1Y1WK

Complete rna polymerase ii elongation complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(P*AP*GP*TP*AP*CP*TP*TP*AP*CP*GP*CP*CP*TP*GP*GP*TP*CP*AP
publication title Complete RNA Polymerase II Elongation Complex Structure and Its Interactions with NTP and TFIIS
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
total genus 28
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2004-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1y1wK00
3GTJC 4C3JK 3RZDK 2VUMC 3PO2K 1Y1WC 1R9TC 1I50K 3I4MC 4A3IC 3S1RC 5IYDK 1TWGC 2E2JC 2WAQD 2R92K 3S15C 5M5WK 5IYBK 3S17K 4KN4A 5C3EC 2JA6C 4ZH4A 4LK1A 2B63K 2R93K 1TWHC 3HOUK 3GTPC 2NVXC 2PA8L 4OIQA 3M4OC 4Y7NC 3RZOC 2PA8D 3GTMC 3FKIC 4A3EC 4OIRA 3S2DK 4QJVA 2E2IC 3GTOC 1TWAC 3GTQC 1HQMA 2PMZL 3HOVK 1SMYA 4BBSK 1YNJA 4A3MC 3S2HK 3S1MK 4YFXA 4A3DK 1TWFK 5C4XC 4A3GC 1I3QK 5C4JC 5IP7K 4A3FC 2NVTC 3S14C 4A3KC 2A6HA 2JA7C 4BY1K 4BBRK 4XSZA 3WODA 2E2HK 4X6AC 3HOYK 2YU9C 1IW7A 4BY7C 2JA5K 5TMCA 3GTKC 3HOWK 4A3LK 3S1QK 2WAQL 1Y1VC 4LK0A 4QJVB 1WCMK 4A3JK 1SFOC 3PO3C 5D4DA 4Q4ZA 5FLMC 3S16K 3S1NC 1I6HK 2NVYC 3CQZC 2Y0SD 3K7AC 4YFKA 2VUMK 4BXXC 1BDFA 4Y52C 3I4MK 4A3CC 3RZDC 3PO2C 1TWCK 3I4NK 2A6EA 5IYCC 3H0GK 4G7OA 5IYDC 4A93C 3DXJA 4KN7A 2R7ZK 4YFNA 2R92C 5IP9C 4A3BK 2NVQC 5IYBC 2WB1L 2JA8C 3M4OK 3RZOK 3HOXC 2R93C 3HOUC 4GZYA 3EQLA 2WB1D 3GTMK 3GTGC 4MEYA 2E2IK 3GTOK 1TWAK 4XSXA 1K83C 3HOZC 4XLPA 3S2DC 5M3FK 3GTLK 3HOVC 4QIWD 2Y0SL 4OIPA 4A3GK 5C4JK 3S2HC 2NVTK 2A69A 5C44K 4A3DC 4A3KK 2JA7K 3M3YC 3GTJK 1I6VA 1I3QC 3H3VD 4LLGA 5IP7C 1Y1WK 1R9TK 4BBRC 4C3HK 4A3IK 3S1RK 5FJ8K 2E2HC 4OIOA 1TWGK 2E2JK 1YNNA 1I50C 3S1NK 2JA5C 5FLMK 3HOWC 3S1QC 4A3LC 2NVYK 3S15K 3CQZK 4BBSC 4XLNA 1WCMC 5M5XK 4A3JC 5M5YK 1I6HC 4G7HA 4YG2A 5C3EK 2JA6K 1TWHK 3GTPK 2NVXK 3HKZD 5TMFA 3S17C 2O5IA 4Y7NK 5IYCK 2B63C 1TWCC 4A93K 3FKIK 4A3EK 3I4NC 3GTQK 3H0GC 5IP9K 2CW0A 4MEXA 4QIWL 4C3IK 2NVQK 4A3MK 4AYBL 5C44C 2R7ZC 4Q5SA 4C2MK 2JA8K 5C4XK 4AYBD 3HOXK 4A3BC 3S14K 4G7ZA 4A3FK 3H3VL 3GTGK 1TWFC 4KMUA 4NOIA 2PPBA 3S1MC 4X6AK 5M3MK 1K83K 3HOZK 2YU9K 2BE5A 4BY7K 2O5JA 4LJZA 4BY1C 3GTKK 1ZYRA 1Y1VK 3HOYC 3PO3K 1SFOK 2PMZD 2A68A 3GTLC 4OINA 1XPPA 3M3YK 3K7AK 4MQ9A 3S16C 4BXXK 3HKZL 4JK1A 4Y52K 4A3CK
