 3SK4A 3HOXB 3BZCA 4A3FH 4K6DA 1STGA 2B2UC 5F2DA 1PH3A 1Y14B 3LWUA 2YTXA 3AU7A 5CORA 2F0IA 1ET9A 4KN7C 1K83B 1BF4A 1EY7A 1FNWA 5KRUA 4POGA 3P75A 4FYDA 2CWAA 3HG9A 5HURA 1N32L 3F1ZA 1LM0A 2EPBA 2K01A 3NQIA 3KF6A 2AUJD 4LUVA 4TSSA 1PZID 4MHEA 5E1FA 3HRZC 1BBWA 5D3IB 1WVLA 4JI6Q 3KF6B 4LUOA 3PO2B 3T51B 3EVQA 2JA7H 3I3CA 4DPGA 2VL6A 2MNAA 5C3WA 5T1IA 1V9PA 1EIGA 4A3JB 4X65L 1CZWA 1TWCH 4DV0Q 3EQLC 4LF6L 1PRTF 2L0CA 4JBWA 1CQVA 2EXZA 3GTOB 4R4IA 1OXXK 5K5PA 5JVH3 1PYBA 1HNZL 1JT8A 1KHIA 3M9BA 4DV6L 2XRQD 4JV5L 2YTYA 4RCOA 4G7OC 4QMGA 1XNQQ 5CV7A 2EJMA 3A56A 2Z8LA 5IT9c 4JI0Q 4QIWB 4HSVA 2HHHQ 2R92H 2FINB 1CSPA 4DR7Q 2XVSA 1Q7YC 1EEFD 5M9OA 3PCOB 4PG3A 3KJOA 1G91A 1PZKD 4FXDA 1QCBD 3S16H 2NN6I 1SNPA 4LF4Q 1K28A 3OHXC 4A3IG 4DV5Q 1O80A 1IYUA 1TQOA 2RHQB 1FVIA 1G8ZD 3WDNA 5M3MG 1UEBA 4NXNQ 1PFSA 1YEZA 5M5WH 3EN2A 3AEVA 1NY4A 2F0UA 3J7AV 3HKSA 5GADC 4B3MQ 4XIGS 2JEAI 4K14A 3FP9A 2RCNA 2O4XA 1VCIA 1L0YB 1VQ9A 2JA9A 3M3YH 3RZOH 3A5ZB 1Q8IA 2LSSA 4LF5Q 2F0SA 4P74A 2E8GA 4HR7B 4XQQA 1BOSA 1CQFA 1K8GA 4X3SA 1S4ZA 2VXWA 4LW1A 2KENA 3L7ZC 3I90A 4DK3C 3VYSA 4DK6C 3PGZA 5CGKA 3UDIA 1S5CD 5TSSA 1F9QA 4YWLA 1EWIA 1EYDA 3GO5A 3TDQA 1UWVA 2KJXA 1TR5A 1HQMC 5IIFA 1PLFA 2KCNA 2UXDQ 2N3SA 1KLGD 4TVAB 4XYOA 2PZTA 4A3IB 2E2DC 3G71A 3T1HL 4HJ9A 2F52A 1O78A 4FDBA 4WJ3M 1TIID 2EYHA 1Y1WG 4DV7Q 2D62A 5IP9H 4RWSC 4NMZA 3ULJA 5DAUA 3MZ5A 5JJIA 4J1MA 4K2KA 2B63H 1K8OA 2I5LX 3D4WA 1DJRD 3FEWX 3KF8A 3FKIG 1PH4A 5G3LD 2WP8J 5K36G 1UNSA 2ALYB 4A93H 5JJZA 1SE2A 1TS4A 1YHAA 4DR6L 2EYFA 1JR0D 3KF8B 2PNRC 1G6ZA 4UPAA 4DF7A 3IRBA 4RMFA 1F2LA 5IYCH 4A3EB 5GROA 2UXBL 1SRUA 3BZKA 2F0HA 5KIXA 4HJAA 2QKIC 1HA6A 2CW0C 2FHTA 3E9HA 2CQOA 2JA6G 3CC2A 1RIPA 2NZHA 2QCPX 1EYCA 3I4NG 1W3SA 3TN2A 5C0XH 2B3GA 1F9PA 2PW5A 3LNNA 2NVQH 2E2IH 1N34L 1AE2A 2DY8A 2G9HD 4HJ5A 2WAQE 4X65Q 2EIFA 5FKAC 1SDFA 1EY8A 4CBVA 4LF6Q 1XX8A 3RLOA 4A3DG 5KNCA 3H94A 2EVBA 4A3BG 3PF5A 4AYBB 1HNZQ 1RJTA 3CD6A 4N9TA 2FMMA 4DV6Q 4JV5Q 2NVXB 1I6HH 2K5HA 4JI8L 1ILQA 2F3WA 1SMYD 2AUKA 4DV2L 1HUMA 1VQHA 2BDOA 4GNXA 1PYWD 1D6EC 4IUVA 2DN8A 1XYIA 2DY7A 1E0BA 3S1QH 2I46A 3SK8A 2OCEA 4DA2A 4PQXA 3MTSA 1EY5A 4OX9L 1JB3A 1CSQA 3A8JE 3MVVA 3HOYH 1K8MA 3KLRA 5CV4A 2JK8A 2ICEC 3HP3A 2JA6B 4A3GB 5JPNC 2ES2A 2R7ZH 1OO9B 2D0OA 2K5DA 3I4NB 1QJOA 3GTKB 1JJGA 1S5DD 2JQOA 1I94Q 1TU2B 4RGMA 1VQPA 2N8NA 4LNQA 2JP1A 3SGIA 1J5EL 1BKBA 3OW2A 3CCSA 1TT2A 3CPFA 1MJCA 3AFPA 1EQTA 4A3BB 1XXGA 4R1JA 2Y0SG 2PMZB 1K3BC 1HFNA 2KCMA 3SR1A 2BA1A 3KLSX 5JVG3 1MSHA 1WCMH 3HGBA 1U9RA 2WB1E 4YCVA 1EEID 1SE8A 3I73A 2IY5B 2UUCL 3K7UC 3HOXH 1BNZA 2KOLA 2PW7A 1LT5D 3MFGA 1H9SB 3ZYYX 1E2WA 4HSPA 1X54A 1Q12A 2R7DA 5FLMH 2A19A 3CF5A 1K83H 4CDFC 3DUZA 1WTOA 1U4LA 2VY3A 3KJPA 2WACA 1I50B 5BR8L 1I4QA 2R3ZA 1Y1VG 5C44G 4LF9L 1D2BA 3TZDA 3S1RB 2UUBL 2KCCA 1N8RC 3AB9A 3GTJB 4YWMA 2BDNA 3PIOA 3PO2H 3FDTA 2G9DA 4I7ZC 1LTID 2A8VA 4BY7G 1WTXA 4K0KL 1B8AA 4A3JH 3S2HB 1VQKA 3P20A 1F77A 1FL0A 5CV5A 4JI4Q 2A5HA 1BCPB 4YHHQ 4DNTB 3DWQA 4DR6Q 3GTOH 2Y0SB 3BVMA 4U673 2F0NA 1A63A 1X55A 4QCLA 2NVYB 3OMGA 2UXBQ 1LV9A 1T5XD 4HIOA 1YNXA 2Z6BA 5CMDA 5JEAH 5J1ZA 4RAUC 4R4OA 1IL8A 4IOAA 1DGSA 2AWOA 5H1SE 2MP1A 3NENA 4KLKA 5JOBA 2EZVA 1JWUD 5J3BA 4NXML 1H9MA 1ONLA 5IGBA 3G48A 2Z4HA 1N34Q 1YHBA 1NBWA 3MXNA 1LO5D 1BO0A 5CYUA 1PVOA 3HOUG 1R4QB 3FMCA 4MN3A 2NN6G 3VR4A 2EOTA 1JCKB 4DR1L 4C3IG 1QZHA 3N52A 1Y1VB 2K7VA 1CM9A 2WKDA 4HN7A 4CDDC 3ER0A 1STEA 2KBNA 5KGUA 2N88A 1EZ8A 3P7JA 2R93B 4DV4L 3S14B 3BVGA 1B50A 2N49A 3S1NB 2B8FA 4UP8A 3I4MG 5AJ3L 1AFPA 2ZXPA 5ELOA 4DV2Q 1F9SA 1CTMA 3M7GA 2AQ3B 3E5SA 1K0SA 3GTGB 1JWSD 4JI7L 1EWCA 5FLXL 4UDUC 2K5VA 1VQAA 3BU2A 4IJHA 3T53B 4XDXA 4OX9Q 4OO1I 3MEHA 4GOPA 1SN8A 3H91A 3ICEA 2B2YA 5ISRA 1VQ6A 3RLFA 1EY0A 1E22A 1LLRD 3PO3G 1IW7D 4GKJL 2F0MA 2EYLA 4KJOA 3SVMA 2L5TA 2RF4A 4GOPB 4CGYB 4B3SL 5FLXc 1B7YB 3SE0A 3H15A 2K04A 2CFMA 5EPKA 5AFWA 1B53A 1J5EQ 1FYCA 1CZGA 1AH9A 1E2ZA 4FO2A 4A3IH 3HOZG 4C3IB 1X6OA 4DK0A 4IUNA 4TKOB 3I7FA 2EYMA 3X3MA 2A68C 3M85A 4A3LG 4KTAA 5DM73 3I4MB 3U4ZA 2J4XA 4P73A 3K7AB 2UUAL 1H95A 3K5NA 2UUCQ 2D2CC 3GQBA 1PH9A 1HCZA 4ZQ3A 3BDLA 1XMQL 3MAQA 3D4RA 3U58A 3VR2A 4OEMB 3U50C 1EIYB 2DJGC 4G7HC 1HUNA 4A3EH 4A3KB 1GUTA 2P5ZX 3SK5A 1NTGA 3PO3B 1NR4A 1IBMQ 4DV3L 4V0BA 5EKIA 2UUBQ 1G2SA 3N6RA 1JOQA 2RDGA 5KEEA 3Q22A 1KDAA 3BJUA 4S3SA 3URYA 3M4OB 4C3HB 4F88A 5ELDA 3M4PA 3NHHA 2EYJA 3CC7A 4J6HA 4LWCA 1JORA 3RLNA 1Y1WH 2MFIA 2B2VC 2BH8A 3S17B 1WTVA 1QNUA 2NVXH 3HOWG 4NP5A 1Q86C 1SJHD 1MD2D 4IJLA 1SYFA 4KHVA 2KHJA 4B9WA 1TWFB 2IX0A 1S72A 1JJ2A 4FXKC 3CU7A 1A2UA 3HKZG 5K36H 1HTPA 1EY9A 4G7ZC
chains in the Genus database with same CATH topology
4LFBL 4LF4Q 4JI8Q 1HNWQ 2VQFL 5IYDG 4NB3A 3J80i 3HOVG 3S15H 3DLLA 2XGTA 3I2ZA 1EQQA 4B3TL 4A3IG 4DV5Q 4IPHA 1GD7A 1UE1A 2RHQB 5DLQE 1FVIA 1M1KC 4GLVB 5M3MG 2ZTCA 4IFDG 1UEBA 2OTJA 4NXNQ 2C35B 3CCJA 2HIXA 1PFSA 1YEZA 3TS0A 1J6QA 4H02A 2PNHA 2JA6H 5M5WH 4A3GH 2PQAB 1S40A 2KHIA 3EN2A 2JE6I 1CKMA 1NY4A 4DV4Q 3UDGA 1QZGA 1G291 3HKSA 5GADC 2JA5H 4L5SA 3I4NH 3CXCA 2CWPA 4B3MQ 4ALPA 2E5LL 3J81j 3D0FA 3GTKH 4GNXB 4XIGS 4X64L 2JEAI 3HOWH 5AJ3Q 4A3FG 4O2DA 3WWVA 3FP9A 2RCNA 2Q2IA 4IPDA 4JBJA 1E1OA 1VCIA 2YU9H 1HJPA 3GD7A 4JI1L 2JA9A 1VQ9A 3M3YH 3RZOH 3D31A 1I5FA 3A5ZB 2V1CC 4JC0A 2LSSA 2ZJRA 4DUZL 4JI7Q 2CCZA 3K0XA 4LUZA 1HNXL 1ASZA 4LF5Q 4P74A 4A3BH 1SR3A 1YZ6A 2E8GA 1A8VA 3G4SA 2B63G 4IPGA 3NBHB 1V43A 3CMEA 4BBSG 3CMAA 1VQ7A 1K8GA 3CPWA 2WFWA 2B29A 2KENA 3L7ZC 4LW1A 4JI2Q 5LMUQ 2JJQA 4DK3C 4QIWE 3DM3A 4A93G 4DK6C 3PGZA 4EX5A 5M3FH 1PH8A 3UDIA 3CCQA 5M3MH 3L0OA 4YWLA 1MIUA 1EWIA 4A4IA 4GKJQ 1YI2A 2JA7G 4A3MG 3GO5A 4JI5L 5LMNL 1UWVA 1KRTA 1IL2A 3A0JA 2MO0A 1VS0A 4A75A 2AMCB 4B3SQ 1IYJB 5IYCG 5C4XH 5EAYA 1G51A 2ZTDA 4JOIC 2UXDQ 2N3SA 4TVAB 4DNIA 2OWOA 1N33Q 3MEFA 3KDFA 1PYSB 4BBRG 2EXDA 3G71A 3T1HL 1TWAH 3I55A 3GTMH 2Q2HA 4NPSA 4QJFA 5FJ8H 2F52A 4HJ9A 4FDBA 1JE5A 2AKWB 1I50H 1KAWA 2K50A 4R4TA 1YHQA 4B3RL 4WJ3M 3J81i 4OXPA 3J81c 4DV7Q 1Y1WG 2D62A 5IP9H 1VQMA 4ME3A 1X3FA 5C0XG 3ULJA 1X9NA 3I56A 3S1RH 3JAMi 3JAMc 4R4CA 3PV0A 1LTLA 4GLAC 3GTJH 5JJIA 2Q2TA 2ZJQA 2B63H 2I5MX 2I5LX 2ZM6L 1VQ5A 4YCWA 2UUAQ 4UP9A 3K80C 4GLXA 3KFUA 3CCRA 5BR8Q 4YCUA 3FKIG 1PH4A 3H0GG 2AWNA 1VQOA 2WP8J 4LF9Q 5K36G 2ALYB 4A93H 3S2HH 1IBML 1M90C 4P71A 4OONA 4X66Q 3CQZH 1YHAA 1MKHA 4DR6L 3Q8DA 1BBUA 2R93G 3KF8B 4JCVE 1XMQQ 3ULPA 1WYDA 4UPAA 4HIDA 1HZ9A 2R6GA 3IRBA 2I0QA 4GN3B 1YITA 1VQCA 2JA8H 4UP7A 4RMFA 5IYCH 4GKKQ 2UXBL 5GROA 1SRUA 2NVYH 3BZKA 3CP0A 3T1YQ 3PUXA 1L1OC 4K0KQ 4HJAA 4JYAL 4DR3L 3E9HA 2F3IA 3PSIA 2CQOA 1PH2A 4YY3L 2JA6G 2MQHA 4DV3Q 4LFAL 5IP7H 3CC2A 3S2DH 3PIPA 4DR4L 4UY8C 1RIPA 2NZHA 2JA5G 1FJGQ 3I4NG 1W3SA 2B3GA 2NVQH 2E2IH 1N34L 4R4QA 1AE2A 3S24A 4GN5A 3TEHB 1QUQA 1VQ4A 4QY7A 4HJ5A 3HOYG 2IX1A 2VS1A 2WAQE 4QL5A 4X65Q 2EIFA 4MTNA 3W1GA 4GOPC 3CCMA 4LF6Q 4GS3A 3RLOA 4A3DG 3FKIH 2R7ZG 1EIFA 1E7ZA 1S3OA 4MZ9A 1YIJA 1PH1A 4A3BG 4AQYL 4LF7L 3PF5A 1P16A 3AEVA 1QUQB 1Y1VH 1HNZQ 3CD6A 4NXMQ 1VQBA 4DV6Q 