1Y1WK

Complete rna polymerase ii elongation complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
114
Chain Sequence
b'MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(P*AP*GP*TP*AP*CP*TP*TP*AP*CP*GP*CP*CP*TP*GP*GP*TP*CP*AP
publication title Complete RNA Polymerase II Elongation Complex Structure and Its Interactions with NTP and TFIIS
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
total genus 28
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2004-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1y1wK00
4LLGA 1TWHC 3GTPC 3CQZC 5C3EK 2WB1L 3FKIC 4C3JK 2B63K 1TWGC 3S1NK 3M4OK 4BXXC 4X6AK 4Q5SA 2E2JC 2A68A 4MQ9A 3GTKK 3S1RC 2E2HK 2E2IC 1TWAK 3GTOK 3S15C 5C4XC 2YU9K 5IYBK 4XSZA 4C3HK 4BY7C 5M3MK 2PPBA 3HOUK 4A3LC 4LJZA 3S1QC 1I6HC 3HOVC 4A3EK 3GTQK 5IP9C 2O5IA 2R7ZC 3I4NC 4A3BK 4A93C 1I50C 1Y1VK 4YFKA 2PA8L 5IP7C 5TMCA 2JA7K 4XLPA 2JA8C 3GTLC 3S14K 3S1MC 3S2DC 2JA5C 3HOZK 2Y0SD 4XSXA 4YG2A 2NVTC 4A3GK 4A3IK 5IYDC 2WAQD 4XLNA 4A3KK 3I4MC 3HOWK 4QIWL 4C2MK 1R9TC 5C4JK 4AYBD 4QJVB 5M5WK 1HQMA 4A3JC 3S17K 4GZYA 2R93C 2NVYC 4A3CK 4A3MK 1K83K 2CW0A 4A3DC 4C3IK 2NVQC 5IYCK 4MEYA 4OINA 1WCMK 2O5JA 1TWCC 2PMZD 4BBRK 1SFOC 3RZOK 2NVXC 4BY1C 5M3FK 3RZDC 3K7AC 3H0GK 4LK1A 1YNJA 5C44K 3DXJA 5D4DA 4KN4A 5FLMK 4Y7NK 1TWHK 2R92C 4MEXA 3M3YK 1TWGK 5C3EC 2B63C 1I3QK 3GTGC 3S1NC 4BBSK 4X6AC 4NOIA 3M4OC 4KMUA 4A3FK 1YNNA 3H3VD 4OIRA 3GTKC 2E2IK 3S15K 5C4XK 2E2HC 3S2HK 3GTOC 2YU9C 3EQLA 5IYBC 4G7HA 4A3LK 1Y1WK 4G7OA 4YFNA 1TWFK 5IP9K 3WODA 4ZH4A 3HOXK 2VUMK 3GTQC 4A3BC 3PO3K 1Y1VC 3GTJC 2JA7C 4OIQA 2A6HA 3HKZD 3S14C 4Y52K 3HOYK 1ZYRA 3PO2C 4A3GC 4A3IC 4A3KC 2Y0SL 3HOWC 5M5YK 1R9TK 3GTMK 4G7ZA 2WAQL 2WB1D 2JA6C 2R93K 5TMFA 3GTPK 3S17C 3CQZK 3FKIK 2NVQK 4AYBL 4A3MC 2BE5A 1K83C 4BXXK 4A3CC 1IW7A 2E2JK 5IYCC 1SFOK 1WCMC 4BBRC 3RZOC 3S1RK 3H0GC 5FLMC 1TWAC 2PMZL 4Y7NC 4BY7K 3S1QK 2A6EA 3HOUC 4LK0A 2PA8D 3HOVK 3GTGK 3M3YC 1I6HK 3I4NK 2R7ZK 4A93K 1I3QC 4A3EC 4BBSC 1I50K 5IP7K 2JA8K 4A3FC 3S2DK 3GTLK 3S1MK 2JA5K 4QIWD 4Q4ZA 2NVTK 1I6VA 3H3VL 3HOZC 5IYDK 3S2HC 3I4MK 5M5XK 4OIOA 1BDFA 4QJVA 1Y1WC 1TWFC 3HOXC 4YFXA 4A3JK 5C4JC 2VUMC 4JK1A 5FJ8K 3GTJK 2NVYK 4OIPA 3S16K 3PO3C 4A3DK 4Y52C 3HOYC 1TWCK 3HKZL 2A69A 2NVXK 4BY1K 3PO2K 3RZDK 3K7AK 1XPPA 4KN7A 1SMYA 3S16C 3GTMC 5C44C 2JA6K 2R92K