chains in the Genus database with same CATH superfamily
3OPFA 4KB2A 4A3IC 3S1RC 1VGXA 3TFHA 1TWGC 2WAQD 2R92K 1WQFA 4PAAA 1RU0A 5C3EC 3GEHA 1EK8A 3JSTA 3CAGA 3OEPA 1TWGA 4OIQA 2KWAA 4QJVA 2PMZL 3HOVK 4YFXA 1BS2A 1DCHA 5C4JC 3N0BA 1HI9A 4BY1K 3TTGA 3Q3QA 4BY7C 2JA5K 5L46A 3AQOA 4BBSK 4LK0A 4GTDA 3S16K 3S1NC 1WOPA 4Q4ZA 4RMFA 3K7AC 4WILA 1ISEA 1BDFA 4C3JC 3RZDC 3PO2C 2A6EA 4O2DA 4KASA 4WJ4A 4A93C 3DXJA 3TFIA 5IP9C 4C3IC 4GTCA 2NVQC 3GTPA 2JA8C 3AH5A 3BUEA 3GTMK 3BP8C 4MEYA 4GFQA 1K83C 3S2DC 4GTEA 4QIWD 1DCOA 4OIPA 1XZQA 4A3DC 3OREA 3LPXA 3GEEA 1K83A 3G4CA 4A3IK 4C3HK 3S1RK 1TWGK 1IE0A 5FLMK 3HOWC 4A3LC 3CQZK 1I6HC 4G7HA 5C3EK 5IYCK 1O25A 1TWCC 4GTFA 4G0UA 1INNA 3I4NC 3SZYA 4MEXA 4GTLA 4AYBL 2R7ZC 4AYBD 4A3BC 1TWCA 3GTGK 4KMUA 2PPBA 3GIRA 4BY7K 4BY1C 2R7ZA 4AH6A 3GTLC 4OINA 2ZFZA 1IS1A 3K7AK 3S16C 2W7VA 5C44C 4JK1A 1JOEA 1DCPA 4C3JK 3RZDK 4J3NA 3PO2K 3GTLA 2E2JC 1O24A 5IORA 1WIHA 1J98A 4KN4A 1V5VA 3NUHA 2NVXC 2GAHC 3ADAC 3GTMC 4OIRA 3S2DK 3GTQC 1BGWA 4G0WA 4WJ3M 3S1MK 4A3DK 2NVXA 1YX2A 2RH6A 1IQ0A 4KMDA 2FQTA 4KATA 3S14C 1JVIA 3GTMA 2A6HA 3BP3A 3GTQA 3SZZA 4P9SA 5JVOA 3TFJA 4C3HC 3GTKC 3HOWK 4A3LK 2WAQL 3A8IA 3T00A 1Y1VC 4QJVB 4FM9A 3PO3C 2Y3PA 5FLMC 1I6HK 3CQZC 2VUMK 4A3CC 4KB4A 1TWCK 5IOSA 3GTKA 1Y1VA 3I4NK 5IYCC 5IYDC 4BKWA 3CQZA 2R7ZK 1ZVUA 4P5AA 4A3BK 5IOQA 1F7VA 3M4OK 5CHPA 3RZOK 2R93C 3AD7C 3GTGC 2E2IK 1ZQ1C 2V6SA 1TWAK 3GTOK 3QX3A 4XLPA 1O2FB 3GTLK 2EBBA 1O28A 1XXCA 3S2HC 1VRQC 5C44K 2R93A 2JA7K 3GTGA 1O27A 3H3VD 1KQ4A 1WSRA 4BLAA 1ZXOA 4BBRC 3T01A 2E2JK 2CFAB 4KMHA 1X31C 4A3JC 5M5XK 4G0VA 2ZUEA 2XCQA 2NVXK 3HKZD 4DDQA 1UV7A 3GTQK 5HL8A 1IBAA 2CW0A 4QIWL 4C2MK 1O2BA 3S14K 3S1MC 3GTKK 5E68A 1Y1VK 3PO3K 3FOFA 1DD5A 2GSNA 1EI6A 4A3CK 3G4AA 2VUMC 1R9TC 2PHCB 5IYDK 3FOEA 3S15C 4KC6A 2VUMA 2V6TA 2JA6C 4ZH4A 1XZPB 1R9TA 2R93K 5EGHA 4ILDA 2PA8L 3M4OC 4Y7NC 3RZOC 2PA8D 3FKIC 2E2IC 3GTOC 1TWAC 2JH3A 3N0CA 1SMYA 2JA6A 2V6UA 1YNJA 4A3MC 3S2HK 1USMA 5C4XC 3IPJA 1PJ7A 3FKIA 2JA7C 1USOA 4BBRK 4KM9A 3WODA 2GAGC 3AQPA 1TWAA 3GTOA 2E2IA 2YU9C 1IL2A 4A3JK 1SFOC 5D4DA 1WORA 2Y0SD 2JA7A 4LOWA 4YFKA 4BXXC 2YU9A 1O2AA 3I4MK 1O29A 1SFOA 4G7OA 4KN7A 2P8TA 4YFNA 4KM8A 2XCOA 5IYBC 4C2MC 2WB1L 3HOUC 4GZYA 1J6WA 2WB1D 3L4JA 