3PUZA 4JV5Q 4WJ4A 2OQKA 3E9IA 1GO3E 1SROA 2R93H 1I6HH 2K5HA 3S14H 4LF4L 4JI8L 3J80c 4A3CH 1WI5A 1D8LA 2Z6KA 4P75A 3PUWA 2PQAA 3RR5A 3S1NH 4DV2L 4HIKA 5M3FG 2UU9Q 1VQHA 2QGQA 1YVCA 4DR1Q 3CW2C 2BH2A 3ERSX 4X6AH 4DV1Q 4GNXA 4LFCL 2K4KA 1Z9FA 2E2JH 2VZAA 3MXNB 5M5YH 1NJIC 2BA0A 1KD1C 5HY6A 4IPCA 2Z0SA 4L5QA 3A5UA 5C4XG 3GTGH 3S1QH 1IZ6A 2QEXA 3H3VH 1TWHH 1XMOL 4LFBQ 1QVGA 2OCEA 4DUYQ 5HGQA 1WCMG 2VQFQ 1XNRL 4KHPL 1TWGH 4OX9L 1HZCA 1CSQA 4B3TQ 5FJ8G 3CCLA 1SFOH 3HOXG 3PUVA 3HOYH 3AFQA 4RG1A 2JK8A 5IP9G 1IBLL 1XJVA 4L5RC 4JI3Q 3CC4A 4A3DH 2ES2A 1A0IA 2R7ZH 5IWAL 2D0OA 3FHWA 1L1OB 5FLMG 4OO1G 1N36L 3GDEA 1JMCA 3NEMA 1X65A 4BY1G 3UE1A 2JQOA 1I94Q 1UE7A 1JJGA 2E5LQ 1E3PA 1VQEA 1VQPA 4LF8L 2N8NA 4J15A 4LNQA 1W2BA 3SGIA 3F2DA 1J5EL 4A3KG 1K9MC 1BKBA 2GN5A 1QVCA 3OW2A 3CCSA 3OTOL 2NZOA 5JJKA 3CPFA 4JI1Q 1MJCA 3AFPA 4C3IH 2IHFA 2ATWA 3PF4A 4Y52H 1T9HA 4R1JA 2Y0SG 4DUZQ 3M7NA 1HNXQ 2K52A 2KCMA 4AYBE 1KQSA 2JA8G 3U4VA 4DR2Q 3S1MH 4X62L 2BA1A 4DR4Q 2K75A 2LXJA 1CKNA 2VQEL 1WCMH 2WB1E 1N33L 4JG2A 1VQFA 4YCVA 3I4MH 4A3JG 2F4VL 1VQDA 3K7AH 1SE8A 4DAYB 2IY5B 3EBEA 3K7UC 3HOXH 5IP7G 2UUCL 3VDYA 2YTVA 1OXUA 1CKNB 2OTLA 4DV7L 4JI5Q 1X54A 4KHZA 5LMNQ 1Q12A 4JBKA 4POFA 1HZBA 2R7DA 4IFDJ 5FLMH 2A19A 3CF5A 5LMNW 2PI2A 1K83H 1XPRA 4IO9A 4BY1H 3ULLA 1U0LA 2VY3A 5JEAG 2VNUD 3KJPA 1C7YA 2LXKA 2OQ0A 4PZ6A 1V1QA 5BR8L 2K5NA 2DGYA 3E0EA 4BA2I 1EUJA 4C2MH 2A1AA 4MNOA 1Y1VG 5C44G 4A3KH 4LF9L 4B3RQ 2UUBL 4JI6L 4X66L 1OXVA 3PO3H 2YV5A 1N8RC 1Q81C 4YWMA 1K8AC 2AHOB 1JB7A 4A3CG 2GVAA 1LUZA 3PIOA 1HR0L 3PO2H 1TXYA 1EOVA 2RHSB 1YJNA 2ZJPA 4OWWB 1NMGA 1N32Q 2A8VA 4BY7G 1OXTA 1X3EA 2ZM6Q 3AQQA 3RZDH 2Z6KC 4OWXB 4DV0L 4K0KL 3M4OH 1B8AA 4C3HH 4A3JH 4QQBX 1VQKA 2XTIA 1NMFA 1FL0A 1E24A 4JI4Q 4YHHQ 5GAEC 2H5XA 3HOZH 4DR6Q 3GTOH 1PH5A 3HKZE 2ZTEA 3NELA 3UE0A 1GKHA 3TQYA 1GM5A 1I3QH 4GN4B 4APVA 2PMZE 3G6EA 3RN5A 3EIVA 4DR5L 1XNQL 4JOIA 1A63A 1X55A 1NE3A 3S17H 2HQLA 4JBMA 1Q1EA 2IHEA 2NVTH 4JI0L 4A3LH 2UXBQ 1GVPA 3OYYA 2HHHL 4HIOA 2FXQA 1YNXA 4JYAQ 4DR3Q 4DR7L 1C9OA 4R4OA 4A76A 2UXCL 3GTPH 1IBKL 4YY3Q 4HIMA 1K0RA 1DGSA 1OXSC 4C3JH 2AWOA 4LFAQ 5H1SE 1VQJA 1Q46A 3NENA 4KLKA 3TREA 2KCTA 5IYBH 5C44H 1TWFH 3F2BA 2QA4A 1HH2P 3AYHB 5J3BA 4NXML 3PUYA 4P72A 3G48A 1LYLA 1N9WA 1O7IA 1N34Q 1HNWL 1YHBA 1NBWA 5E7NA 5ELNA 5C0XJ 1CUKA 1PVOA 2YYZA 3RNUA 3HOUG 4BY7H 1YBYA 3KOJA 4DV5L 3KLWA 1KC8C 1Z47A 2NN6G 3STBD 1G6PA 4DR1L 1QZHA 4NXNL 1PV4A 3I4OA 4DV1L 4BXXH 2PI2E 4AQYQ 1P8LA 2ID0A 2KBNA 1JJCB 3ER0A 4PMWA 4LF7Q 1VQGA 4DV4L 1PH7A 2IT1A 1WOCA 4IFDI 3STBC 3RN2A 2N49A 4B3ML 1WJJA 4DKAC 3M4QA 4DUYL 4UP8A 3I4MG 2WAQG 2VW9A 3LGJA 1L1OA 5AJ3L 5ELOA 3CCVA 4Y7NH 2CKZB 4DV2Q 3S16H 1U5KA 4O0AA 2HIVA 4OWTB 1IXRA 2I5HA 1B70B 1EQRA 4JI3L 5C4JH 1MJEA 4LFCQ 4IOAA 3TRZA 3W1BA 4JI7L 1FGUA 5GQOA 1ASYA 1XPOA 4LF5L 5C3EG 2K5VA 1YJWA 2Y0SE 1VQAA 3L2PA 1XMOQ 1CKOA 1XNRQ 1XTDA 3BU2A 4IJHA 1I94L 1QVFA 4OX9Q 4KHPQ 4X64Q 2JEBI 2VUMH 1BVSA 2MO1A 1Q1BA 4OO1I 4JI2L 4GOPA 5LMUL 3HOUH 1SN8A 3KYHC 3ICEA 1VQ6A 3B6YA 3RLFA 1XPUA 1E22A 1Q82C 1IBLQ 3PO3G 2D0PA 4GKJL 1KL9A 5IWAQ 4IOCA 4TQUS 3PO2G 2RF4A 1UE5A 4GOPB 1N36Q 4B3SL 5FLXc 1B7YB 2DUDA 4DR2L 3H15A 1KIXA 3CCUA 4LF8Q 2UXDL 3GTLH 2CFMA 4A3EG 3CAMA 5JJLA 1C0AA 5IYDH 1VQIA 1L0WA 3HOVH 2K14A 1J5EQ 1SLJA 4AIMA 1PH6A 1AH9A 1L2FA 1A62A 4A3IH 3HOZG 3OTOQ 1X6OA 2ASBA 1X3GA 1KRSA 1E1TA 4PZ7A 3I7FA 1K73C 1Q8KA 3HFZB 3W5OA 3M85A 4A3LG 5C3EH 4X62Q 1OTCA 2VQEQ 2EQSA 3GTQH 3F8TA 4P73A 3U4ZA 2HT1A 5C0XI 2UUAL 1H95A 1EFWA 3T1HQ 2F4VQ 3BZCA 4A3FH 4QGUA 2UUCQ 5IYBG 1PH9A 1PH3A 1Y14B 2YTXA 4AYBG 1AE3A 1K3RA 3KDFB 1XMQL 4POGA 3U58A 3U50C 3JC66 2CWAA 2WB1G 4GKKL 1N32L 3F1ZA 4HJ8A 1LM0A 3K8AA 1EIYB 1PHJA 2R92G 3K81C 3KF6A 3T1YL 4BBSH 4L5TA 1UE6A 1HZAA 4LUVA 4AH6A 4A3EH 1VQ8A 5GAGC 5IE8A 4BXXG 1KXLA 1EYGA 1NTGA 2GVBA 3J7ZC 3A74A 2L15A 4DV3L 1IBMQ 1BBWA 4GNXC 4YHHL 4HJ7A 4JI4L 2UUBQ 4YWKA 4JI6Q 5IY0A 3KF6B 4LUOA 1FJGL 2JA7H 1R9TH 4A3MH 1HR0Q 1D7QA 4DPGA 2VL6A 3BJUA 3UDFA 2MNAA 1HR0W 2E2HH 1V9PA 3H3VI 4X65L 3J7A5 1TWCH 4DV0Q 1VQLA 5GAHC 4LF6L 3CCEA 4BBRH 3F2CA 4JBWA 1YJ9A 2N78A 3M4PA 4R4IA 1SMXA 3CC7A 4A3GG 1OXXK 4LWCA 3RLNA 1HNZL 1PYBA 1Y1WH 2MFIA 1KHIA 3M9BA 4DV6L 4JV5L 1JT8A 2BH8A 2YTYA 1RL2A 1WFQA 4DR5Q 1XNQQ 2NVXH 2VUMG 3HOWG 3ZJYC 1Q86C 2Q2UA 2R7FA 1VQNA 4JI0Q 5IT9c 1X56A 4IJLA 2UU9L 2HHHQ 3TS2A 2R92H 4BA1I 4XTCS 1CSPA 4DR7Q 2KHJA 1Q7YC 3UDXA 2UXCQ 1IBKQ 3PCOB 2IX0A 3H0GH 5JEAJ 1S72A 1JJ2A 4PG3A 1PA6A 3HKZG 4PZ8A 3KJOA 4KI0A 4DAMA 4EQ5A 2NN6I 5M5XH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LFB L;  4LF4 Q;  4JI8 Q;  1HNW Q;  2VQF L;  5IYD G;  4NB3 A;  3J80 i;  3HOV G;  3S15 H;  3DLL A;  2XGT A;  3I2Z A;  1EQQ A;  4B3T L;  4A3I G;  4DV5 Q;  4IPH A;  1GD7 A;  1UE1 A;  2RHQ B;  5DLQ E;  1FVI A;  1M1K C;  4GLV B;  5M3M G;  2ZTC A;  4IFD G;  1UEB A;  2OTJ A;  4NXN Q;  2C35 B;  3CCJ A;  2HIX A;  1PFS A;  1YEZ A;  3TS0 A;  1J6Q A;  4H02 A;  2PNH A;  2JA6 H;  5M5W H;  4A3G H;  2PQA B;  1S40 A;  2KHI A;  3EN2 A;  2JE6 I;  1CKM A;  1NY4 A;  4DV4 Q;  3UDG A;  1QZG A;  1G29 1;  3HKS A;  5GAD C;  2JA5 H;  4L5S A;  3I4N H;  3CXC A;  2CWP A;  4B3M Q;  4ALP A;  2E5L L;  3J81 j;  3D0F A;  3GTK H;  4GNX B;  4XIG S;  4X64 L;  2JEA I;  3HOW H;  5AJ3 Q;  4A3F G;  4O2D A;  3WWV A;  3FP9 A;  2RCN A;  2Q2I A;  4IPD A;  4JBJ A;  1E1O A;  1VCI A;  2YU9 H;  1HJP A;  3GD7 A;  4JI1 L;  2JA9 A;  1VQ9 A;  3M3Y H;  3RZO H;  3D31 A;  1I5F A;  3A5Z B;  2V1C C;  4JC0 A;  2LSS A;  2ZJR A;  4DUZ L;  4JI7 Q;  2CCZ A;  3K0X A;  4LUZ A;  1HNX L;  1ASZ A;  4LF5 Q;  4P74 A;  4A3B H;  1SR3 A;  1YZ6 A;  2E8G A;  1A8V A;  3G4S A;  2B63 G;  4IPG A;  3NBH B;  1V43 A;  3CME A;  4BBS G;  3CMA A;  1VQ7 A;  1K8G A;  3CPW A;  2WFW A;  2B29 A;  2KEN A;  3L7Z C;  4LW1 A;  4JI2 Q;  5LMU Q;  2JJQ A;  4DK3 C;  4QIW E;  3DM3 A;  4A93 G;  4DK6 C;  3PGZ A;  4EX5 A;  5M3F H;  1PH8 A;  3UDI A;  3CCQ A;  5M3M H;  3L0O A;  4YWL A;  1MIU A;  1EWI A;  4A4I A;  4GKJ Q;  1YI2 A;  2JA7 G;  4A3M G;  3GO5 A;  4JI5 L;  5LMN L;  1UWV A;  1KRT A;  1IL2 A;  3A0J A;  2MO0 A;  1VS0 A;  4A75 A;  2AMC B;  4B3S Q;  1IYJ B;  5IYC G;  5C4X H;  5EAY A;  1G51 A;  2ZTD A;  4JOI C;  2UXD Q;  2N3S A;  4TVA B;  4DNI A;  2OWO A;  1N33 Q;  3MEF A;  3KDF A;  1PYS B;  4BBR G;  2EXD A;  3G71 A;  3T1H L;  1TWA H;  3I55 A;  3GTM H;  2Q2H A;  4NPS A;  4QJF A;  5FJ8 H;  2F52 A;  4HJ9 A;  4FDB A;  1JE5 A;  2AKW B;  1I50 H;  1KAW A;  2K50 A;  4R4T A;  1YHQ A;  4B3R L;  4WJ3 M;  3J81 i;  4OXP A;  3J81 c;  4DV7 Q;  1Y1W G;  2D62 A;  5IP9 H;  1VQM A;  4ME3 A;  1X3F A;  5C0X G;  3ULJ A;  1X9N A;  3I56 A;  3S1R H;  3JAM i;  3JAM c;  4R4C A;  3PV0 A;  1LTL A;  4GLA C;  3GTJ H;  5JJI A;  2Q2T A;  2ZJQ A;  2B63 H;  2I5M X;  2I5L X;  2ZM6 L;  1VQ5 A;  4YCW A;  2UUA Q;  4UP9 A;  3K80 C;  4GLX A;  3KFU A;  3CCR A;  5BR8 Q;  4YCU A;  3FKI G;  1PH4 A;  3H0G G;  2AWN A;  1VQO A;  2WP8 J;  4LF9 Q;  5K36 G;  2ALY B;  4A93 H;  3S2H H;  1IBM L;  1M90 C;  4P71 A;  4OON A;  4X66 