chains in the Genus database with same CATH superfamily
2JA5A 5C3EK 3VA7A 3FKIC 4C3JK 4BXXC 2FQTA 4Q5SA 2A68A 1JOEA 3S1RC 3S15C 1TWAK 2R93A 1VGXA 4XSZA 4LJZA 5IP9C 1I50C 5TMCA 3T02A 1DD5A 3GTLC 4G0UA 1XXAA 2EBBA 2R92A 2WAQD 4QIWL 1R9TC 3G4CA 5C4JK 1I50A 1J98A 3GTKA 4A3CK 2XCQA 1WIHA 4A3DC 4OINA 1WCMK 4KDDA 2PMZD 1SFOC 5M3FK 3PO2C 3GTQA 3BP3A 4Y7NK 3DXJA 4KN4A 4P5AA 2PHCB 3FOEA 1O27A 3GTGC 4X6AC 3ERED 4A3FK 1KQ4A 1WOSA 1XZQB 4GFQA 4KMHA 1B4AA 3EQLA 5IYBC 1K83A 3TFHA 1XZPA 1O2FB 1ZXOA 5IOSA 2VUMK 1PJ6A 4KM9A 1Y1VC 2GSNA 3HOYK 1ZYRA 3A8KA 3T00A 2Y0SL 3HOWC 3V4GA 3GTMK 1I3QA 4G7ZA 2WB1D 1RU0A 3LPXA 2R93K 3S17C 3FKIK 1ZQ1C 2NVQK 3AQPA 2BE5A 4BXXK 1VH2A 4P5BA 4BLAA 3S1RK 3AH5A 3H0GC 5FLMC 1TWAC 1JQWA 2A6EA 1J6XA 4BBSC 1I50K 3GTLK 5IORA 3LAJA 3H3VL 2GAGC 3GTPA 1BDFA 1TWGA 1WOPA 4GTBA 3Q3QA 5C4JC 4JK1A 5FJ8K 1ZVUA 3NUHA 3PO3C 1BJTA 4A3DK 2E2IA 2KWAA 3PO2K 4KN7A 3N0CA 3OEPA 1F93A 2W7VA 1VRQC 1WORA 1WSRA 3CQZC 4X6AK 4WJ3M 1L0WA 4KARA 4KB4A 4MQ9A 5IYBK 2NVYA 4BY7C 2D6FC 3N3YA 3HOVC 2O5IA 4A93C 1Y1VK 5CHPA 5IP7C 4XLPA 1O26A 2V6UA 2JA5C 3N0BA 3HOWK 4LOWA 1HQMA 1F7UA 3S17K 2R93C 2E2HA 2NVQC 3GTOA 1IE0A 4MEYA 3AQOA 2FQOA 4BY1C 3H0GK 4LK1A 1YNJA 5FLMK 5CJ9A 3GTJA 2JA7A 2R92C 1TWGK 2B63C 3S1NC 4BBSK 1WQGA 3M4OC 4DDQA 2RH6A 4ILDA 3GEEA 3GTKC 2E2IK 3TFIA 5IOQA 2YU9C 4A3LK 1IBAA 4C3HC 2B63A 2GSUA 4ZH4A 3GTQC 1INNA 3T01A 4A3BC 3QX3A 3PO3K 2A6HA 1X31C 2YU9A 4P9SA 5E68A 4A3IC 4A3KC 5HL8A 4G0VA 4G0WA 4C2MC 5TMFA 3CQZK 2RGRA 4AYBL 1AB4A 4LR2A 1K83C 3GSIA 1IW7A 5IYCC 2CFAA 1Y1WA 4BBRC 3RZOC 1UV7A 1TWFA 4KASA 4BY7K 3HOVK 4LK0A 3M3YC 4LQYA 1WQHA 4A93K 1I3QC 5IP7K 4KMAA 2JA5K 4QIWD 1I6VA 1TWHA 4QJVA 3A8IA 2ZUEA 3GTJK 4O2DA 1PJ5A 1YX2A 4Y52C 3HKZL 3GDZA 4BY1K 2ZUFA 1DCOA 1SMYA 3ADAC 2R92K 4LLGA 3GIRA 3GTPC 4KAWX 2B63K 3S1NK 1TWGC 3M4OK 5L46A 4GTLA 4KMDA 3SZZA 1EH1A 3GTKK 1EQRA 2E2IC 1YCLA 2YU9K 1C0AA 4C3HK 1EFWA 2PPBA 3HOUK 4A3LC 3S1QC 4GT9A 4FZBA 3GTQK 1F7VA 4A3BK 1TWCA 2PA8L 1VJEA 1XZPB 2JA8C 2NVXA 3S1MC 2Y0SD 4XSXA 4YG2A 4A3IK 5IYDC 4KM8A 4A3KK 3HXAA 4C2MK 1VLOA 4QJVB 5M5WK 4A3JC 4GZYA 3GEIA 2NVYC 2XCOA 1K83K 2CW0A 3AD7C 4PAAA 5IYCK 2O5JA 4GTCA 4BBRK 3RZOK 3S16K 3K7AC 1TWHK 4FM9A 3M3YK 3TTGA 1I3QK 4KMUA 3SZYA 5JVOA 3H3VD 1XXBA 5C4XK 2E2HC 2JA6A 4GTFA 3GTOC 1WQFA 4G7OA 