4XSXA 1EFWA 1GE9A 1VJEA 4A3GK 2NVTK 2A69A 4A3KK 5IOTA 1I6VA 1I3QC 5CJ9A 4LLGA 5IP7C 1R9TK 2E2HC 5FJ8K 4GT9A 4KARA 1AB4A 4OIOA 1YNNA 4LQYA 1O26A 3V4GA 3T02A 3S1QC 2NVYK 3S15K 4XLNA 1WCMC 1I3QA 4YG2A 2D6FC 2JA6K 2E2HA 1YCLA 4Y7NK 3FKIK 1WCMA 5TJ3A 3H0GC 3GDZA 3L4KA 4Q5SA 1WOOA 4A3MK 5C4XK 3HOXK 3GEIA 3H3VL 4NOIA 3H0GA 3HOZK 2YU9K 2O5JA 4LJZA 1ZYRA 4BLBA 2XCRB 1G51A 1WQHA 1SFOK 2PMZD 4GTBA 3M3YK 4MQ9A 4BXXK 3HKZL 3GTJC 1XZQB 1Y1WC 4M1XA 1I50K 3I4MC 1F7UA 1WQGA 5M5WK 5IYBK 4KDDA 3GTJA 3HXAA 3S17K 1Y1WA 4LR2A 4LK1A 4KAWX 2B63K 1TWHC 3HOUK 3GTPC 1BJTA 3S0XA 3AD8C 3GSIA 2ZUFA 4A3EC 1HQMA 1TWHA 3ERED 1TWFK 3N3YA 4A3GC 1I3QK 5IP7K 4A3FC 2NVTC 4A3KC 1XXAA 4XSZA 2CFAA 2E2HK 4X6AC 3HOYK 1IW7A 5TMCA 1J6XA 3S1QK 4PABA 1WCMK 4C45A 2RGRA 1L0WA 2NVYC 1EQRA 1PJ5A 1WSVA 4Y52C 4P5BA 3A8KA 1J6VA 3VA7A 2P5MA 3H0GK 1EH1A 3LAPA 2NVYA 5EGEA 2R92C 1F9NA 1VLOA 5JFEA 3HOXC 3EQLA 4FZBA 1WOSA 3HOZC 3MMLB 2R92A 5M3FK 3HOVC 2Y0SL 5C4JK 3M3YC 3GTJK 3A8JA 1F93A 1Y1WK 2GSOA 1I50C 3S1NK 2JA5C 4BBSC 1B4BA 1XZPA 4KMAA 5M5YK 3AD9C 1TWHK 3GTPK 5TMFA 1B4AA 3S17C 2O5IA 1I50A 2B63C 1VH2A 2JA5A 4A93K 4A3EK 5IP9K 4C3IK 2NVQK 4XCHA 2JA8K 2B63A 4G7ZA 4A3FK 1JQWA 1TWFC 2FQOA 4X6AK 2GSUA 5M3MK 1K83K 1ZBSA 2BE5A 1C0AA 4GTAA 1XXBA 3LAJA 3HOYC 2A68A 3FHZA 1XPPA 1TWFA 1PJ6A 4Y52K
chains in the Genus database with same CATH topology
3GTJC 4C3JK 3RZDK 2VUMC 3PO2K 1Y1WC 1R9TC 1I50K 3I4MC 4A3IC 3S1RC 5IYDK 1TWGC 2E2JC 2WAQD 2R92K 3S15C 5M5WK 5IYBK 3S17K 4KN4A 5C3EC 2JA6C 4ZH4A 4LK1A 2B63K 2R93K 1TWHC 3HOUK 3GTPC 2NVXC 2PA8L 4OIQA 3M4OC 4Y7NC 3RZOC 2PA8D 3GTMC 3FKIC 4A3EC 4OIRA 3S2DK 4QJVA 2E2IC 3GTOC 1TWAC 3GTQC 1HQMA 2PMZL 3HOVK 1SMYA 4BBSK 1YNJA 4A3MC 3S2HK 3S1MK 4YFXA 4A3DK 1TWFK 5C4XC 4A3GC 1I3QK 5C4JC 5IP7K 4A3FC 2NVTC 3S14C 4A3KC 2A6HA 2JA7C 4BY1K 4BBRK 4XSZA 3WODA 2E2HK 4X6AC 3HOYK 2YU9C 1IW7A 4BY7C 2JA5K 5TMCA 3GTKC 3HOWK 4A3LK 3S1QK 2WAQL 1Y1VC 4LK0A 4QJVB 1WCMK 4A3JK 1SFOC 3PO3C 5D4DA 4Q4ZA 5FLMC 3S16K 3S1NC 1I6HK 2NVYC 3CQZC 2Y0SD 3K7AC 4YFKA 2VUMK 4BXXC 1BDFA 4Y52C 3I4MK 4A3CC 3RZDC 3PO2C 1TWCK 3I4NK 2A6EA 5IYCC 3H0GK 4G7OA 5IYDC 4A93C 3DXJA 4KN7A 2R7ZK 4YFNA 2R92C 5IP9C 4A3BK 2NVQC 5IYBC 2WB1L 2JA8C 3M4OK 3RZOK 3HOXC 2R93C 3HOUC 4GZYA 3EQLA 