Q;  3CQZ H;  1YHA A;  1MKH A;  4DR6 L;  3Q8D A;  1BBU A;  2R93 G;  3KF8 B;  4JCV E;  1XMQ Q;  3ULP A;  1WYD A;  4UPA A;  4HID A;  1HZ9 A;  2R6G A;  3IRB A;  2I0Q A;  4GN3 B;  1YIT A;  1VQC A;  2JA8 H;  4UP7 A;  4RMF A;  5IYC H;  4GKK Q;  2UXB L;  5GRO A;  1SRU A;  2NVY H;  3BZK A;  3CP0 A;  3T1Y Q;  3PUX A;  1L1O C;  4K0K Q;  4HJA A;  4JYA L;  4DR3 L;  3E9H A;  2F3I A;  3PSI A;  2CQO A;  1PH2 A;  4YY3 L;  2JA6 G;  2MQH A;  4DV3 Q;  4LFA L;  5IP7 H;  3CC2 A;  3S2D H;  3PIP A;  4DR4 L;  4UY8 C;  1RIP A;  2NZH A;  2JA5 G;  1FJG Q;  3I4N G;  1W3S A;  2B3G A;  2NVQ H;  2E2I H;  1N34 L;  4R4Q A;  1AE2 A;  3S24 A;  4GN5 A;  3TEH B;  1QUQ A;  1VQ4 A;  4QY7 A;  4HJ5 A;  3HOY G;  2IX1 A;  2VS1 A;  2WAQ E;  4QL5 A;  4X65 Q;  2EIF A;  4MTN A;  3W1G A;  4GOP C;  3CCM A;  4LF6 Q;  4GS3 A;  3RLO A;  4A3D G;  3FKI H;  2R7Z G;  1EIF A;  1E7Z A;  1S3O A;  4MZ9 A;  1YIJ A;  1PH1 A;  4A3B G;  4AQY L;  4LF7 L;  3PF5 A;  1P16 A;  3AEV A;  1QUQ B;  1Y1V H;  1HNZ Q;  3CD6 A;  4NXM Q;  1VQB A;  4DV6 Q;  3PUZ A;  4JV5 Q;  4WJ4 A;  2OQK A;  3E9I A;  1GO3 E;  1SRO A;  2R93 H;  1I6H H;  2K5H A;  3S14 H;  4LF4 L;  4JI8 L;  3J80 c;  4A3C H;  1WI5 A;  1D8L A;  2Z6K A;  4P75 A;  3PUW A;  2PQA A;  3RR5 A;  3S1N H;  4DV2 L;  4HIK A;  5M3F G;  2UU9 Q;  1VQH A;  2QGQ A;  1YVC A;  4DR1 Q;  3CW2 C;  2BH2 A;  3ERS X;  4X6A H;  4DV1 Q;  4GNX A;  4LFC L;  2K4K A;  1Z9F A;  2E2J H;  2VZA A;  3MXN B;  5M5Y H;  1NJI C;  2BA0 A;  1KD1 C;  5HY6 A;  4IPC A;  2Z0S A;  4L5Q A;  3A5U A;  5C4X G;  3GTG H;  3S1Q H;  1IZ6 A;  2QEX A;  3H3V H;  1TWH H;  1XMO L;  4LFB Q;  1QVG A;  2OCE A;  4DUY Q;  5HGQ A;  1WCM G;  2VQF Q;  1XNR L;  4KHP L;  1TWG H;  4OX9 L;  1HZC A;  1CSQ A;  4B3T Q;  5FJ8 G;  3CCL A;  1SFO H;  3HOX G;  3PUV A;  3HOY H;  3AFQ A;  4RG1 A;  2JK8 A;  5IP9 G;  1IBL L;  1XJV A;  4L5R C;  4JI3 Q;  3CC4 A;  4A3D H;  2ES2 A;  1A0I A;  2R7Z H;  5IWA L;  2D0O A;  3FHW A;  1L1O B;  5FLM G;  4OO1 G;  1N36 L;  3GDE A;  1JMC A;  3NEM A;  1X65 A;  4BY1 G;  3UE1 A;  2JQO A;  1I94 Q;  1UE7 A;  1JJG A;  2E5L Q;  1E3P A;  1VQE A;  1VQP A;  4LF8 L;  2N8N A;  4J15 A;  4LNQ A;  1W2B A;  3SGI A;  3F2D A;  1J5E L;  4A3K G;  1K9M C;  1BKB A;  2GN5 A;  1QVC A;  3OW2 A;  3CCS A;  3OTO L;  2NZO A;  5JJK A;  3CPF A;  4JI1 Q;  1MJC A;  3AFP A;  4C3I H;  2IHF A;  2ATW A;  3PF4 A;  4Y52 H;  1T9H A;  4R1J A;  2Y0S G;  4DUZ Q;  3M7N A;  1HNX Q;  2K52 A;  2KCM A;  4AYB E;  1KQS A;  2JA8 G;  3U4V A;  4DR2 Q;  3S1M H;  4X62 L;  2BA1 A;  4DR4 Q;  2K75 A;  2LXJ A;  1CKN A;  2VQE L;  1WCM H;  2WB1 E;  1N33 L;  4JG2 A;  1VQF A;  4YCV A;  3I4M H;  4A3J G;  2F4V L;  1VQD A;  3K7A H;  1SE8 A;  4DAY B;  2IY5 B;  3EBE A;  3K7U C;  3HOX H;  5IP7 G;  2UUC L;  3VDY A;  2YTV A;  1OXU A;  1CKN B;  2OTL A;  4DV7 L;  4JI5 Q;  1X54 A;  4KHZ A;  5LMN Q;  1Q12 A;  4JBK A;  4POF A;  1HZB A;  2R7D A;  4IFD J;  5FLM H;  2A19 A;  3CF5 A;  5LMN W;  2PI2 A;  1K83 H;  1XPR A;  4IO9 A;  4BY1 H;  3ULL A;  1U0L A;  2VY3 A;  5JEA G;  2VNU D;  3KJP A;  1C7Y A;  2LXK A;  2OQ0 A;  4PZ6 A;  1V1Q A;  5BR8 L;  2K5N A;  2DGY A;  3E0E A;  4BA2 I;  1EUJ A;  4C2M H;  2A1A A;  4MNO A;  1Y1V G;  5C44 G;  4A3K H;  4LF9 L;  4B3R Q;  2UUB L;  4JI6 L;  4X66 L;  1OXV A;  3PO3 H;  2YV5 A;  1N8R C;  1Q81 C;  4YWM A;  1K8A C;  2AHO B;  1JB7 A;  4A3C G;  2GVA A;  1LUZ A;  3PIO A;  1HR0 L;  3PO2 H;  1TXY A;  1EOV A;  2RHS B;  1YJN A;  2ZJP A;  4OWW B;  1NMG A;  1N32 Q;  2A8V A;  4BY7 G;  1OXT A;  1X3E A;  2ZM6 Q;  3AQQ A;  3RZD H;  2Z6K C;  4OWX B;  4DV0 L;  4K0K L;  3M4O H;  1B8A A;  4C3H H;  4A3J H;  4QQB X;  1VQK A;  2XTI A;  1NMF A;  1FL0 A;  1E24 A;  4JI4 Q;  4YHH Q;  5GAE C;  2H5X A;  3HOZ H;  4DR6 Q;  3GTO H;  1PH5 A;  3HKZ E;  2ZTE A;  3NEL A;  3UE0 A;  1GKH A;  3TQY A;  1GM5 A;  1I3Q H;  4GN4 B;  4APV A;  2PMZ E;  3G6E A;  3RN5 A;  3EIV A;  4DR5 L;  1XNQ L;  4JOI A;  1A63 A;  1X55 A;  1NE3 A;  3S17 H;  2HQL A;  4JBM A;  1Q1E A;  2IHE A;  2NVT H;  4JI0 L;  4A3L H;  2UXB Q;  1GVP A;  3OYY A;  2HHH L;  4HIO A;  2FXQ A;  1YNX A;  4JYA Q;  4DR3 Q;  4DR7 L;  1C9O A;  4R4O A;  4A76 A;  2UXC L;  3GTP H;  1IBK L;  4YY3 Q;  4HIM A;  1K0R A;  1DGS A;  1OXS C;  4C3J H;  2AWO A;  4LFA Q;  5H1S E;  1VQJ A;  1Q46 A;  3NEN A;  4KLK A;  3TRE A;  2KCT A;  5IYB H;  5C44 H;  1TWF H;  3F2B A;  2QA4 A;  1HH2 P;  3AYH B;  5J3B A;  4NXM L;  3PUY A;  4P72 A;  3G48 A;  1LYL A;  1N9W A;  1O7I A;  1N34 Q;  1HNW L;  1YHB A;  1NBW A;  5E7N A;  5ELN A;  5C0X J;  1CUK A;  1PVO A;  2YYZ A;  3RNU A;  3HOU G;  4BY7 H;  1YBY A;  3KOJ A;  4DV5 L;  3KLW A;  1KC8 C;  1Z47 A;  2NN6 G;  3STB D;  1G6P A;  4DR1 L;  1QZH A;  4NXN L;  1PV4 A;  3I4O A;  4DV1 L;  4BXX H;  2PI2 E;  4AQY Q;  1P8L A;  2ID0 A;  2KBN A;  1JJC B;  3ER0 A;  4PMW A;  4LF7 Q;  1VQG A;  4DV4 L;  1PH7 A;  2IT1 A;  1WOC A;  4IFD I;  3STB C;  3RN2 A;  2N49 A;  4B3M L;  1WJJ A;  4DKA C;  3M4Q A;  4DUY L;  4UP8 A;  3I4M G;  2WAQ G;  2VW9 A;  3LGJ A;  1L1O A;  5AJ3 L;  5ELO A;  3CCV A;  4Y7N H;  2CKZ B;  4DV2 Q;  3S16 H;  1U5K A;  4O0A A;  2HIV A;  4OWT B;  1IXR A;  2I5H A;  1B70 B;  1EQR A;  4JI3 L;  5C4J H;  1MJE A;  4LFC Q;  4IOA A;  3TRZ A;  3W1B A;  4JI7 L;  1FGU A;  5GQO A;  1ASY A;  1XPO A;  4LF5 L;  5C3E G;  2K5V A;  1YJW A;  2Y0S E;  1VQA A;  3L2P A;  1XMO Q;  1CKO A;  1XNR Q;  1XTD A;  3BU2 A;  4IJH A;  1I94 L;  1QVF A;  4OX9 Q;  4KHP Q;  4X64 Q;  2JEB I;  2VUM H;  1BVS A;  2MO1 A;  1Q1B A;  4OO1 I;  4JI2 L;  4GOP A;  5LMU L;  3HOU H;  1SN8 A;  3KYH C;  3ICE A;  1VQ6 A;  3B6Y A;  3RLF A;  1XPU A;  1E22 A;  1Q82 C;  1IBL Q;  3PO3 G;  2D0P A;  4GKJ L;  1KL9 A;  5IWA Q;  4IOC A;  4TQU S;  3PO2 G;  2RF4 A;  1UE5 A;  4GOP B;  1N36 Q;  4B3S L;  5FLX c;  1B7Y B;  2DUD A;  4DR2 L;  3H15 A;  1KIX A;  3CCU A;  4LF8 Q;  2UXD L;  3GTL H;  2CFM A;  4A3E G;  3CAM A;  5JJL A;  1C0A A;  5IYD H;  1VQI A;  1L0W A;  3HOV H;  2K14 A;  1J5E Q;  1SLJ A;  4AIM A;  1PH6 A;  1AH9 A;  1L2F A;  1A62 A;  4A3I H;  3HOZ G;  3OTO Q;  1X6O A;  2ASB A;  1X3G A;  1KRS A;  1E1T A;  4PZ7 A;  3I7F A;  1K73 C;  1Q8K A;  3HFZ B;  3W5O A;  3M85 A;  4A3L G;  5C3E H;  4X62 Q;  1OTC A;  2VQE Q;  2EQS A;  3GTQ H;  3F8T A;  4P73 A;  3U4Z A;  2HT1 A;  5C0X I;  2UUA L;  1H95 A;  1EFW A;  3T1H Q;  2F4V Q;  3BZC A;  4A3F H;  4QGU A;  2UUC Q;  5IYB G;  1PH9 A;  1PH3 A;  1Y14 B;  2YTX A;  4AYB G;  1AE3 A;  1K3R A;  3KDF B;  1XMQ L;  4POG A;  3U58 A;  3U50 C;  3JC6 6;  2CWA A;  2WB1 G;  4GKK L;  1N32 L;  3F1Z A;  4HJ8 A;  1LM0 A;  3K8A A;  1EIY B;  1PHJ A;  2R92 G;  3K81 C;  3KF6 A;  3T1Y L;  4BBS H;  4L5T A;  1UE6 A;  1HZA A;  4LUV A;  4AH6 A;  4A3E H;  1VQ8 A;  5GAG C;  5IE8 A;  4BXX G;  1KXL A;  1EYG A;  1NTG A;  2GVB A;  3J7Z C;  3A74 A;  2L15 A;  4DV3 L;  1IBM Q;  1BBW A;  4GNX C;  4YHH L;  4HJ7 A;  4JI4 L;  2UUB Q;  4YWK A;  4JI6 Q;  5IY0 A;  3KF6 B;  4LUO A;  1FJG L;  2JA7 H;  1R9T H;  4A3M H;  1HR0 Q;  1D7Q A;  4DPG A;  2VL6 A;  3BJU A;  3UDF A;  2MNA A;  1HR0 W;  2E2H H;  1V9P A;  3H3V I;  4X65 L;  3J7A 5;  1TWC H;  4DV0 Q;  1VQL A;  5GAH C;  4LF6 L;  3CCE A;  4BBR H;  3F2C A;  4JBW A;  1YJ9 A;  2N78 A;  3M4P A;  4R4I A;  1SMX A;  3CC7 A;  4A3G G;  1OXX K;  4LWC A;  3RLN A;  1HNZ L;  1PYB A;  1Y1W H;  2MFI A;  1KHI A;  3M9B A;  4DV6 L;  4JV5 L;  1JT8 A;  2BH8 A;  2YTY A;  1RL2 A;  1WFQ A;  4DR5 Q;  1XNQ Q;  2NVX H;  2VUM G;  3HOW G;  3ZJY C;  1Q86 C;  2Q2U A;  2R7F A;  1VQN A;  4JI0 Q;  5IT9 c;  1X56 A;  4IJL A;  2UU9 L;  2HHH Q;  3TS2 A;  2R92 H;  4BA1 I;  4XTC S;  1CSP A;  4DR7 Q;  2KHJ A;  1Q7Y C;  3UDX A;  2UXC Q;  1IBK Q;  3PCO B;  2IX0 A;  3H0G H;  5JEA J;  1S72 A;  1JJ2 A;  4PG3 A;  1PA6 A;  3HKZ G;  4PZ8 A;  3KJO A;  4KI0 A;  4DAM A;  4EQ5 A;  2NN6 I;  5M5X H; 