4YFNA 3WODA 1WCMA 3GTJC 2JA7C 4OIQA 4GTDA 3S14C 4Y52K 4A3GC 5M5YK 1DCHA 2WAQL 3OREA 1O25A 3GTPK 5EGEA 4A3MC 4C3IC 2VUMA 2PMZL 3S1QK 3HOUC 1WOOA 2JA8K 1XZQA 3S1MK 3AD8C 5EGHA 1O2BA 3GTMA 1BGWA 5IYDK 3S2HC 4XCHA 3CAGA 4OIOA 3FKIA 1Y1WC 1TWFC 3HOXC 4YFXA 1IQ0A 4A3JK 2NVYK 4M1XA 4KC6A 1IS1A 3FHZA 2A69A 3K7AK 4KATA 4WILA 3MMLB 3S16C 2JA6K 3GTLA 1TWHC 1O24A 2JH3A 2WB1L 4WJ4A 1O2AA 1IL2A 2E2JC 2GSOA 3GEHA 1R9TA 2E2HK 2ZFZA 3GTOK 5C4XC 5M3MK 1USOA 1I6HC 4A3EK 3I4NC 5IOTA 2R7ZC 4YFKA 4GTEA 1SFOA 2JA7K 3S2DC 3S14K 3HOZK 2NVTC 4A3GK 4XLNA 1F9NA 3I4MC 1B4BA 1J6WA 3GTGA 2Y3PA 2R7ZA 4AYBD 3BUEA 3AD9C 4RMFA 1DCPA 4A3MK 4BKWA 4C3IK 4GTAA 1TWCC 3L4JA 1HI9A 2NVXC 3RZDC 5C44K 2CFAB 5D4DA 3FOFA 3IPJA 2V6TA 1Y1VA 1USMA 4MEXA 3JSTA 5C3EC 4AH6A 4C3JC 4NOIA 1YNNA 4OIRA 3S15K 1PJ7A 3S2HK 4G7HA 1Y1WK 1TWFK 5IP9K 3HOXK 2XCRB 3A8JA 3HKZD 3H0GA 1TWAA 1ZBSA 3BP8C 1BS2A 3S0XA 3G4AA 1EI6A 1EK8A 1R9TK 1G51A 1O28A 2JA6C 4C45A 2P8TA 3TFJA 4A3CC 2P5MA 1O29A 2E2JK 1SFOK 1WCMC 4KB2A 1V5VA 3LAPA 1ISEA 4Y7NC 2GAHC 4PABA 1I6HK 2PA8D 4J3NA 3GTGK 3OPFA 3I4NK 2R7ZK 4A3EC 4BLBA 4A3FC 3S2DK 5TJ3A 2V6SA 4Q4ZA 3L4KA 2NVTK 3HOZC 1JVIA 1WSVA 5JFEA 1GE9A 3I4MK 3CQZA 5M5XK 2VUMC 4OIPA 1XXCA 1J6VA 3HOYC 1TWCK 2NVXK 3RZDK 1XPPA 3GTMC 5C44C
chains in the Genus database with same CATH topology
4LLGA 1TWHC 3GTPC 3CQZC 5C3EK 2WB1L 3FKIC 4C3JK 2B63K 1TWGC 3S1NK 3M4OK 4BXXC 4X6AK 4Q5SA 2E2JC 2A68A 4MQ9A 3GTKK 3S1RC 2E2HK 2E2IC 1TWAK 3GTOK 3S15C 5C4XC 2YU9K 5IYBK 4XSZA 4C3HK 4BY7C 5M3MK 2PPBA 3HOUK 4A3LC 4LJZA 3S1QC 1I6HC 3HOVC 4A3EK 3GTQK 5IP9C 2O5IA 2R7ZC 3I4NC 4A3BK 4A93C 1I50C 1Y1VK 4YFKA 2PA8L 5IP7C 5TMCA 2JA7K 4XLPA 2JA8C 3GTLC 3S14K 3S1MC 3S2DC 2JA5C 3HOZK 2Y0SD 4XSXA 4YG2A 2NVTC 4A3GK 4A3IK 5IYDC 2WAQD 4XLNA 4A3KK 3I4MC 3HOWK 4QIWL 4C2MK 1R9TC 5C4JK 4AYBD 4QJVB 5M5WK 1HQMA 4A3JC 3S17K 4GZYA 2R93C 2NVYC 4A3CK 4A3MK 1K83K 2CW0A 4A3DC 4C3IK 2NVQC 5IYCK 4MEYA 4OINA 1WCMK 2O5JA 1TWCC 2PMZD 4BBRK 1SFOC 3RZOK 2NVXC 4BY1C 5M3FK 3RZDC 3K7AC 3H0GK 4LK1A 1YNJA 5C44K 3DXJA 5D4DA 4KN4A 5FLMK 4Y7NK 1TWHK 2R92C 4MEXA 3M3YK 1TWGK 5C3EC 2B63C 1I3QK 3GTGC 3S1NC 4BBSK 4X6AC 4NOIA 3M4OC 4KMUA 4A3FK 1YNNA 3H3VD 4OIRA 3GTKC 2E2IK 3S15K 5C4XK 2E2HC 3S2HK 3GTOC 2YU9C 3EQLA 5IYBC 4G7HA 4A3LK 1Y1WK 4G7OA 4YFNA 1TWFK 5IP9K 3WODA 4ZH4A 