2WB1D 3GTMK 3GTGC 4MEYA 2E2IK 3GTOK 1TWAK 4XSXA 1K83C 3HOZC 4XLPA 3S2DC 5M3FK 3GTLK 3HOVC 4QIWD 2Y0SL 4OIPA 4A3GK 5C4JK 3S2HC 2NVTK 2A69A 5C44K 4A3DC 4A3KK 2JA7K 3M3YC 3GTJK 1I6VA 1I3QC 3H3VD 4LLGA 5IP7C 1Y1WK 1R9TK 4BBRC 4C3HK 4A3IK 3S1RK 5FJ8K 2E2HC 4OIOA 1TWGK 2E2JK 1YNNA 1I50C 3S1NK 2JA5C 5FLMK 3HOWC 3S1QC 4A3LC 2NVYK 3S15K 3CQZK 4BBSC 4XLNA 1WCMC 5M5XK 4A3JC 5M5YK 1I6HC 4G7HA 4YG2A 5C3EK 2JA6K 1TWHK 3GTPK 2NVXK 3HKZD 5TMFA 3S17C 2O5IA 4Y7NK 5IYCK 2B63C 1TWCC 4A93K 3FKIK 4A3EK 3I4NC 3GTQK 3H0GC 5IP9K 2CW0A 4MEXA 4QIWL 4C3IK 2NVQK 4A3MK 4AYBL 5C44C 2R7ZC 4Q5SA 4C2MK 2JA8K 5C4XK 4AYBD 3HOXK 4A3BC 3S14K 4G7ZA 4A3FK 3H3VL 3GTGK 1TWFC 4KMUA 4NOIA 2PPBA 3S1MC 4X6AK 5M3MK 1K83K 3HOZK 2YU9K 2BE5A 4BY7K 2O5JA 4LJZA 4BY1C 3GTKK 1ZYRA 1Y1VK 3HOYC 3PO3K 1SFOK 2PMZD 2A68A 3GTLC 4OINA 1XPPA 3M3YK 3K7AK 4MQ9A 3S16C 4BXXK 3HKZL 4JK1A 4Y52K 4A3CK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTJ C;  4C3J K;  3RZD K;  2VUM C;  3PO2 K;  1Y1W C;  1R9T C;  1I50 K;  3I4M C;  4A3I C;  3S1R C;  5IYD K;  1TWG C;  2E2J C;  2WAQ D;  2R92 K;  3S15 C;  5M5W K;  5IYB K;  3S17 K;  4KN4 A;  5C3E C;  2JA6 C;  4ZH4 A;  4LK1 A;  2B63 K;  2R93 K;  1TWH C;  3HOU K;  3GTP C;  2NVX C;  2PA8 L;  4OIQ A;  3M4O C;  4Y7N C;  3RZO C;  2PA8 D;  3GTM C;  3FKI C;  4A3E C;  4OIR A;  3S2D K;  4QJV A;  2E2I C;  3GTO C;  1TWA C;  3GTQ C;  1HQM A;  2PMZ L;  3HOV K;  1SMY A;  4BBS K;  1YNJ A;  4A3M C;  3S2H K;  3S1M K;  4YFX A;  4A3D K;  1TWF K;  5C4X C;  4A3G C;  1I3Q K;  5C4J C;  5IP7 K;  4A3F C;  2NVT C;  3S14 C;  4A3K C;  2A6H A;  2JA7 C;  4BY1 K;  4BBR K;  4XSZ A;  3WOD A;  2E2H K;  4X6A C;  3HOY K;  2YU9 C;  1IW7 A;  4BY7 C;  2JA5 K;  5TMC A;  3GTK C;  3HOW K;  4A3L K;  3S1Q K;  2WAQ L;  1Y1V C;  4LK0 A;  4QJV B;  1WCM K;  4A3J K;  1SFO C;  3PO3 C;  5D4D A;  4Q4Z A;  5FLM C;  3S16 K;  3S1N C;  1I6H K;  2NVY C;  3CQZ C;  2Y0S D;  3K7A C;  4YFK A;  2VUM K;  4BXX C;  1BDF A;  4Y52 C;  3I4M K;  4A3C C;  3RZD C;  3PO2 C;  1TWC K;  3I4N K;  2A6E A;  5IYC C;  3H0G K;  4G7O A;  5IYD C;  4A93 C;  3DXJ A;  4KN7 A;  2R7Z K;  4YFN A;  2R92 C;  5IP9 C;  4A3B K;  2NVQ C;  5IYB C;  2WB1 L;  2JA8 C;  3M4O K;  3RZO K;  3HOX C;  2R93 C;  3HOU C;  4GZY A;  