#chains in the Genus database with same CATH topology
 2PO4 A;  2VQF L;  5IYD G;  1SNM A;  3HOV G;  1DOM A;  3DLL A;  2XGT A;  4B3T L;  3I91 A;  4IPH A;  5DLQ E;  4GLV B;  4IFD G;  2Q8R E;  4ILW A;  1JE4 A;  3D4D A;  3TS0 A;  4FF1 A;  3CKI B;  4H02 A;  2JA6 H;  1SBB B;  4A3G H;  2PQA B;  1S40 A;  3WOF A;  4DV4 Q;  1VQN A;  3DHQ A;  1G29 1;  3I4N H;  2CWP A;  4ALP A;  1D5X C;  3BDC A;  3D0F A;  3GTK H;  3TBI B;  4QUC A;  5AJ3 Q;  1HXY D;  3OOC A;  3WWV A;  1PRT D;  4JBJ A;  3K5L A;  2BOS A;  5IOC A;  1O7L A;  4JI1 L;  4CJ2 C;  1BCP D;  3D31 A;  1I5F A;  3DM1 A;  4JI7 Q;  3K0X A;  4LUZ A;  4A3B H;  1W6K A;  1YZ6 A;  2J7Z A;  3G4S A;  5FO9 B;  1V43 A;  4QF4 A;  5NUC A;  4BBS G;  5JPM C;  3CMA A;  1LTT D;  1WTR A;  4QIW E;  4J8Q A;  1D1K A;  1PH8 A;  2RCF A;  3FRP B;  3D6C A;  4A4I A;  2QW7 A;  4GKJ Q;  4A3M G;  1VS0 A;  4B3S Q;  3H09 A;  3SEB A;  5EAY A;  2NWG A;  3HOV B;  1ZKO A;  4DNI A;  3FPP A;  4BBR G;  3I55 A;  1QWY A;  1SYE A;  1JWM D;  4R4T A;  3VR3 A;  1I50 H;  1YNN D;  3TP6 A;  2V4D A;  3I56 A;  3HZX A;  3JAM i;  5C3E B;  3JAM c;  5C4H A;  3SDZ A;  3S1R H;  3PV0 A;  3GTJ H;  1DXM A;  2ZJQ A;  2ZM6 L;  1EY6 A;  5FK9 C;  4YCW A;  2UUA Q;  4FF3 A;  3K80 C;  4LAA A;  1QIL A;  3W3A A;  3H0G G;  2AWN A;  5A2Q L;  1CT1 D;  1VQO A;  3S2H H;  4DXG A;  4OON A;  4X66 Q;  1MKH A;  2VB3 X;  3C2P A;  4KKS A;  3R8B A;  4JCV E;  1XMQ Q;  3AMU A;  3ULP A;  1HZ9 A;  5IT9 L;  2I0Q A;  4BBS B;  1TVX A;  2NVY H;  3PUX A;  1L1O C;  3BYY B;  3PSI A;  2B2W C;  1PH2 A;  3TP7 A;  4DV3 Q;  1BCP F;  3PIP A;  1R9T B;  4A3M B;  1TS5 A;  1ZYR D;  2D9U A;  3S24 A;  3TEH B;  1QUQ A;  3F2U A;  4QY7 A;  2IX1 A;  2VS1 A;  4BBR B;  3W1G A;  3CCM A;  1PMR A;  1CK1 A;  1YIJ A;  1PH1 A;  1QUQ B;  1Y1V H;  1GO3 E;  4QUF A;  2R93 H;  3S14 H;  1D8L A;  4P75 A;  1HPC A;  1SE3 A;  3RR5 A;  1C8C A;  3S1N H;  5M3F G;  4L63 B;  1V1P B;  2QGQ A;  1YVC A;  1EFI D;  3CW2 C;  3H0G B;  4O42 A;  2EE1 A;  4X6A H;  4LFC L;  2K4K A;  2FMC A;  1SMY C;  1MSG A;  5IT9 E;  1QE6 A;  5HY6 A;  5CBA E;  2EDG A;  3OW7 A;  1AP0 A;  4KKU A;  3GTG H;  3M4Y A;  4DUY Q;  1T5E A;  2VQF Q;  1HZC A;  4E6I A;  1A6X A;  4B3T Q;  3A7A B;  2B8G A;  4JI3 Q;  5IWA L;  4IZ8 A;  4EGV A;  2F0K A;  2D5D A;  4OO1 G;  1N36 L;  1X65 A;  3VA7 A;  4BY1 G;  4LF8 L;  1E3P A;  1VQE A;  4J15 A;  1DOL A;  4KK7 A;  3F2D A;  1GUO A;  2A6E D;  3J7Y W;  1A3U A;  4ZLT F;  4R8I A;  2GN5 A;  1QVC A;  2NN6 H;  5JJK A;  4JI1 Q;  4C3I H;  3PF4 A;  1T9H A;  2EY6 A;  1SE4 A;  2IL8 A;  3W2D A;  4UAI A;  3M7N A;  4AYB E;  4FVM A;  2JA8 G;  3U4V A;  1DOK A;  4HTH A;  2LXJ A;  2VQE L;  2B2T A;  3QWN A;  2FJ2 A;  1N33 L;  2OF1 A;  3I4M H;  3VR6 A;  5M3F B;  2F4V L;  3I70 A;  1MGS A;  3K7A H;  3QOJ A;  2Z9H A;  3QR8 A;  4DAY B;  3K59 A;  5M3M B;  5E4W C;  5IP7 G;  3WOE A;  3VDY A;  3TSS A;  1SSO A;  2HDM A;  3L9A X;  4X3T A;  5D65 A;  1UUP A;  4POF A;  4IFD J;  2NTT A;  3A7L A;  3NWT A;  2PI2 A;  2K33 A;  2VNU D;  1HFG A;  1RKN A;  1LTR D;  2PZW A;  4R8N A;  4PZ6 A;  1ZEQ X;  2DGY A;  4FXG C;  2IX3 A;  2A1A A;  4A3K H;  2NBF A;  1H9R A;  3PO3 H;  1SXT A;  5EKK A;  4A3C G;  1LUZ A;  4B9X A;  1EOV A;  1O7Z A;  2RHS B;  2TMP A;  1N32 Q;  4KKT A;  3V2T A;  1FGB D;  2ZM6 Q;  2JSO A;  3AQQ A;  2PPB C;  3H3V C;  2R61 A;  2SDF A;  3M4O H;  4C3H H;  3EA6 A;  3CQZ B;  1E24 A;  1V8Q A;  4ZK9 B;  3QB3 A;  5GAE C;  3HOZ H;  1PH5 A;  3NEL A;  1GKH A;  3TQY A;  2JA8 B;  1C4Q A;  3RN5 A;  2PMZ E;  3K5O A;  4DR5 L;  2OT2 A;  4JOI A;  2IW3 A;  1NE3 A;  2NZ1 D;  3S17 H;  4JBM A;  1Q1E A;  4A3L H;  1GVP A;  1BDO A;  3IL8 A;  4LK1 C;  4GZY C;  2A74 C;  3PIO 3;  4A76 A;  1ICW A;  1IBK L;  3UI2 A;  4HIM A;  1Y1W B;  1XTC D;  2PCF B;  1TWF H;  1J9O A;  1GUS A;  1KAB A;  2K5Q A;  2Z1C A;  1N9W A;  1O7I A;  5DM6 3;  1SJE D;  4K5W A;  1HNW L;  1Q3L A;  5E7N A;  1JOO A;  3R2T A;  3RNU A;  1F9R A;  1PTO B;  3KLW A;  3FKI B;  1I4P A;  1LT3 D;  3STB D;  4G57 A;  2L1B A;  1PV4 A;  2SOB A;  2F0V A;  4DV1 L;  1P8L A;  3HS0 C;  4PMW A;  1JJC B;  4ZYS A;  1SYC A;  2IT1 A;  1ICF B;  4IFD I;  3KLS A;  1LTA D;  1WJJ A;  4DKA C;  2WAQ G;  1GJX A;  2KHS A;  4KD4 A;  4K2L A;  2HIV A;  5KND A;  2I5H A;  1B70 B;  5M5Y B;  1EQR A;  4LFC Q;  5BN3 A;  3KBG A;  1FGU A;  1TWH B;  4CJ0 B;  1CHQ D;  1D5M C;  1TWG B;  2Y0S E;  3D3R A;  4ODG A;  3NTH A;  1XTD A;  1QVF A;  2JEB I;  5JAV A;  3KYH C;  4U68 A;  4A3D B;  3B6Y A;  3CHB D;  4X3U A;  4ZUI A;  2X6L A;  5IWA Q;  2OXP A;  3TP8 A;  2CH4 A;  2RDF A;  1N36 Q;  3KUP A;  1GUN A;  3T4A C;  4DR2 L;  1H9S A;  3CCU A;  4LF8 Q;  1IW7 C;  2PYK A;  4N8F A;  1C0A A;  5IYD H;  1L0W A;  3HOV H;  1V1O A;  2K14 A;  1STB A;  1SLJ A;  4RGT A;  1EIH A;  1B2T A;  1A62 A;  2LS0 1;  2ASB A;  3G6J B;  3TZU A;  4PZ7 A;  4ZKC B;  3S1M B;  1Q8K A;  3HFZ B;  3MXG A;  5ELE A;  5I6W A;  4IAL A;  5C3E H;  2VQE Q;  1HRJ A;  1EQV A;  4IUU A;  2JYO A;  2HCC A;  3F8T A;  4OIK A;  2F4I A;  4DFA A;  3T1H Q;  2F4V Q;  4C3J G;  4QGU A;  3K0Y A;  1X3Q A;  2QDL A;  2QEJ C;  2O5I C;  1NSN S;  3KDF B;  2WKC A;  1M4V A;  2WB1 G;  4GKK L;  5IGF A;  2EJG C;  2AQ1 B;  1PHJ A;  2R92 G;  3T1Y L;  1AEX A;  4BBS H;  4PNY A;  4C2M B;  5GAG C;  5IE8 A;  5C4Z A;  1VF7 A;  2GVB A;  3A74 A;  2L15 A;  4GNX C;  1GOZ A;  4HJ7 A;  1FJG L;  1R9T H;  4A3M H;  1YNJ D;  2DJF C;  3RUZ A;  1D7Q A;  5EJW A;  3T13 A;  1GHJ A;  5EGT A;  3RZD B;  2F0J A;  2OEO A;  3H3V I;  2F0E A;  3CCE A;  4BBR H;  3F2C A;  4CDC C;  1YJ9 A;  4L8J A;  1D5Z C;  1TY2 A;  1ENF A;  3VR5 A;  4NW2 A;  1LAB A;  1I3Q B;  2XWJ B;  4YIJ A;  4DR5 Q;  5A35 A;  2NVT B;  1LT4 D;  3K58 A;  4H44 C;  1QG7 A;  3TS2 A;  4BA1 I;  3LX0 A;  4C3J B;  4CJ1 B;  1KDC A;  5C44 B;  1IBK Q;  2E75 C;  4HCE A;  3H0G H;  2LFN A;  1I4R A;  4KI0 A;  4DAM A;  2H4O A;  4OGQ C;  4LFB L;  2BE5 D;  4JI8 Q;  1HNW Q;  4NB3 A;  3J80 i;  4BY7 B;  3I2Z A;  1DYQ A;  1SAP A;  1GD7 A;  1I4H A;  1UE1 A;  3K5M A;  1M1K C;  2ZTC A;  2C35 B;  3CCJ A;  4DK1 A;  4FP5 D;  4KN4 C;  3UDG A;  1CKM A;  3CXC A;  2E5L L;  2LMC B;  1Z6H A;  4Y7N B;  1NCV A;  4X64 L;  1NR2 A;  1AZP A;  4IPD A;  3SK6 A;  