3HOXK 2VUMK 3GTQC 4A3BC 3PO3K 1Y1VC 3GTJC 2JA7C 4OIQA 2A6HA 3HKZD 3S14C 4Y52K 3HOYK 1ZYRA 3PO2C 4A3GC 4A3IC 4A3KC 2Y0SL 3HOWC 5M5YK 1R9TK 3GTMK 4G7ZA 2WAQL 2WB1D 2JA6C 2R93K 5TMFA 3GTPK 3S17C 3CQZK 3FKIK 2NVQK 4AYBL 4A3MC 2BE5A 1K83C 4BXXK 4A3CC 1IW7A 2E2JK 5IYCC 1SFOK 1WCMC 4BBRC 3RZOC 3S1RK 3H0GC 5FLMC 1TWAC 2PMZL 4Y7NC 4BY7K 3S1QK 2A6EA 3HOUC 4LK0A 2PA8D 3HOVK 3GTGK 3M3YC 1I6HK 3I4NK 2R7ZK 4A93K 1I3QC 4A3EC 4BBSC 1I50K 5IP7K 2JA8K 4A3FC 3S2DK 3GTLK 3S1MK 2JA5K 4QIWD 4Q4ZA 2NVTK 1I6VA 3H3VL 3HOZC 5IYDK 3S2HC 3I4MK 5M5XK 4OIOA 1BDFA 4QJVA 1Y1WC 1TWFC 3HOXC 4YFXA 4A3JK 5C4JC 2VUMC 4JK1A 5FJ8K 3GTJK 2NVYK 4OIPA 3S16K 3PO3C 4A3DK 4Y52C 3HOYC 1TWCK 3HKZL 2A69A 2NVXK 4BY1K 3PO2K 3RZDK 3K7AK 1XPPA 4KN7A 1SMYA 3S16C 3GTMC 5C44C 2JA6K 2R92K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LLG A;  1TWH C;  3GTP C;  3CQZ C;  5C3E K;  2WB1 L;  3FKI C;  4C3J K;  2B63 K;  1TWG C;  3S1N K;  3M4O K;  4BXX C;  4X6A K;  4Q5S A;  2E2J C;  2A68 A;  4MQ9 A;  3GTK K;  3S1R C;  2E2H K;  2E2I C;  1TWA K;  3GTO K;  3S15 C;  5C4X C;  2YU9 K;  5IYB K;  4XSZ A;  4C3H K;  4BY7 C;  5M3M K;  2PPB A;  3HOU K;  4A3L C;  4LJZ A;  3S1Q C;  1I6H C;  3HOV C;  4A3E K;  3GTQ K;  5IP9 C;  2O5I A;  2R7Z C;  3I4N C;  4A3B K;  4A93 C;  1I50 C;  1Y1V K;  4YFK A;  2PA8 L;  5IP7 C;  5TMC A;  2JA7 K;  4XLP A;  2JA8 C;  3GTL C;  3S14 K;  3S1M C;  3S2D C;  2JA5 C;  3HOZ K;  2Y0S D;  4XSX A;  4YG2 A;  2NVT C;  4A3G K;  4A3I K;  5IYD C;  2WAQ D;  4XLN A;  4A3K K;  3I4M C;  3HOW K;  4QIW L;  4C2M K;  1R9T C;  5C4J K;  4AYB D;  4QJV B;  5M5W K;  1HQM A;  4A3J C;  3S17 K;  4GZY A;  2R93 C;  2NVY C;  4A3C K;  4A3M K;  1K83 K;  2CW0 A;  4A3D C;  4C3I K;  2NVQ C;  5IYC K;  4MEY A;  4OIN A;  1WCM K;  2O5J A;  1TWC C;  2PMZ D;  4BBR K;  1SFO C;  3RZO K;  2NVX C;  4BY1 C;  5M3F K;  3RZD C;  3K7A C;  3H0G K;  4LK1 A;  1YNJ A;  5C44 K;  3DXJ A;  5D4D A;  4KN4 A;  5FLM K;  4Y7N K;  1TWH K;  2R92 C;  4MEX A;  3M3Y K;  1TWG K;  5C3E C;  2B63 C;  1I3Q K;  3GTG C;  3S1N C;  4BBS K;  4X6A C;  4NOI A;  3M4O C;  4KMU A;  4A3F K;  1YNN A;  3H3V D;  4OIR A;  3GTK C;  2E2I K;  3S15 K;  5C4X K;  2E2H C;  3S2H K;  3GTO C;  2YU9 C;  3EQL A;  5IYB C;  4G7H A;  4A3L K;  1Y1W K;  4G7O A;  4YFN A;  1TWF K;  5IP9 K;  3WOD A;  4ZH4 A;  