3EQL A;  2WB1 D;  3GTM K;  3GTG C;  4MEY A;  2E2I K;  3GTO K;  1TWA K;  4XSX A;  1K83 C;  3HOZ C;  4XLP A;  3S2D C;  5M3F K;  3GTL K;  3HOV C;  4QIW D;  2Y0S L;  4OIP A;  4A3G K;  5C4J K;  3S2H C;  2NVT K;  2A69 A;  5C44 K;  4A3D C;  4A3K K;  2JA7 K;  3M3Y C;  3GTJ K;  1I6V A;  1I3Q C;  3H3V D;  4LLG A;  5IP7 C;  1Y1W K;  1R9T K;  4BBR C;  4C3H K;  4A3I K;  3S1R K;  5FJ8 K;  2E2H C;  4OIO A;  1TWG K;  2E2J K;  1YNN A;  1I50 C;  3S1N K;  2JA5 C;  5FLM K;  3HOW C;  3S1Q C;  4A3L C;  2NVY K;  3S15 K;  3CQZ K;  4BBS C;  4XLN A;  1WCM C;  5M5X K;  4A3J C;  5M5Y K;  1I6H C;  4G7H A;  4YG2 A;  5C3E K;  2JA6 K;  1TWH K;  3GTP K;  2NVX K;  3HKZ D;  5TMF A;  3S17 C;  2O5I A;  4Y7N K;  5IYC K;  2B63 C;  1TWC C;  4A93 K;  3FKI K;  4A3E K;  3I4N C;  3GTQ K;  3H0G C;  5IP9 K;  2CW0 A;  4MEX A;  4QIW L;  4C3I K;  2NVQ K;  4A3M K;  4AYB L;  5C44 C;  2R7Z C;  4Q5S A;  4C2M K;  2JA8 K;  5C4X K;  4AYB D;  3HOX K;  4A3B C;  3S14 K;  4G7Z A;  4A3F K;  3H3V L;  3GTG K;  1TWF C;  4KMU A;  4NOI A;  2PPB A;  3S1M C;  4X6A K;  5M3M K;  1K83 K;  3HOZ K;  2YU9 K;  2BE5 A;  4BY7 K;  2O5J A;  4LJZ A;  4BY1 C;  3GTK K;  1ZYR A;  1Y1V K;  3HOY C;  3PO3 K;  1SFO K;  2PMZ D;  2A68 A;  3GTL C;  4OIN A;  1XPP A;  3M3Y K;  3K7A K;  4MQ9 A;  3S16 C;  4BXX K;  3HKZ L;  4JK1 A;  4Y52 K;  4A3C K; 
#chains in the Genus database with same CATH topology
 3OPF A;  4KB2 A;  4A3I C;  3S1R C;  1VGX A;  3TFH A;  1TWG C;  2WAQ D;  2R92 K;  1WQF A;  4PAA A;  1RU0 A;  5C3E C;  3GEH A;  1EK8 A;  3JST A;  3CAG A;  3OEP A;  1TWG A;  4OIQ A;  2KWA A;  4QJV A;  2PMZ L;  3HOV K;  4YFX A;  1BS2 A;  1DCH A;  5C4J C;  3N0B A;  1HI9 A;  4BY1 K;  3TTG A;  3Q3Q A;  4BY7 C;  2JA5 K;  5L46 A;  3AQO A;  4BBS K;  4LK0 A;  4GTD A;  3S16 K;  3S1N C;  1WOP A;  4Q4Z A;  4RMF A;  3K7A C;  4WIL A;  1ISE A;  1BDF A;  4C3J C;  3RZD C;  3PO2 C;  2A6E A;  4O2D A;  4KAS A;  4WJ4 A;  4A93 C;  3DXJ A;  3TFI A;  5IP9 C;  4C3I C;  4GTC A;  2NVQ C;  3GTP A;  2JA8 C;  3AH5 A;  3BUE A;  3GTM K;  3BP8 C;  4MEY A;  4GFQ A;  1K83 C;  3S2D C;  4GTE A;  4QIW D;  1DCO A;  4OIP A;  1XZQ A;  4A3D C;  3ORE A;  3LPX A;  3GEE A;  1K83 A;  3G4C A;  4A3I K;  4C3H K;  3S1R K;  1TWG K;  1IE0 A;  5FLM K;  