1E1O A;  1UAP A;  2KED A;  2V1C C;  4JC0 A;  5J39 A;  1SEB D;  1GXD C;  4K8I A;  1HNX L;  2K28 A;  1A8V A;  1PRT C;  2WV6 D;  2B63 G;  4IPG A;  3NBH B;  3IAY A;  1VQ7 A;  1PDQ A;  3BG3 A;  1BCP C;  3HOU B;  2B29 A;  2JJQ A;  1RTN A;  3DM3 A;  4A93 G;  4EX5 A;  5M3F H;  3J81 L;  3CCQ A;  4UHV A;  3NE5 B;  3L0O A;  5M3M H;  1MIU A;  4JI5 L;  5LMN L;  4JW0 A;  4KMU C;  4JK1 C;  1KRT A;  2MO0 A;  4A75 A;  2AMC B;  1RD9 D;  5IYC G;  2F1M A;  1G51 A;  2ZTD A;  2C9O A;  1JOK A;  2HQE A;  2X69 A;  3ERO A;  2OWO A;  1Z7T A;  1PYS B;  1PTO D;  3H6M A;  3MC0 B;  1HQR D;  2Q2H A;  4QJF A;  5FLX E;  3EFX D;  3FVQ A;  1JE5 A;  2AKW B;  1YHQ A;  3J81 i;  4OXP A;  3J81 c;  4RGN A;  4KY6 A;  1B3A A;  1VQM A;  4ME3 A;  1SND A;  1STY A;  5C0X G;  2MHV A;  4FF4 A;  5IGE A;  1LTL A;  4GLA C;  3GTQ B;  4OO1 H;  2RSO A;  4RA8 A;  4ZRZ A;  4KY5 A;  1DZ1 A;  2I5M X;  3O13 A;  3MHB A;  1YNN C;  4NDX A;  4RCN A;  2Z4I A;  4UP9 A;  4GLX A;  5BR8 Q;  3K57 A;  2RKS A;  1KTK A;  4LF9 Q;  2K05 A;  1QNK A;  1M90 C;  4P71 A;  1PZJ D;  3CQZ H;  2LY7 A;  2Q8T A;  3C1F A;  1WTQ A;  1BBU A;  1WYD A;  4HID A;  2R6G A;  3NBI A;  4GN3 B;  2JA8 H;  3BVZ A;  4UP7 A;  4GKK Q;  3J81 E;  1U4P A;  2F0W A;  3CP0 A;  1F2Y A;  3T1Y Q;  4K0K Q;  1H9J A;  4DR3 L;  2HUG A;  3HOZ B;  2F3I A;  1Q90 A;  2DNC A;  4YY3 L;  3E3X A;  5EBD A;  4LFA L;  5IP7 H;  4UY8 C;  2JA5 G;  1FJG Q;  5BN5 A;  4IUR A;  2RBM A;  2B39 A;  2E2H B;  3CRK C;  4R4Q A;  3D8G A;  3KK7 A;  3HOY G;  5C6A A;  4QL5 A;  2B2U A;  1ZYR C;  4GOP C;  1PTO H;  2GA4 B;  3FKI H;  2R7Z G;  2B2Y C;  1EIF A;  3NUC A;  2BCO A;  4AQY L;  4HED A;  4LF7 L;  1WTH A;  3I4L A;  1ESR A;  4NXM Q;  1VQB A;  4KJN A;  3PUZ A;  1SRO A;  4A3C H;  4LF4 L;  2J0T D;  1WI5 A;  4CDE C;  2Z6K A;  2PQA A;  3PIP 3;  1PTO F;  4RGO S;  4DR1 Q;  2WIN B;  1NAP A;  1Y8N B;  4MIU A;  2ENB A;  5I2Y A;  2VZA A;  5M5Y H;  3IFD A;  1SYG A;  1KD1 C;  5M5X B;  1ZXT A;  2MJ8 A;  2Z0S A;  4L5Q A;  4N8X 1;  3A5U A;  2KQ3 A;  1IZ6 A;  5C4X G;  1TWH H;  1XMO L;  3S15 B;  2MUY A;  1XNR L;  1BXT A;  4LFB Q;  1WCM G;  3DWP A;  4KHP L;  1TWG H;  1CI3 M;  5FJ8 G;  3CCL A;  5CV8 A;  3HOX G;  4IUQ A;  5IGD A;  2TSS A;  1Y69 U;  3AFQ A;  4RG1 A;  1IBL L;  1XJV A;  4A3D H;  1LTB D;  1A0I A;  2RA4 A;  2JA5 B;  5FLM G;  1L1O B;  2K32 A;  2G5D A;  4IUT A;  3Q23 A;  4XQN A;  3UE1 A;  3HOW B;  1UE7 A;  1DD2 A;  2E5L Q;  1HHV A;  2YU9 B;  2PZU A;  4WFN 3;  3NTK A;  1K9M C;  3QOL A;  4G4K A;  2NZO A;  1AW7 A;  5IOD A;  3HKZ B;  3JAM L;  4Y52 H;  1CA6 A;  5FO8 B;  1HNX Q;  2K52 A;  2A6E C;  3FPU B;  3OWE B;  2A6H D;  1CHP D;  3V96 A;  3S1M H;  4K6L A;  1HTL D;  2K75 A;  1CKN A;  1WTW A;  2ZXR A;  1RDP D;  4JG2 A;  1VQF A;  1B9N A;  3E6Z X;  4H0L C;  4A3J G;  1VQD A;  4RHR A;  2EY5 A;  4F7X A;  2HDL A;  1H9K A;  1OXU A;  1CKN B;  1VF5 C;  1EY4 A;  3A54 A;  4DV7 L;  2OTL A;  4JI5 Q;  4KHZ A;  5LMN Q;  4JBK A;  5C4X B;  5LMN W;  5EBC A;  4HCS A;  1XPR A;  1PFB A;  3ULL A;  1TWA B;  3I72 A;  5JEA G;  3GTM B;  2OQ0 A;  4HMJ A;  1R4P B;  4BA2 I;  1EUJ A;  1EYA A;  4C2M H;  4MNO A;  3MFY A;  1OXV A;  3QJY A;  2YV5 A;  1Q81 C;  2AHO B;  1HR0 L;  2L12 A;  4L6T B;  1YJN A;  2ZJP A;  1OXT A;  4DNR B;  1X3E A;  3RZD H;  2Z6K C;  4FF2 A;  3JAM E;  5FO7 B;  2XTI A;  4EQO A;  3R2I A;  3ND9 A;  3C1E A;  2H5X A;  1LT6 D;  1EWH A;  1GM5 A;  1I3Q H;  4APV A;  3G6E A;  2HQL A;  2NVT H;  3OYY A;  1B3Q A;  2FXQ A;  1B1Z A;  1STA A;  4DR3 Q;  2CQA A;  2FFK B;  2UXC L;  3S2D B;  4YY3 Q;  4MTK A;  1OXS C;  4C3J H;  4M1U B;  4LFA Q;  3TRE A;  1Q46 A;  5C44 H;  1QZG A;  3F2B A;  1V1P A;  3PUY A;  1IYV A;  3LWE A;  1LYL A;  2O5J C;  4XXE A;  4KV6 A;  5A2Q E;  5ELN A;  5C0X J;  1CUK A;  3Q24 A;  2KEC A;  4BY7 H;  3KOJ A;  1KC8 C;  5IGG A;  4DN4 M;  3I4O A;  3T16 A;  2PI2 E;  4AQY Q;  1XWE A;  4LF7 Q;  2IJ0 A;  1PH7 A;  2A69 D;  3GV6 A;  3STB C;  4OIJ A;  4DU9 A;  2F3V A;  3M4Q A;  4IQZ A;  4PMB A;  4LJZ C;  2VW9 A;  4IUP A;  4Y7N H;  2CKZ B;  2L55 A;  1BQQ T;  1STH A;  3DXJ C;  5E4X A;  1BR9 A;  4OWT B;  1LTS D;  3NPP A;  5C5M A;  2E2J B;  4CKB A;  5ELC A;  1ILP A;  3TRZ A;  3RMH A;  3W1B A;  5GQO A;  4OL7 A;  1XMO Q;  1XNR Q;  1I94 L;  4KHP Q;  4C1N K;  3X3N A;  1SFO B;  4ZKB B;  4JI2 L;  2XSC A;  2E76 C;  3OIQ A;  4ME5 A;  5LMU L;  3HOU H;  2SNM A;  4Q0F A;  1DON A;  3VYU A;  4WOR A;  1B4O A;  1Q82 C;  1IBL Q;  5T1G A;  2EYO A;  1KL9 A;  1L0X B;  4TQU S;  4CKC A;  4DAY A;  1UEA B;  1UE5 A;  3NSW A;  2DUD A;  1U4M A;  1FNU A;  5KYI A;  4XYQ A;  3BZD B;  5KNB A;  4A3E G;  3CAM A;  3OSO A;  5JJL A;  1VQI A;  1PFM A;  3DEP A;  2F03 A;  2EYP A;  1BUV T;  4PMC A;  1X3G A;  1KRS A;  1E1T A;  4EVO A;  4B08 A;  4M8A A;  1OTC A;  3GTQ H;  2SNS A;  1AZQ A;  1X3P A;  5C0X I;  2HD3 A;  2X6G A;  3GV3 A;  4R9W A;  5CV6 A;  5IYB G;  4PV1 C;  3EJI A;  4AYB G;  1IKM A;  1AE3 A;  1K3R A;  3V05 A;  4BY1 B;  5ELF A;  2F0F A;  3JC6 6;  4HJ8 A;  3K8A A;  1A15 A;  2NB0 A;  3K81 C;  4L5T A;  5ELB A;  1UE6 A;  1HZA A;  4AH6 A;  1MI2 A;  1VQ8 A;  4BXX G;  1KXL A;  1EYG A;  4LMQ D;  3J7Z C;  4H13 C;  4P2C B;  4YHH L;  3Q0A A;  4JI4 L;  3J7A F;  4YWK A;  5IY0 A;  1HR0 Q;  1S5F D;  3C3L A;  3UDF A;  1HR0 W;  2L4N A;  3S9W A;  3OIP A;  2E2H H;  1EU3 A;  3J7A 5;  1VQL A;  5GAH C;  1YNJ C;  3NTI A;  2WII B;  2N78 A;  2H1E A;  4A3G G;  1SMX A;  5L37 A;  2K5W A;  1CA5 A;  1JQY D;  1Y8O B;  1RL2 A;  1BBX C;  1WFQ A;  4DXF A;  2VUM G;  3KBX A;  3ZJY C;  4ABN A;  2Q2U A;  2R7F A;  2HCI A;  1C48 A;  5D14 A;  1VMC A;  1X56 A;  2UU9 L;  3GTP B;  3E0J A;  4XTC S;  3MXP A;  1TY0 A;  3UDX A;  2UXC Q;  5JEA J;  3QO2 A;  1PA6 A;  4PZ8 A;  2K1B A;  1JIC A;  4EQ5 A;  5M5X H;  3U9S A;  4N9P A;  5LL6 X;  3S15 H;  1JC7 A;  2B2T C;  1EQQ A;  4EQP A;  2KEE A;  2C5C A;  3ND8 A;  2BE5 C;  2HIX A;  1J6Q A;  1ENC A;  2PNH A;  3VYT A;  3MXU A;  2K6A A;  4ULL A;  2KHI A;  2JE6 I;  3GP7 A;  2OTJ A;  2JA5 H;  1VDZ A;  4L5S A;  4XQJ A;  1A2T A;  3C46 A;  3J81 j;  4GNX B;  2JN4 A;  3HOW H;  4A3F G;  4O2D A;  2Q2I A;  2XIW A;  4DGZ A;  5J22 A;  5C4J B;  2YU9 H;  3P1H A;  1HJP A;  1RCV D;  3GD7 A;  5G3L F;  3VYR A;  2ZJR A;  4DUZ L;  2CCZ A;  1ASZ A;  1SR3 A;  3IKJ A;  1SNC A;  1RF2 D;  2VUM B;  3CME A;  4I65 A;  2RQX A;  4KY7 A;  5C5L A;  2KUM A;  3CPW A;  2WFW A;  4JI2 Q;  2E74 C;  2L9H A;  5LMU Q;  4FNF A;  1FNV A;  1GUG A;  2EY1 A;  4IFD H;  1YI2 A;  2JA7 G;  3A55 A;  3BS1 A;  5DEH A;  1IL2 A;  3A0J A;  2F0G A;  3RD4 A;  3GTL B;  1IYJ B;  5C4X H;  1RHP A;  1I4X A;  2WAQ B;  4JOI C;  1GUW A;  1N33 Q;  3MEF A;  1VMP A;  1PXU A;  3KDF A;  2ZT9 C;  4NKL A;  2EXD A;  1TWA H;  3GTM H;  4NPS A;  5E3F A;  5FJ8 H;  1O7Y A;  4ZAI A;  1KAW A;  2K50 A;  2Q8I B;  4B3R L;  4RKB A;  3BYT B;  1RTO A;  2F0Q A;  1X3F A;  1ROD A;  5CV9 A;  4C1N I;  1X9N A;  1PTO C;  4R4C A;  3U9O A;  5C3X A;  2CH4 W;  2Q2T A;  4IN3 A;  1WD1 A;  5LL6 S;  1D1I A;  3IFT A;  