3HOX K;  2VUM K;  3GTQ C;  4A3B C;  3PO3 K;  1Y1V C;  3GTJ C;  2JA7 C;  4OIQ A;  2A6H A;  3HKZ D;  3S14 C;  4Y52 K;  3HOY K;  1ZYR A;  3PO2 C;  4A3G C;  4A3I C;  4A3K C;  2Y0S L;  3HOW C;  5M5Y K;  1R9T K;  3GTM K;  4G7Z A;  2WAQ L;  2WB1 D;  2JA6 C;  2R93 K;  5TMF A;  3GTP K;  3S17 C;  3CQZ K;  3FKI K;  2NVQ K;  4AYB L;  4A3M C;  2BE5 A;  1K83 C;  4BXX K;  4A3C C;  1IW7 A;  2E2J K;  5IYC C;  1SFO K;  1WCM C;  4BBR C;  3RZO C;  3S1R K;  3H0G C;  5FLM C;  1TWA C;  2PMZ L;  4Y7N C;  4BY7 K;  3S1Q K;  2A6E A;  3HOU C;  4LK0 A;  2PA8 D;  3HOV K;  3GTG K;  3M3Y C;  1I6H K;  3I4N K;  2R7Z K;  4A93 K;  1I3Q C;  4A3E C;  4BBS C;  1I50 K;  5IP7 K;  2JA8 K;  4A3F C;  3S2D K;  3GTL K;  3S1M K;  2JA5 K;  4QIW D;  4Q4Z A;  2NVT K;  1I6V A;  3H3V L;  3HOZ C;  5IYD K;  3S2H C;  3I4M K;  5M5X K;  4OIO A;  1BDF A;  4QJV A;  1Y1W C;  1TWF C;  3HOX C;  4YFX A;  4A3J K;  5C4J C;  2VUM C;  4JK1 A;  5FJ8 K;  3GTJ K;  2NVY K;  4OIP A;  3S16 K;  3PO3 C;  4A3D K;  4Y52 C;  3HOY C;  1TWC K;  3HKZ L;  2A69 A;  2NVX K;  4BY1 K;  3PO2 K;  3RZD K;  3K7A K;  1XPP A;  4KN7 A;  1SMY A;  3S16 C;  3GTM C;  5C44 C;  2JA6 K;  2R92 K; 
#chains in the Genus database with same CATH topology
 2JA5 A;  5C3E K;  3VA7 A;  3FKI C;  4C3J K;  4BXX C;  2FQT A;  4Q5S A;  2A68 A;  1JOE A;  3S1R C;  3S15 C;  1TWA K;  2R93 A;  1VGX A;  4XSZ A;  4LJZ A;  5IP9 C;  1I50 C;  5TMC A;  3T02 A;  1DD5 A;  3GTL C;  4G0U A;  1XXA A;  2EBB A;  2R92 A;  2WAQ D;  4QIW L;  1R9T C;  3G4C A;  5C4J K;  1I50 A;  1J98 A;  3GTK A;  4A3C K;  2XCQ A;  1WIH A;  4A3D C;  4OIN A;  1WCM K;  4KDD A;  2PMZ D;  1SFO C;  5M3F K;  3PO2 C;  3GTQ A;  3BP3 A;  4Y7N K;  3DXJ A;  4KN4 A;  4P5A A;  2PHC B;  3FOE A;  1O27 A;  3GTG C;  4X6A C;  3ERE D;  4A3F K;  1KQ4 A;  1WOS A;  1XZQ B;  4GFQ A;  4KMH A;  1B4A A;  3EQL A;  5IYB C;  1K83 A;  3TFH A;  1XZP A;  1O2F B;  1ZXO A;  5IOS A;  2VUM K;  1PJ6 A;  4KM9 A;  1Y1V C;  2GSN A;  3HOY K;  1ZYR A;  3A8K A;  3T00 A;  2Y0S L;  3HOW C;  3V4G A;  3GTM K;  1I3Q A;  4G7Z A;  2WB1 D;  1RU0 A;  3LPX A;  2R93 K;  3S17 C;  3FKI K;  1ZQ1 C;  2NVQ K;  3AQP A;  2BE5 A;  4BXX K;  1VH2 A;  4P5B A;  4BLA A;  3S1R K;  3AH5 A;  3H0G C;  5FLM C;  1TWA C;  1JQW A;  2A6E A;  1J6X A;  4BBS C;  1I50 K;  3GTL K;  5IOR A;  