3HOW C;  4A3L C;  3CQZ K;  1I6H C;  4G7H A;  5C3E K;  5IYC K;  1O25 A;  1TWC C;  4GTF A;  4G0U A;  1INN A;  3I4N C;  3SZY A;  4MEX A;  4GTL A;  4AYB L;  2R7Z C;  4AYB D;  4A3B C;  1TWC A;  3GTG K;  4KMU A;  2PPB A;  3GIR A;  4BY7 K;  4BY1 C;  2R7Z A;  4AH6 A;  3GTL C;  4OIN A;  2ZFZ A;  1IS1 A;  3K7A K;  3S16 C;  2W7V A;  5C44 C;  4JK1 A;  1JOE A;  1DCP A;  4C3J K;  3RZD K;  4J3N A;  3PO2 K;  3GTL A;  2E2J C;  1O24 A;  5IOR A;  1WIH A;  1J98 A;  4KN4 A;  1V5V A;  3NUH A;  2NVX C;  2GAH C;  3ADA C;  3GTM C;  4OIR A;  3S2D K;  3GTQ C;  1BGW A;  4G0W A;  4WJ3 M;  3S1M K;  4A3D K;  2NVX A;  1YX2 A;  2RH6 A;  1IQ0 A;  4KMD A;  2FQT A;  4KAT A;  3S14 C;  1JVI A;  3GTM A;  2A6H A;  3BP3 A;  3GTQ A;  3SZZ A;  4P9S A;  5JVO A;  3TFJ A;  4C3H C;  3GTK C;  3HOW K;  4A3L K;  2WAQ L;  3A8I A;  3T00 A;  1Y1V C;  4QJV B;  4FM9 A;  3PO3 C;  2Y3P A;  5FLM C;  1I6H K;  3CQZ C;  2VUM K;  4A3C C;  4KB4 A;  1TWC K;  5IOS A;  3GTK A;  1Y1V A;  3I4N K;  5IYC C;  5IYD C;  4BKW A;  3CQZ A;  2R7Z K;  1ZVU A;  4P5A A;  4A3B K;  5IOQ A;  1F7V A;  3M4O K;  5CHP A;  3RZO K;  2R93 C;  3AD7 C;  3GTG C;  2E2I K;  1ZQ1 C;  2V6S A;  1TWA K;  3GTO K;  3QX3 A;  4XLP A;  1O2F B;  3GTL K;  2EBB A;  1O28 A;  1XXC A;  3S2H C;  1VRQ C;  5C44 K;  2R93 A;  2JA7 K;  3GTG A;  1O27 A;  3H3V D;  1KQ4 A;  1WSR A;  4BLA A;  1ZXO A;  4BBR C;  3T01 A;  2E2J K;  2CFA B;  4KMH A;  1X31 C;  4A3J C;  5M5X K;  4G0V A;  2ZUE A;  2XCQ A;  2NVX K;  3HKZ D;  4DDQ A;  1UV7 A;  3GTQ K;  5HL8 A;  1IBA A;  2CW0 A;  4QIW L;  4C2M K;  1O2B A;  3S14 K;  3S1M C;  3GTK K;  5E68 A;  1Y1V K;  3PO3 K;  3FOF A;  1DD5 A;  2GSN A;  1EI6 A;  4A3C K;  3G4A A;  2VUM C;  1R9T C;  2PHC B;  5IYD K;  3FOE A;  3S15 C;  4KC6 A;  2VUM A;  2V6T A;  2JA6 C;  4ZH4 A;  1XZP B;  1R9T A;  2R93 K;  5EGH A;  4ILD A;  2PA8 L;  3M4O C;  4Y7N C;  3RZO C;  2PA8 D;  3FKI C;  2E2I C;  3GTO C;  1TWA C;  2JH3 A;  3N0C A;  1SMY A;  2JA6 A;  2V6U A;  1YNJ A;  4A3M C;  3S2H K;  1USM A;  5C4X C;  3IPJ A;  1PJ7 A;  3FKI A;  2JA7 C;  1USO A;  4BBR K;  4KM9 A;  3WOD A;  2GAG C;  3AQP A;  1TWA A;  3GTO A;  2E2I A;  2YU9 C;  1IL2 A;  4A3J K;  1SFO C;  5D4D A;  1WOR A;  2Y0S D;  2JA7 A;  4LOW A;  4YFK A;  4BXX C;  2YU9 A;  1O2A A;  3I4M K;  1O29 A;  1SFO A;  4G7O A;  4KN7 A;  2P8T A;  4YFN A;  4KM8 A;  2XCO A;  5IYB C;  4C2M C;  2WB1 L;  3HOU C;  4GZY A;  1J6W A;  2WB1 D;  3L4J A;  4XSX A;  1EFW A;  1GE9 A;  1VJE A;  4A3G K;  2NVT K;  2A69 A;  4A3K K;  5IOT A;  1I6V A;  1I3Q C;  5CJ9 A;  4LLG A;  5IP7 C;  1R9T K;  2E2H C;  5FJ8 K;  4GT9 A;  4KAR A;  1AB4 A;  4OIO A;  1YNN A;  4LQY A;  1O26 A;  3V4G A;  3T02 A;  3S1Q C;  2NVY K;  3S15 K;  4XLN A;  1WCM C;  1I3Q A;  4YG2 A;  2D6F C;  2JA6 K;  2E2H A;  1YCL A;  4Y7N K;  3FKI K;  1WCM A;  5TJ3 A;  3H0G C;  3GDZ A;  3L4K A;  4Q5S A;  1WOO A;  4A3M K;  5C4X K;  3HOX K;  3GEI A;  3H3V L;  4NOI A;  3H0G A;  3HOZ K;  2YU9 K;  2O5J A;  4LJZ A;  1ZYR A;  4BLB A;  2XCR B;  1G51 A;  1WQH A;  1SFO K;  2PMZ D;  4GTB A;  3M3Y K;  4MQ9 A;  4BXX K;  3HKZ L;  3GTJ C;  1XZQ B;  1Y1W C;  4M1X A;  1I50 K;  3I4M C;  1F7U A;  1WQG A;  5M5W K;  5IYB K;  4KDD A;  3GTJ A;  3HXA A;  3S17 K;  1Y1W A;  4LR2 A;  4LK1 A;  4KAW X;  2B63 K;  1TWH C;  3HOU K;  3GTP C;  1BJT A;  3S0X A;  3AD8 C;  3GSI A;  2ZUF A;  4A3E C;  1HQM A;  1TWH A;  3ERE D;  1TWF K;  3N3Y A;  4A3G C;  1I3Q K;  5IP7 K;  4A3F C;  2NVT C;  4A3K C;  1XXA A;  4XSZ A;  2CFA A;  2E2H K;  4X6A C;  3HOY K;  1IW7 A;  5TMC A;  1J6X A;  3S1Q K;  4PAB A;  1WCM K;  4C45 A;  2RGR A;  1L0W A;  2NVY C;  1EQR A;  1PJ5 A;  1WSV A;  4Y52 C;  4P5B A;  3A8K A;  1J6V A;  3VA7 A;  2P5M A;  3H0G K;  1EH1 A;  3LAP A;  2NVY A;  5EGE A;  2R92 C;  1F9N A;  1VLO A;  5JFE A;  3HOX C;  3EQL A;  4FZB A;  1WOS A;  3HOZ C;  3MML B;  2R92 A;  5M3F K;  3HOV C;  2Y0S L;  5C4J K;  3M3Y C;  3GTJ K;  3A8J A;  1F93 A;  1Y1W K;  2GSO A;  1I50 C;  3S1N K;  2JA5 C;  4BBS C;  1B4B A;  1XZP A;  4KMA A;  5M5Y K;  3AD9 C;  1TWH K;  3GTP K;  5TMF A;  1B4A A;  3S17 C;  2O5I A;  1I50 A;  2B63 C;  1VH2 A;  2JA5 A;  4A93 K;  4A3E K;  5IP9 K;  4C3I K;  2NVQ K;  4XCH A;  2JA8 K;  2B63 A;  4G7Z A;  4A3F K;  1JQW A;  1TWF C;  2FQO A;  4X6A K;  2GSU A;  5M3M K;  1K83 K;  1ZBS A;  2BE5 A;  1C0A A;  4GTA A;  1XXB A;  3LAJ A;  3HOY C;  2A68 A;  3FHZ A;  1XPP A;  1TWF A;  1PJ6 A;  4Y52 K; 
#chains in the Genus database with same CATH homology