1EL0 A;  2SEB D;  2QIL A;  4A3F B;  4K8J A;  1DCZ A;  3NP8 A;  3K6O A;  2VB2 X;  3CCR A;  3KFU A;  4YCU A;  1SNQ A;  1GHK A;  1IBM L;  1F2Z A;  3Q8D A;  3TP5 A;  1LAC A;  5I2X A;  2CW0 D;  2R93 G;  1A3T A;  2MGS A;  1YIT A;  1VQC A;  4JYA L;  1B9M A;  1PRT B;  3TME A;  1S5E D;  2F0D A;  5D3D A;  2MQH A;  1WD0 A;  4DAV A;  3S2D H;  1MHW C;  4DR4 L;  2JA7 B;  3QIA A;  3Q6S A;  4OEL B;  1AN8 A;  2ZXO A;  1G2T A;  4K5V A;  3J80 L;  3T56 B;  5CBE E;  5I6Y A;  1KNA A;  4GN5 A;  1TWC B;  1X32 A;  4CHT B;  1NNX A;  1VQ4 A;  1HA5 A;  4MTN A;  2KVM A;  4GS3 A;  3SHL A;  3I8Z A;  1E7Z A;  1S3O A;  4MZ9 A;  1PFN A;  4I7A A;  1J8I A;  1P16 A;  4F87 A;  4BS9 A;  2IPK D;  4OHJ A;  4WJ4 A;  2OQK A;  3E9I A;  2N55 A;  2WB1 B;  3J80 c;  5IGC A;  4RH6 A;  4ID6 A;  2QF7 A;  2R92 B;  3PUW A;  4XT3 B;  4HIK A;  2UU9 Q;  2PQE A;  2BH2 A;  3ERS X;  1TS3 A;  4DV1 Q;  1ESF A;  1SYB A;  1Z9F A;  2E2J H;  3MXN B;  1NJI C;  3S16 B;  2BA0 A;  4IPC A;  1EU4 A;  4JPB W;  5EQ0 A;  2QEX A;  3H3V H;  1QVG A;  5HGQ A;  2L11 A;  1A3V A;  4ZCK A;  1SFO H;  3PUV A;  1W6J A;  3NBH A;  3CRL C;  3A8K E;  5IP9 G;  4L5R C;  3CC4 A;  4TRD A;  3J80 E;  5M5W B;  1CFM A;  3MA2 B;  2B2V A;  3FHW A;  2QDB A;  3GDE A;  1JMC A;  1I6V C;  3NEM A;  3DMU A;  5EKL A;  1W2B A;  2EY2 A;  1QB5 D;  2DNE A;  2M00 A;  1KLU D;  4A3K G;  3RZO B;  3M3Y B;  3OTO L;  2ATW A;  2IHF A;  4DUZ Q;  1FR3 A;  1KQS A;  4DR2 Q;  4QB4 A;  4X62 L;  4RHS A;  2K03 A;  1ET6 A;  2KA7 A;  1SYD A;  4C3H G;  4K5X A;  3EBE A;  1SNO A;  1ML0 D;  2A6H C;  2IWH A;  4WRD A;  2YTV A;  4EQN A;  3MWY W;  1HZB A;  4X3K A;  1STN A;  4H7B A;  2M9V A;  1IKL A;  4IO9 A;  4BY1 H;  1U0L A;  1C7Y A;  2XN9 C;  2LXK A;  3OPO A;  2RSN A;  1V1Q A;  2K5N A;  4DAP A;  3E0E A;  3ERQ A;  4B3R Q;  1IHZ A;  1I4G A;  4JI6 L;  2NTS A;  4X66 L;  4XT1 B;  1K8A C;  1JB7 A;  2GVA A;  4F8M A;  3G7L A;  2B63 B;  1TXY A;  4OWW B;  1NMG A;  4ZUJ A;  1B44 D;  1KDB A;  3QG1 A;  5CC4 A;  2EJF C;  4OWX B;  4DV0 L;  2I07 B;  4A93 B;  4QQB X;  3PMF A;  1NMF A;  3NQT A;  2RDH A;  1S5B D;  5I4D A;  3NWS A;  5LHY 1;  3OWF A;  3HKZ E;  2MPM A;  2ZTE A;  3DWA A;  3UE0 A;  3NK9 A;  4GN4 B;  1F2M A;  3A8I E;  3EIV A;  1XNQ L;  1M8A A;  4WJW A;  2XRS D;  2IHE A;  4JI0 L;  2NUC A;  1QOH A;  2HHH L;  3DEO A;  4JYA Q;  2JXM B;  4DR7 L;  1C9O A;  3GTP H;  4KD3 A;  2CHB D;  1K0R A;  2O2L D;  1VQ5 A;  5IYB H;  1VQJ A;  4DR4 Q;  2KCT A;  4Q5V A;  2QA4 A;  1HH2 P;  3AYH B;  2NVQ B;  2E2I B;  4P72 A;  5FOB B;  3PQI A;  3D6W A;  5EPL A;  2YYZ A;  2F0L A;  4O1N A;  1YBY A;  4DV5 L;  3BDO A;  1Z47 A;  5EPJ A;  5DNF A;  3R93 A;  1G6P A;  4NXN L;  3VA5 A;  4BXX H;  1EZ6 A;  4CKE A;  2ID0 A;  5I9P A;  1NUC A;  1VQG A;  1LTG D;  2NYZ D;  1I6H B;  1WOC A;  3R3O A;  1TKW B;  1KNE A;  1Y8P B;  2AQ2 B;  3OMC A;  3RN2 A;  1E2V A;  4B3M L;  3ITP A;  4DUY L;  4V19 0;  3LGJ A;  1L1O A;  2F0P A;  4RFB A;  3CCV A;  4BWG B;  1ENA A;  2XNA C;  1U5K A;  2B2W A;  4O0A A;  1IXR A;  2A69 C;  4RKL A;  2M2L A;  4HAE A;  4JI3 L;  5C4J H;  4Z9C B;  5BN4 A;  1MJE A;  2ICI A;  3S1Q B;  1ASY A;  4LF5 L;  1XPO A;  2F0O A;  5C3E G;  1YJW A;  3L2P A;  1CKO A;  1II3 A;  2CVR A;  4X64 Q;  3HOY B;  2VUM H;  3ONA B;  1BVS A;  2MO1 A;  1Q1B A;  2LKV A;  4JVZ A;  1XPU A;  2R7Z B;  5KYL A;  2D0P A;  4IOC A;  3PO2 G;  5COY A;  1KIX A;  4HMI A;  5CR3 A;  2UXD L;  3GTL H;  1TS2 A;  3HEJ A;  4AIM A;  1PH6 A;  2A68 D;  1L2F A;  4C56 C;  2XWB B;  3SXH A;  3OTO Q;  1WTP A;  5HGT A;  1EOT A;  2F0T A;  1K73 C;  1FD7 D;  1MBY A;  3W5O A;  2RVL A;  3NXW A;  1U4R A;  5I9O A;  1WCM B;  4X62 Q;  2A73 B;  1DM0 B;  2EQS A;  1KAA A;  3L3O C;  2HT1 A;  1EFW A;  3SK4 A;  3HOX B;  3BZC A;  4A3F H;  4K6D A;  1STG A;  2B2U C;  5F2D A;  1PH3 A;  1Y14 B;  3LWU A;  2YTX A;  3AU7 A;  5COR A;  2F0I A;  1ET9 A;  4KN7 C;  1K83 B;  1BF4 A;  1EY7 A;  1FNW A;  5KRU A;  4POG A;  3P75 A;  4FYD A;  2CWA A;  3HG9 A;  5HUR A;  1N32 L;  3F1Z A;  1LM0 A;  2EPB A;  2K01 A;  3NQI A;  3KF6 A;  2AUJ D;  4LUV A;  4TSS A;  1PZI D;  4MHE A;  5E1F A;  3HRZ C;  1BBW A;  5D3I B;  1WVL A;  4JI6 Q;  3KF6 B;  4LUO A;  3PO2 B;  3T51 B;  3EVQ A;  2JA7 H;  3I3C A;  4DPG A;  2VL6 A;  2MNA A;  5C3W A;  5T1I A;  1V9P A;  1EIG A;  4A3J B;  4X65 L;  1CZW A;  1TWC H;  4DV0 Q;  3EQL C;  4LF6 L;  1PRT F;  2L0C A;  4JBW A;  1CQV A;  2EXZ A;  3GTO B;  4R4I A;  1OXX K;  5K5P A;  5JVH 3;  1PYB A;  1HNZ L;  1JT8 A;  1KHI A;  3M9B A;  4DV6 L;  2XRQ D;  4JV5 L;  2YTY A;  4RCO A;  4G7O C;  4QMG A;  1XNQ Q;  5CV7 A;  2EJM A;  3A56 A;  2Z8L A;  5IT9 c;  4JI0 Q;  4QIW B;  4HSV A;  2HHH Q;  2R92 H;  2FIN B;  1CSP A;  4DR7 Q;  2XVS A;  1Q7Y C;  1EEF D;  5M9O A;  3PCO B;  4PG3 A;  3KJO A;  1G91 A;  1PZK D;  4FXD A;  1QCB D;  3S16 H;  2NN6 I;  1SNP A;  4LF4 Q;  1K28 A;  3OHX C;  4A3I G;  4DV5 Q;  1O80 A;  1IYU A;  1TQO A;  2RHQ B;  1FVI A;  1G8Z D;  3WDN A;  5M3M G;  1UEB A;  4NXN Q;  1PFS A;  1YEZ A;  5M5W H;  3EN2 A;  3AEV A;  1NY4 A;  2F0U A;  3J7A V;  3HKS A;  5GAD C;  4B3M Q;  4XIG S;  2JEA I;  4K14 A;  3FP9 A;  2RCN A;  2O4X A;  1VCI A;  1L0Y B;  1VQ9 A;  2JA9 A;  3M3Y H;  3RZO H;  3A5Z B;  1Q8I A;  2LSS A;  4LF5 Q;  2F0S A;  4P74 A;  2E8G A;  4HR7 B;  4XQQ A;  1BOS A;  1CQF A;  1K8G A;  4X3S A;  1S4Z A;  2VXW A;  4LW1 A;  2KEN A;  3L7Z C;  3I90 A;  4DK3 C;  3VYS A;  4DK6 C;  3PGZ A;  5CGK A;  3UDI A;  1S5C D;  5TSS A;  1F9Q A;  4YWL A;  1EWI A;  1EYD A;  3GO5 A;  3TDQ A;  1UWV A;  2KJX A;  1TR5 A;  1HQM C;  5IIF A;  1PLF A;  2KCN A;  2UXD Q;  2N3S A;  1KLG D;  4TVA B;  4XYO A;  2PZT A;  4A3I B;  2E2D C;  3G71 A;  3T1H L;  4HJ9 A;  2F52 A;  1O78 A;  4FDB A;  4WJ3 M;  1TII D;  2EYH A;  1Y1W G;  4DV7 Q;  2D62 A;  5IP9 H;  4RWS C;  4NMZ A;  3ULJ A;  5DAU A;  3MZ5 A;  5JJI A;  4J1M A;  4K2K A;  2B63 H;  1K8O A;  2I5L X;  3D4W A;  1DJR D;  3FEW X;  3KF8 A;  3FKI G;  1PH4 A;  5G3L D;  2WP8 J;  5K36 G;  1UNS A;  2ALY B;  4A93 H;  5JJZ A;  1SE2 A;  1TS4 A;  1YHA A;  4DR6 L;  2EYF A;  1JR0 D;  3KF8 B;  2PNR C;  1G6Z A;  4UPA A;  4DF7 A;  3IRB A;  4RMF A;  1F2L A;  5IYC H;  4A3E B;  5GRO A;  2UXB L;  1SRU A;  3BZK A;  2F0H A;  5KIX A;  4HJA A;  2QKI C;  1HA6 A;  2CW0 C;  2FHT A;  3E9H A;  2CQO A;  2JA6 G;  3CC2 A;  1RIP A;  2NZH A;  2QCP X;  1EYC A;  3I4N G;  1W3S A;  3TN2 A;  5C0X H;  2B3G A;  1F9P A;  2PW5 A;  3LNN A;  2NVQ H;  2E2I H;  1N34 L;  1AE2 A;  2DY8 A;  2G9H D;  4HJ5 A;  2WAQ E;  4X65 Q;  2EIF A;  5FKA C;  1SDF A;  1EY8 A;  4CBV A;  4LF6 Q;  1XX8 A;  3RLO A;  4A3D G;  5KNC A;  3H94 A;  2EVB A;  4A3B G;  3PF5 A;  4AYB B;  1HNZ Q;  1RJT A;  3CD6 A;  4N9T A;  2FMM A;  4DV6 Q;  4JV5 Q;  2NVX B;  1I6H H;  2K5H A;  4JI8 L;  1ILQ A;  2F3W A;  1SMY D;  2AUK A;  4DV2 L;  1HUM A;  1VQH A;  2BDO A;  4GNX A;  1PYW D;  1D6E C;  4IUV A;  2DN8 A;  1XYI A;  2DY7 A;  1E0B A;  3S1Q H;  2I46 A;  3SK8 A;  2OCE A;  4DA2 A;  4PQX A;  3MTS A;  1EY5 A;  4OX9 L;  1JB3 A;  1CSQ A;  3A8J E;  3MVV A;  3HOY H;  1K8M A;  3KLR A;  5CV4 A;  2JK8 A;  2ICE C;  3HP3 A;  2JA6 B;  4A3G B;  5JPN C;  2ES2 A;  2R7Z H;  1OO9 B;  2D0O A;  2K5D A;  3I4N B;  1QJO A;  3GTK B;  1JJG A;  1S5D D;  2JQO A;  1I94 Q;  1TU2 B;  4RGM A;  1VQP A;  2N8N A;  4LNQ A;  2JP1 A;  3SGI A;  1J5E L;  1BKB A;  3OW2 A;  3CCS A;  1TT2 A;  3CPF A;  1MJC A;  3AFP A;  1EQT A;  4A3B B;  1XXG A;  4R1J A;  2Y0S G;  2PMZ B;  1K3B C;  1HFN A;  2KCM A;  3SR1 A;  2BA1 A;  3KLS X;  5JVG 3;  1MSH A;  1WCM H;  3HGB A;  1U9R A;  2WB1 E;  4YCV A;  1EEI D;  1SE8 A;  3I73 A;  2IY5 B;  2UUC L;  3K7U C;  3HOX H;  1BNZ A;  2KOL A;  2PW7 A;  1LT5 D;  3MFG A;  1H9S B;  3ZYY X;  1E2W A;  4HSP A;  1X54 A;  1Q12 A;  2R7D A;  5FLM H;  2A19 A;  3CF5 A;  1K83 H;  4CDF C;  3DUZ A;  1WTO A;  1U4L A;  2VY3 A;  3KJP A;  2WAC A;  1I50 B;  5BR8 L;  1I4Q A;  2R3Z A;  1Y1V G;  5C44 G;  4LF9 L;  1D2B A;  3TZD A;  3S1R B;  2UUB L;  2KCC A;  1N8R C;  3AB9 A;  3GTJ B;  4YWM A;  2BDN A;  3PIO A;  3PO2 H;  3FDT A;  2G9D A;  4I7Z C;  1LTI D;  2A8V A;  4BY7 G;  1WTX A;  4K0K L;  1B8A A;  4A3J H;  3S2H B;  1VQK A;  3P20 A;  1F77 A;  1FL0 A;  5CV5 A;  4JI4 Q;  2A5H A;  1BCP B;  4YHH Q;  4DNT B;  3DWQ A;  4DR6 Q;  3GTO H;  2Y0S B;  3BVM A;  4U67 3;  2F0N A;  1A63 A;  1X55 A;  4QCL A;  2NVY B;  3OMG A;  2UXB Q;  1LV9 A;  1T5X D;  4HIO A;  1YNX A;  2Z6B A;  5CMD A;  5JEA H;  5J1Z A;  4RAU C;  4R4O A;  1IL8 A;  4IOA A;  1DGS A;  2AWO A;  5H1S E;  2MP1 A;  3NEN A;  4KLK A;  5JOB A;  2EZV A;  1JWU D;  5J3B A;  4NXM L;  1H9M A;  1ONL A;  5IGB A;  3G48 A;  2Z4H A;  1N34 Q;  1YHB A;  1NBW A;  3MXN A;  1LO5 D;  1BO0 A;  5CYU A;  1PVO A;  3HOU G;  1R4Q B;  3FMC A;  4MN3 A;  2NN6 G;  3VR4 A;  2EOT A;  1JCK B;  4DR1 L;  4C3I G;  1QZH A;  3N52 A;  1Y1V B;  2K7V A;  1CM9 A;  2WKD A;  4HN7 A;  4CDD C;  3ER0 A;  1STE A;  2KBN A;  5KGU A;  2N88 A;  1EZ8 A;  3P7J A;  2R93 B;  4DV4 L;  3S14 B;  3BVG A;  1B50 A;  2N49 A;  3S1N B;  2B8F A;  4UP8 A;  3I4M G;  5AJ3 L;  1AFP A;  2ZXP A;  5ELO A;  4DV2 Q;  1F9S A;  1CTM A;  3M7G A;  2AQ3 B;  3E5S A;  1K0S A;  3GTG B;  1JWS D;  4JI7 L;  1EWC A;  5FLX L;  4UDU C;  2K5V A;  1VQA A;  3BU2 A;  4IJH A;  3T53 B;  4XDX A;  4OX9 Q;  4OO1 I;  3MEH A;  4GOP A;  1SN8 A;  3H91 A;  3ICE A;  2B2Y A;  5ISR A;  1VQ6 A;  3RLF A;  1EY0 A;  1E22 A;  1LLR D;  3PO3 G;  1IW7 D;  4GKJ L;  2F0M A;  2EYL A;  4KJO A;  3SVM A;  2L5T A;  2RF4 A;  4GOP B;  4CGY B;  4B3S L;  5FLX c;  1B7Y B;  3SE0 A;  3H15 A;  2K04 A;  2CFM A;  5EPK A;  5AFW A;  1B53 A;  1J5E Q;  1FYC A;  1CZG A;  1AH9 A;  1E2Z A;  4FO2 A;  4A3I H;  3HOZ G;  4C3I B;  1X6O A;  4DK0 A;  4IUN A;  4TKO B;  3I7F A;  2EYM A;  3X3M A;  2A68 C;  3M85 A;  4A3L G;  4KTA A;  5DM7 3;  3I4M B;  3U4Z A;  2J4X A;  4P73 A;  3K7A B;  2UUA L;  1H95 A;  3K5N A;  2UUC Q;  2D2C C;  3GQB A;  1PH9 A;  1HCZ A;  4ZQ3 A;  3BDL A;  1XMQ L;  3MAQ A;  3D4R A;  3U58 A;  3VR2 A;  4OEM B;  3U50 C;  1EIY B;  2DJG C;  4G7H C;  1HUN A;  4A3E H;  4A3K B;  1GUT A;  2P5Z X;  3SK5 A;  1NTG A;  3PO3 B;  1NR4 A;  1IBM Q;  4DV3 L;  4V0B A;  5EKI A;  2UUB Q;  1G2S A;  3N6R A;  1JOQ A;  2RDG A;  5KEE A;  3Q22 A;  1KDA A;  3BJU A;  4S3S A;  3URY A;  3M4O B;  4C3H B;  4F88 A;  5ELD A;  3M4P A;  3NHH A;  2EYJ A;  3CC7 A;  4J6H A;  4LWC A;  1JOR A;  3RLN A;  1Y1W H;  2MFI A;  2B2V C;  2BH8 A;  3S17 B;  1WTV A;  1QNU A;  2NVX H;  3HOW G;  4NP5 A;  1Q86 C;  1SJH D;  1MD2 D;  4IJL A;  1SYF A;  4KHV A;  2KHJ A;  4B9W A;  1TWF B;  2IX0 A;  1S72 A;  1JJ2 A;  4FXK C;  3CU7 A;  1A2U A;  3HKZ G;  5K36 H;  1HTP A;  1EY9 A;  4G7Z C; 
#chains in the Genus database with same CATH homology
 4LFB L;  4LF4 Q;  4JI8 Q;  1HNW Q;  2VQF L;  5IYD G;  4NB3 A;  3J80 i;  3HOV G;  3S15 H;  3DLL A;  2XGT A;  3I2Z A;  1EQQ A;  4B3T L;  4A3I G;  4DV5 Q;  4IPH A;  1GD7 A;  1UE1 A;  2RHQ B;  5DLQ E;  1FVI A;  1M1K C;  4GLV B;  5M3M G;  2ZTC A;  4IFD G;  1UEB A;  2OTJ A;  4NXN Q;  2C35 B;  3CCJ A;  2HIX A;  1PFS A;  1YEZ A;  3TS0 A;  1J6Q A;  4H02 A;  2PNH A;  2JA6 H;  5M5W H;  4A3G H;  2PQA B;  1S40 A;  2KHI A;  3EN2 A;  2JE6 I;  1CKM A;  1NY4 A;  4DV4 Q;  3UDG A;  1QZG A;  1G29 1;  3HKS A;  5GAD C;  2JA5 H;  4L5S A;  3I4N H;  3CXC A;  2CWP A;  4B3M Q;  4ALP A;  2E5L L;  3J81 j;  3D0F A;  3GTK H;  4GNX B;  4XIG S;  4X64 L;  2JEA I;  3HOW H;  5AJ3 Q;  4A3F G;  4O2D A;  3WWV A;  3FP9 A;  2RCN A;  2Q2I A;  4IPD A;  4JBJ A;  1E1O A;  1VCI A;  2YU9 H;  1HJP A;  3GD7 A;  4JI1 L;  2JA9 A;  1VQ9 A;  3M3Y H;  3RZO H;  3D31 A;  1I5F A;  3A5Z B;  2V1C C;  4JC0 A;  2LSS A;  2ZJR A;  4DUZ L;  4JI7 Q;  2CCZ A;  3K0X A;  4LUZ A;  1HNX L;  1ASZ A;  4LF5 Q;  4P74 A;  4A3B H;  1SR3 A;  1YZ6 A;  2E8G A;  1A8V A;  3G4S A;  2B63 G;  4IPG A;  3NBH B;  1V43 A;  3CME A;  4BBS G;  3CMA A;  1VQ7 A;  1K8G A;  3CPW A;  2WFW A;  2B29 A;  2KEN A;  3L7Z C;  4LW1 A;  4JI2 Q;  5LMU Q;  2JJQ A;  4DK3 C;  4QIW E;  3DM3 A;  4A93 G;  4DK6 C;  3PGZ A;  4EX5 A;  5M3F H;  1PH8 A;  3UDI A;  3CCQ A;  5M3M H;  3L0O A;  4YWL A;  1MIU A;  1EWI A;  4A4I A;  4GKJ Q;  1YI2 A;  2JA7 G;  4A3M G;  3GO5 A;  4JI5 L;  5LMN L;  1UWV A;  1KRT A;  1IL2 A;  3A0J A;  2MO0 A;  1VS0 A;  4A75 A;  2AMC B;  4B3S Q;  1IYJ B;  5IYC G;  5C4X H;  5EAY A;  1G51 A;  2ZTD A;  4JOI C;  2UXD Q;  2N3S A;  4TVA B;  4DNI A;  2OWO A;  1N33 Q;  3MEF A;  3KDF A;  1PYS B;  4BBR G;  2EXD A;  3G71 A;  3T1H L;  1TWA H;  3I55 A;  3GTM H;  2Q2H A;  4NPS A;  4QJF A;  5FJ8 H;  2F52 A;  4HJ9 A;  4FDB A;  1JE5 A;  2AKW B;  1I50 H;  1KAW A;  2K50 A;  4R4T A;  1YHQ A;  4B3R L;  4WJ3 M;  3J81 i;  4OXP A;  3J81 c;  4DV7 Q;  1Y1W G;  2D62 A;  5IP9 H;  1VQM A;  4ME3 A;  1X3F A;  5C0X G;  3ULJ A;  1X9N A;  3I56 A;  3S1R H;  3JAM i;  3JAM c;  4R4C A;  3PV0 A;  1LTL A;  4GLA C;  3GTJ H;  5JJI A;  2Q2T A;  2ZJQ A;  2B63 H;  2I5M X;  2I5L X;  2ZM6 L;  1VQ5 A;  4YCW A;  2UUA Q;  4UP9 A;  3K80 C;  4GLX A;  3KFU A;  3CCR A;  5BR8 Q;  4YCU A;  3FKI G;  1PH4 A;  3H0G G;  2AWN A;  1VQO A;  2WP8 J;  4LF9 Q;  5K36 G;  2ALY B;  4A93 H;  3S2H H;  1IBM L;  1M90 C;  4P71 A;  4OON A;  4X66 Q;  3CQZ H;  1YHA A;  1MKH A;  4DR6 L;  3Q8D A;  1BBU A;  2R93 G;  3KF8 B;  4JCV E;  1XMQ Q;  3ULP A;  1WYD A;  4UPA A;  4HID A;  1HZ9 A;  2R6G A;  3IRB A;  2I0Q A;  4GN3 B;  1YIT A;  1VQC A;  2JA8 H;  4UP7 A;  4RMF A;  5IYC H;  4GKK Q;  2UXB L;  5GRO A;  1SRU A;  2NVY H;  3BZK A;  3CP0 A;  3T1Y Q;  3PUX A;  1L1O C;  4K0K Q;  4HJA A;  4JYA L;  4DR3 L;  3E9H A;  2F3I A;  3PSI A;  2CQO A;  1PH2 A;  4YY3 L;  2JA6 G;  2MQH A;  4DV3 Q;  4LFA L;  5IP7 H;  3CC2 A;  3S2D H;  3PIP A;  4DR4 L;  4UY8 C;  1RIP A;  2NZH A;  2JA5 G;  1FJG Q;  3I4N G;  1W3S A;  2B3G A;  2NVQ H;  2E2I H;  1N34 L;  4R4Q A;  1AE2 A;  3S24 A;  4GN5 A;  3TEH B;  1QUQ A;  1VQ4 A;  4QY7 A;  4HJ5 A;  3HOY G;  2IX1 A;  2VS1 A;  2WAQ E;  4QL5 A;  4X65 Q;  2EIF A;  4MTN A;  3W1G A;  4GOP C;  3CCM A;  4LF6 Q;  4GS3 A;  3RLO A;  4A3D G;  3FKI