3LAJ A;  3H3V L;  2GAG C;  3GTP A;  1BDF A;  1TWG A;  1WOP A;  4GTB A;  3Q3Q A;  5C4J C;  4JK1 A;  5FJ8 K;  1ZVU A;  3NUH A;  3PO3 C;  1BJT A;  4A3D K;  2E2I A;  2KWA A;  3PO2 K;  4KN7 A;  3N0C A;  3OEP A;  1F93 A;  2W7V A;  1VRQ C;  1WOR A;  1WSR A;  3CQZ C;  4X6A K;  4WJ3 M;  1L0W A;  4KAR A;  4KB4 A;  4MQ9 A;  5IYB K;  2NVY A;  4BY7 C;  2D6F C;  3N3Y A;  3HOV C;  2O5I A;  4A93 C;  1Y1V K;  5CHP A;  5IP7 C;  4XLP A;  1O26 A;  2V6U A;  2JA5 C;  3N0B A;  3HOW K;  4LOW A;  1HQM A;  1F7U A;  3S17 K;  2R93 C;  2E2H A;  2NVQ C;  3GTO A;  1IE0 A;  4MEY A;  3AQO A;  2FQO A;  4BY1 C;  3H0G K;  4LK1 A;  1YNJ A;  5FLM K;  5CJ9 A;  3GTJ A;  2JA7 A;  2R92 C;  1TWG K;  2B63 C;  3S1N C;  4BBS K;  1WQG A;  3M4O C;  4DDQ A;  2RH6 A;  4ILD A;  3GEE A;  3GTK C;  2E2I K;  3TFI A;  5IOQ A;  2YU9 C;  4A3L K;  1IBA A;  4C3H C;  2B63 A;  2GSU A;  4ZH4 A;  3GTQ C;  1INN A;  3T01 A;  4A3B C;  3QX3 A;  3PO3 K;  2A6H A;  1X31 C;  2YU9 A;  4P9S A;  5E68 A;  4A3I C;  4A3K C;  5HL8 A;  4G0V A;  4G0W A;  4C2M C;  5TMF A;  3CQZ K;  2RGR A;  4AYB L;  1AB4 A;  4LR2 A;  1K83 C;  3GSI A;  1IW7 A;  5IYC C;  2CFA A;  1Y1W A;  4BBR C;  3RZO C;  1UV7 A;  1TWF A;  4KAS A;  4BY7 K;  3HOV K;  4LK0 A;  3M3Y C;  4LQY A;  1WQH A;  4A93 K;  1I3Q C;  5IP7 K;  4KMA A;  2JA5 K;  4QIW D;  1I6V A;  1TWH A;  4QJV A;  3A8I A;  2ZUE A;  3GTJ K;  4O2D A;  1PJ5 A;  1YX2 A;  4Y52 C;  3HKZ L;  3GDZ A;  4BY1 K;  2ZUF A;  1DCO A;  1SMY A;  3ADA C;  2R92 K;  4LLG A;  3GIR A;  3GTP C;  4KAW X;  2B63 K;  3S1N K;  1TWG C;  3M4O K;  5L46 A;  4GTL A;  4KMD A;  3SZZ A;  1EH1 A;  3GTK K;  1EQR A;  2E2I C;  1YCL A;  2YU9 K;  1C0A A;  4C3H K;  1EFW A;  2PPB A;  3HOU K;  4A3L C;  3S1Q C;  4GT9 A;  4FZB A;  3GTQ K;  1F7V A;  4A3B K;  1TWC A;  2PA8 L;  1VJE A;  1XZP B;  2JA8 C;  2NVX A;  3S1M C;  2Y0S D;  4XSX A;  4YG2 A;  4A3I K;  5IYD C;  4KM8 A;  4A3K K;  3HXA A;  4C2M K;  1VLO A;  4QJV B;  5M5W K;  4A3J C;  4GZY A;  3GEI A;  2NVY C;  2XCO A;  1K83 K;  2CW0 A;  3AD7 C;  4PAA A;  5IYC K;  2O5J A;  4GTC A;  4BBR K;  3RZO K;  3S16 K;  3K7A C;  1TWH K;  4FM9 A;  3M3Y K;  3TTG A;  1I3Q K;  4KMU A;  3SZY A;  5JVO A;  3H3V D;  1XXB A;  5C4X K;  2E2H C;  2JA6 A;  4GTF A;  3GTO C;  1WQF A;  4G7O A;  4YFN A;  3WOD A;  1WCM A;  3GTJ C;  2JA7 C;  4OIQ A;  4GTD A;  3S14 C;  4Y52 K;  4A3G C;  5M5Y K;  1DCH A;  2WAQ L;  3ORE A;  1O25 A;  3GTP K;  5EGE A;  4A3M C;  4C3I C;  2VUM A;  2PMZ L;  3S1Q K;  3HOU C;  1WOO A;  2JA8 K;  1XZQ A;  3S1M K;  3AD8 C;  5EGH A;  1O2B A;  3GTM A;  1BGW A;  5IYD K;  3S2H C;  4XCH A;  3CAG A;  4OIO A;  3FKI A;  1Y1W C;  1TWF C;  3HOX C;  4YFX A;  1IQ0 A;  4A3J K;  2NVY K;  4M1X A;  4KC6 A;  1IS1 A;  3FHZ A;  2A69 A;  3K7A K;  4KAT A;  4WIL A;  3MML B;  3S16 C;  2JA6 K;  3GTL A;  1TWH C;  1O24 A;  2JH3 A;  2WB1 L;  4WJ4 A;  1O2A A;  1IL2 A;  2E2J C;  2GSO A;  3GEH A;  1R9T A;  2E2H K;  2ZFZ A;  3GTO K;  5C4X C;  5M3M K;  1USO A;  1I6H C;  4A3E K;  3I4N C;  5IOT A;  2R7Z C;  4YFK A;  4GTE A;  1SFO A;  2JA7 K;  3S2D C;  3S14 K;  3HOZ K;  2NVT C;  4A3G K;  4XLN A;  1F9N A;  3I4M C;  1B4B A;  1J6W A;  3GTG A;  2Y3P A;  2R7Z A;  4AYB D;  3BUE A;  3AD9 C;  4RMF A;  1DCP A;  4A3M K;  4BKW A;  4C3I K;  4GTA A;  1TWC C;  3L4J A;  1HI9 A;  2NVX C;  3RZD C;  5C44 K;  2CFA B;  5D4D A;  3FOF A;  3IPJ A;  2V6T A;  1Y1V A;  1USM A;  4MEX A;  3JST A;  5C3E C;  4AH6 A;  4C3J C;  4NOI A;  1YNN A;  4OIR A;  3S15 K;  1PJ7 A;  3S2H K;  4G7H A;  1Y1W K;  1TWF K;  5IP9 K;  3HOX K;  2XCR B;  3A8J A;  3HKZ D;  3H0G A;  1TWA A;  1ZBS A;  3BP8 C;  1BS2 A;  3S0X A;  3G4A A;  1EI6 A;  1EK8 A;  1R9T K;  1G51 A;  1O28 A;  2JA6 C;  4C45 A;  2P8T A;  3TFJ A;  4A3C C;  2P5M A;  1O29 A;  2E2J K;  1SFO K;  1WCM C;  4KB2 A;  1V5V A;  3LAP A;  1ISE A;  4Y7N C;  2GAH C;  4PAB A;  1I6H K;  2PA8 D;  4J3N A;  3GTG K;  3OPF A;  3I4N K;  2R7Z K;  4A3E C;  4BLB A;  4A3F C;  3S2D K;  5TJ3 A;  2V6S A;  4Q4Z A;  3L4K A;  2NVT K;  3HOZ C;  1JVI A;  1WSV A;  5JFE A;  1GE9 A;  3I4M K;  3CQZ A;  5M5X K;  2VUM C;  4OIP A;  1XXC A;  1J6V A;  3HOY C;  1TWC K;  2NVX K;  3RZD K;  1XPP A;  3GTM C;  5C44 C; 
#chains in the Genus database with same CATH homology
 4LLG A;  1TWH C;  3GTP C;  3CQZ C;  5C3E K;  2WB1 L;  3FKI C;  4C3J K;  2B63 K;  1TWG C;  3S1N K;  3M4O K;  4BXX C;  4X6A K;  4Q5S A;  2E2J C;  2A68 A;  4MQ9 A;  3GTK K;  3S1R C;  2E2H K;  2E2I C;  1TWA K;  3GTO K;  3S15 C;  5C4X C;  2YU9 K;  5IYB K;  4XSZ A;  4C3H K;  4BY7 C;  5M3M K;  2PPB A;  3HOU K;  4A3L C;  4LJZ A;  3S1Q C;  1I6H C;  3HOV C;  4A3E K;  3GTQ K;  5IP9 