H;  2R7Z G;  1EIF A;  1E7Z A;  1S3O A;  4MZ9 A;  1YIJ A;  1PH1 A;  4A3B G;  4AQY L;  4LF7 L;  3PF5 A;  1P16 A;  3AEV A;  1QUQ B;  1Y1V H;  1HNZ Q;  3CD6 A;  4NXM Q;  1VQB A;  4DV6 Q;  3PUZ A;  4JV5 Q;  4WJ4 A;  2OQK A;  3E9I A;  1GO3 E;  1SRO A;  2R93 H;  1I6H H;  2K5H A;  3S14 H;  4LF4 L;  4JI8 L;  3J80 c;  4A3C H;  1WI5 A;  1D8L A;  2Z6K A;  4P75 A;  3PUW A;  2PQA A;  3RR5 A;  3S1N H;  4DV2 L;  4HIK A;  5M3F G;  2UU9 Q;  1VQH A;  2QGQ A;  1YVC A;  4DR1 Q;  3CW2 C;  2BH2 A;  3ERS X;  4X6A H;  4DV1 Q;  4GNX A;  4LFC L;  2K4K A;  1Z9F A;  2E2J H;  2VZA A;  3MXN B;  5M5Y H;  1NJI C;  2BA0 A;  1KD1 C;  5HY6 A;  4IPC A;  2Z0S A;  4L5Q A;  3A5U A;  5C4X G;  3GTG H;  3S1Q H;  1IZ6 A;  2QEX A;  3H3V H;  1TWH H;  1XMO L;  4LFB Q;  1QVG A;  2OCE A;  4DUY Q;  5HGQ A;  1WCM G;  2VQF Q;  1XNR L;  4KHP L;  1TWG H;  4OX9 L;  1HZC A;  1CSQ A;  4B3T Q;  5FJ8 G;  3CCL A;  1SFO H;  3HOX G;  3PUV A;  3HOY H;  3AFQ A;  4RG1 A;  2JK8 A;  5IP9 G;  1IBL L;  1XJV A;  4L5R C;  4JI3 Q;  3CC4 A;  4A3D H;  2ES2 A;  1A0I A;  2R7Z H;  5IWA L;  2D0O A;  3FHW A;  1L1O B;  5FLM G;  4OO1 G;  1N36 L;  3GDE A;  1JMC A;  3NEM A;  1X65 A;  4BY1 G;  3UE1 A;  2JQO A;  1I94 Q;  1UE7 A;  1JJG A;  2E5L Q;  1E3P A;  1VQE A;  1VQP A;  4LF8 L;  2N8N A;  4J15 A;  4LNQ A;  1W2B A;  3SGI A;  3F2D A;  1J5E L;  4A3K G;  1K9M C;  1BKB A;  2GN5 A;  1QVC A;  3OW2 A;  3CCS A;  3OTO L;  2NZO A;  5JJK A;  3CPF A;  4JI1 Q;  1MJC A;  3AFP A;  4C3I H;  2IHF A;  2ATW A;  3PF4 A;  4Y52 H;  1T9H A;  4R1J A;  2Y0S G;  4DUZ Q;  3M7N A;  1HNX Q;  2K52 A;  2KCM A;  4AYB E;  1KQS A;  2JA8 G;  3U4V A;  4DR2 Q;  3S1M H;  4X62 L;  2BA1 A;  4DR4 Q;  2K75 A;  2LXJ A;  1CKN A;  2VQE L;  1WCM H;  2WB1 E;  1N33 L;  4JG2 A;  1VQF A;  4YCV A;  3I4M H;  4A3J G;  2F4V L;  1VQD A;  3K7A H;  1SE8 A;  4DAY B;  2IY5 B;  3EBE A;  3K7U C;  3HOX H;  5IP7 G;  2UUC L;  3VDY A;  2YTV A;  1OXU A;  1CKN B;  2OTL A;  4DV7 L;  4JI5 Q;  1X54 A;  4KHZ A;  5LMN Q;  1Q12 A;  4JBK A;  4POF A;  1HZB A;  2R7D A;  4IFD J;  5FLM H;  2A19 A;  3CF5 A;  5LMN W;  2PI2 A;  1K83 H;  1XPR A;  4IO9 A;  4BY1 H;  3ULL A;  1U0L A;  2VY3 A;  5JEA G;  2VNU D;  3KJP A;  1C7Y A;  2LXK A;  2OQ0 A;  4PZ6 A;  1V1Q A;  5BR8 L;  2K5N A;  2DGY A;  3E0E A;  4BA2 I;  1EUJ A;  4C2M H;  2A1A A;  4MNO A;  1Y1V G;  5C44 G;  4A3K H;  4LF9 L;  4B3R Q;  2UUB L;  4JI6 L;  4X66 L;  1OXV A;  3PO3 H;  2YV5 A;  1N8R C;  1Q81 C;  4YWM A;  1K8A C;  2AHO B;  1JB7 A;  4A3C G;  2GVA A;  1LUZ A;  3PIO A;  1HR0 L;  3PO2 H;  1TXY A;  1EOV A;  2RHS B;  1YJN A;  2ZJP A;  4OWW B;  1NMG A;  1N32 Q;  2A8V A;  4BY7 G;  1OXT A;  1X3E A;  2ZM6 Q;  3AQQ A;  3RZD H;  2Z6K C;  4OWX B;  4DV0 L;  4K0K L;  3M4O H;  1B8A A;  4C3H H;  4A3J H;  4QQB X;  1VQK A;  2XTI A;  1NMF A;  1FL0 A;  1E24 A;  4JI4 Q;  4YHH Q;  5GAE C;  2H5X A;  3HOZ H;  4DR6 Q;  3GTO H;  1PH5 A;  3HKZ E;  2ZTE A;  3NEL A;  3UE0 A;  1GKH A;  3TQY A;  1GM5 A;  1I3Q H;  4GN4 B;  4APV A;  2PMZ E;  3G6E A;  3RN5 A;  3EIV A;  4DR5 L;  1XNQ L;  4JOI A;  1A63 A;  1X55 A;  1NE3 A;  3S17 H;  2HQL A;  4JBM A;  1Q1E A;  2IHE A;  2NVT H;  4JI0 L;  4A3L H;  2UXB Q;  1GVP A;  3OYY A;  2HHH L;  4HIO A;  2FXQ A;  1YNX A;  4JYA Q;  4DR3 Q;  4DR7 L;  1C9O A;  4R4O A;  4A76 A;  2UXC L;  3GTP H;  1IBK L;  4YY3 Q;  4HIM A;  1K0R A;  1DGS A;  1OXS C;  4C3J H;  2AWO A;  4LFA Q;  5H1S E;  1VQJ A;  1Q46 A;  3NEN A;  4KLK A;  3TRE A;  2KCT A;  5IYB H;  5C44 H;  1TWF H;  3F2B A;  2QA4 A;  1HH2 P;  3AYH B;  5J3B A;  4NXM L;  3PUY A;  4P72 A;  3G48 A;  1LYL A;  1N9W A;  1O7I A;  1N34 Q;  1HNW L;  1YHB A;  1NBW A;  5E7N A;  5ELN A;  5C0X J;  1CUK A;  1PVO A;  2YYZ A;  3RNU A;  3HOU G;  4BY7 H;  1YBY A;  3KOJ A;  4DV5 L;  3KLW A;  1KC8 C;  1Z47 A;  2NN6 G;  3STB D;  1G6P A;  4DR1 L;  1QZH A;  4NXN L;  1PV4 A;  3I4O A;  4DV1 L;  4BXX H;  2PI2 E;  4AQY Q;  1P8L A;  2ID0 A;  2KBN A;  1JJC B;  3ER0 A;  4PMW A;  4LF7 Q;  1VQG A;  4DV4 L;  1PH7 A;  2IT1 A;  1WOC A;  4IFD I;  3STB C;  3RN2 A;  2N49 A;  4B3M L;  1WJJ A;  4DKA C;  3M4Q A;  4DUY L;  4UP8 A;  3I4M G;  2WAQ G;  2VW9 A;  3LGJ A;  1L1O A;  5AJ3 L;  5ELO A;  3CCV A;  4Y7N H;  2CKZ B;  4DV2 Q;  3S16 H;  1U5K A;  4O0A A;  2HIV A;  4OWT B;  1IXR A;  2I5H A;  1B70 B;  1EQR A;  4JI3 L;  5C4J H;  1MJE A;  4LFC Q;  4IOA A;  3TRZ A;  3W1B A;  4JI7 L;  1FGU A;  5GQO A;  1ASY A;  1XPO A;  4LF5 L;  5C3E G;  2K5V A;  1YJW A;  2Y0S E;  1VQA A;  3L2P A;  1XMO Q;  1CKO A;  1XNR Q;  1XTD A;  3BU2 A;  4IJH A;  1I94 L;  1QVF A;  4OX9 Q;  4KHP Q;  4X64 Q;  2JEB I;  2VUM H;  1BVS A;  2MO1 A;  1Q1B A;  4OO1 I;  4JI2 L;  4GOP A;  5LMU L;  3HOU H;  1SN8 A;  3KYH C;  3ICE A;  1VQ6 A;  3B6Y A;  3RLF A;  1XPU A;  1E22 A;  1Q82 C;  1IBL Q;  3PO3 G;  2D0P A;  4GKJ L;  1KL9 A;  5IWA Q;  4IOC A;  4TQU S;  3PO2 G;  2RF4 A;  1UE5 A;  4GOP B;  1N36 Q;  4B3S L;  5FLX c;  1B7Y B;  2DUD A;  4DR2 L;  3H15 A;  1KIX A;  3CCU A;  4LF8 Q;  2UXD L;  3GTL H;  2CFM A;  4A3E G;  3CAM A;  5JJL A;  1C0A A;  5IYD H;  1VQI A;  1L0W A;  3HOV H;  2K14 A;  1J5E Q;  1SLJ A;  4AIM A;  1PH6 A;  1AH9 A;  1L2F A;  1A62 A;  4A3I H;  3HOZ G;  3OTO Q;  1X6O A;  2ASB A;  1X3G A;  1KRS A;  1E1T A;  4PZ7 A;  3I7F A;  1K73 C;  1Q8K A;  3HFZ B;  3W5O A;  3M85 A;  4A3L G;  5C3E H;  4X62 Q;  1OTC A;  2VQE Q;  2EQS A;  3GTQ H;  3F8T A;  4P73 A;  3U4Z A;  2HT1 A;  5C0X I;  2UUA L;  1H95 A;  1EFW A;  3T1H Q;  2F4V Q;  3BZC A;  4A3F H;  4QGU A;  2UUC Q;  5IYB G;  1PH9 A;  1PH3 A;  1Y14 B;  2YTX A;  4AYB G;  1AE3 A;  1K3R A;  3KDF B;  1XMQ L;  4POG A;  3U58 A;  3U50 C;  3JC6 6;  2CWA A;  2WB1 G;  4GKK L;  1N32 L;  3F1Z A;  4HJ8 A;  1LM0 A;  3K8A A;  1EIY B;  1PHJ A;  2R92 G;  3K81 C;  3KF6 A;  3T1Y L;  4BBS H;  4L5T A;  1UE6 A;  1HZA A;  4LUV A;  4AH6 A;  4A3E H;  1VQ8 A;  5GAG C;  5IE8 A;  4BXX G;  1KXL A;  1EYG A;  1NTG A;  2GVB A;  3J7Z C;  3A74 A;  2L15 A;  4DV3 L;  1IBM Q;  1BBW A;  4GNX C;  4YHH L;  4HJ7 A;  4JI4 L;  2UUB Q;  4YWK A;  4JI6 Q;  5IY0 A;  3KF6 B;  4LUO A;  1FJG L;  2JA7 H;  1R9T H;  4A3M H;  1HR0 Q;  1D7Q A;  4DPG A;  2VL6 A;  3BJU A;  3UDF A;  2MNA A;  1HR0 W;  2E2H H;  1V9P A;  3H3V I;  4X65 L;  3J7A 5;  1TWC H;  4DV0 Q;  1VQL A;  5GAH C;  4LF6 L;  3CCE A;  4BBR H;  3F2C A;  4JBW A;  1YJ9 A;  2N78 A;  3M4P A;  4R4I A;  1SMX A;  3CC7 A;  4A3G G;  1OXX K;  4LWC A;  3RLN A;  1HNZ L;  1PYB A;  1Y1W H;  2MFI A;  1KHI A;  3M9B A;  4DV6 L;  4JV5 L;  1JT8 A;  2BH8 A;  2YTY A;  1RL2 A;  1WFQ A;  4DR5 Q;  1XNQ Q;  2NVX H;  2VUM G;  3HOW G;  3ZJY C;  1Q86 C;  2Q2U A;  2R7F A;  1VQN A;  4JI0 Q;  5IT9 c;  1X56 A;  4IJL A;  2UU9 L;  2HHH Q;  3TS2 A;  2R92 H;  4BA1 I;  4XTC S;  1CSP A;  4DR7 Q;  2KHJ A;  1Q7Y C;  3UDX A;  2UXC Q;  1IBK Q;  3PCO B;  2IX0 A;  3H0G H;  5JEA J;  1S72 A;  1JJ2 A;  4PG3 A;  1PA6 A;  3HKZ G;  4PZ8 A;  3KJO A;  4KI0 A;  4DAM A;  4EQ5 A;  2NN6 I;  5M5X H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...