C;  2O5I A;  2R7Z C;  3I4N C;  4A3B K;  4A93 C;  1I50 C;  1Y1V K;  4YFK A;  2PA8 L;  5IP7 C;  5TMC A;  2JA7 K;  4XLP A;  2JA8 C;  3GTL C;  3S14 K;  3S1M C;  3S2D C;  2JA5 C;  3HOZ K;  2Y0S D;  4XSX A;  4YG2 A;  2NVT C;  4A3G K;  4A3I K;  5IYD C;  2WAQ D;  4XLN A;  4A3K K;  3I4M C;  3HOW K;  4QIW L;  4C2M K;  1R9T C;  5C4J K;  4AYB D;  4QJV B;  5M5W K;  1HQM A;  4A3J C;  3S17 K;  4GZY A;  2R93 C;  2NVY C;  4A3C K;  4A3M K;  1K83 K;  2CW0 A;  4A3D C;  4C3I K;  2NVQ C;  5IYC K;  4MEY A;  4OIN A;  1WCM K;  2O5J A;  1TWC C;  2PMZ D;  4BBR K;  1SFO C;  3RZO K;  2NVX C;  4BY1 C;  5M3F K;  3RZD C;  3K7A C;  3H0G K;  4LK1 A;  1YNJ A;  5C44 K;  3DXJ A;  5D4D A;  4KN4 A;  5FLM K;  4Y7N K;  1TWH K;  2R92 C;  4MEX A;  3M3Y K;  1TWG K;  5C3E C;  2B63 C;  1I3Q K;  3GTG C;  3S1N C;  4BBS K;  4X6A C;  4NOI A;  3M4O C;  4KMU A;  4A3F K;  1YNN A;  3H3V D;  4OIR A;  3GTK C;  2E2I K;  3S15 K;  5C4X K;  2E2H C;  3S2H K;  3GTO C;  2YU9 C;  3EQL A;  5IYB C;  4G7H A;  4A3L K;  1Y1W K;  4G7O A;  4YFN A;  1TWF K;  5IP9 K;  3WOD A;  4ZH4 A;  3HOX K;  2VUM K;  3GTQ C;  4A3B C;  3PO3 K;  1Y1V C;  3GTJ C;  2JA7 C;  4OIQ A;  2A6H A;  3HKZ D;  3S14 C;  4Y52 K;  3HOY K;  1ZYR A;  3PO2 C;  4A3G C;  4A3I C;  4A3K C;  2Y0S L;  3HOW C;  5M5Y K;  1R9T K;  3GTM K;  4G7Z A;  2WAQ L;  2WB1 D;  2JA6 C;  2R93 K;  5TMF A;  3GTP K;  3S17 C;  3CQZ K;  3FKI K;  2NVQ K;  4AYB L;  4A3M C;  2BE5 A;  1K83 C;  4BXX K;  4A3C C;  1IW7 A;  2E2J K;  5IYC C;  1SFO K;  1WCM C;  4BBR C;  3RZO C;  3S1R K;  3H0G C;  5FLM C;  1TWA C;  2PMZ L;  4Y7N C;  4BY7 K;  3S1Q K;  2A6E A;  3HOU C;  4LK0 A;  2PA8 D;  3HOV K;  3GTG K;  3M3Y C;  1I6H K;  3I4N K;  2R7Z K;  4A93 K;  1I3Q C;  4A3E C;  4BBS C;  1I50 K;  5IP7 K;  2JA8 K;  4A3F C;  3S2D K;  3GTL K;  3S1M K;  2JA5 K;  4QIW D;  4Q4Z A;  2NVT K;  1I6V A;  3H3V L;  3HOZ C;  5IYD K;  3S2H C;  3I4M K;  5M5X K;  4OIO A;  1BDF A;  4QJV A;  1Y1W C;  1TWF C;  3HOX C;  4YFX A;  4A3J K;  5C4J C;  2VUM C;  4JK1 A;  5FJ8 K;  3GTJ K;  2NVY K;  4OIP A;  3S16 K;  3PO3 C;  4A3D K;  4Y52 C;  3HOY C;  1TWC K;  3HKZ L;  2A69 A;  2NVX K;  4BY1 K;  3PO2 K;  3RZD K;  3K7A K;  1XPP A;  4KN7 A;  1SMY A;  3S16 C;  3GTM C;  5C44 C;  2JA6 K;  2R92 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...