 3GTJ C;  4C3J K;  3RZD K;  2VUM C;  3PO2 K;  1Y1W C;  1R9T C;  1I50 K;  3I4M C;  4A3I C;  3S1R C;  5IYD K;  1TWG C;  2E2J C;  2WAQ D;  2R92 K;  3S15 C;  5M5W K;  5IYB K;  3S17 K;  4KN4 A;  5C3E C;  2JA6 C;  4ZH4 A;  4LK1 A;  2B63 K;  2R93 K;  1TWH C;  3HOU K;  3GTP C;  2NVX C;  2PA8 L;  4OIQ A;  3M4O C;  4Y7N C;  3RZO C;  2PA8 D;  3GTM C;  3FKI C;  4A3E C;  4OIR A;  3S2D K;  4QJV A;  2E2I C;  3GTO C;  1TWA C;  3GTQ C;  1HQM A;  2PMZ L;  3HOV K;  1SMY A;  4BBS K;  1YNJ A;  4A3M C;  3S2H K;  3S1M K;  4YFX A;  4A3D K;  1TWF K;  5C4X C;  4A3G C;  1I3Q K;  5C4J C;  5IP7 K;  4A3F C;  2NVT C;  3S14 C;  4A3K C;  2A6H A;  2JA7 C;  4BY1 K;  4BBR K;  4XSZ A;  3WOD A;  2E2H K;  4X6A C;  3HOY K;  2YU9 C;  1IW7 A;  4BY7 C;  2JA5 K;  5TMC A;  3GTK C;  3HOW K;  4A3L K;  3S1Q K;  2WAQ L;  1Y1V C;  4LK0 A;  4QJV B;  1WCM K;  4A3J K;  1SFO C;  3PO3 C;  5D4D A;  4Q4Z A;  5FLM C;  3S16 K;  3S1N C;  1I6H K;  2NVY C;  3CQZ C;  2Y0S D;  3K7A C;  4YFK A;  2VUM K;  4BXX C;  1BDF A;  4Y52 C;  3I4M K;  4A3C C;  3RZD C;  3PO2 C;  1TWC K;  3I4N K;  2A6E A;  5IYC C;  3H0G K;  4G7O A;  5IYD C;  4A93 C;  3DXJ A;  4KN7 A;  2R7Z K;  4YFN A;  2R92 C;  5IP9 C;  4A3B K;  2NVQ C;  5IYB C;  2WB1 L;  2JA8 C;  3M4O K;  3RZO K;  3HOX C;  2R93 C;  3HOU C;  4GZY A;  3EQL A;  2WB1 D;  3GTM K;  3GTG C;  4MEY A;  2E2I K;  3GTO K;  1TWA K;  4XSX A;  1K83 C;  3HOZ C;  4XLP A;  3S2D C;  5M3F K;  3GTL K;  3HOV C;  4QIW D;  2Y0S L;  4OIP A;  4A3G K;  5C4J K;  3S2H C;  2NVT K;  2A69 A;  5C44 K;  4A3D C;  4A3K K;  2JA7 K;  3M3Y C;  3GTJ K;  1I6V A;  1I3Q C;  3H3V D;  4LLG A;  5IP7 C;  1Y1W K;  1R9T K;  4BBR C;  4C3H K;  4A3I K;  3S1R K;  5FJ8 K;  2E2H C;  4OIO A;  1TWG K;  2E2J K;  1YNN A;  1I50 C;  3S1N K;  2JA5 C;  5FLM K;  3HOW C;  3S1Q C;  4A3L C;  2NVY K;  3S15 K;  3CQZ K;  4BBS C;  4XLN A;  1WCM C;  5M5X K;  4A3J C;  5M5Y K;  1I6H C;  4G7H A;  4YG2 A;  5C3E K;  2JA6 K;  1TWH K;  3GTP K;  2NVX K;  3HKZ D;  5TMF A;  3S17 C;  2O5I A;  4Y7N K;  5IYC K;  2B63 C;  1TWC C;  4A93 K;  3FKI K;  4A3E K;  3I4N C;  3GTQ K;  3H0G C;  5IP9 K;  2CW0 A;  4MEX A;  4QIW L;  4C3I K;  2NVQ K;  4A3M K;  4AYB L;  5C44 C;  2R7Z C;  4Q5S A;  4C2M K;  2JA8 K;  5C4X K;  4AYB D;  3HOX K;  4A3B C;  3S14 K;  4G7Z A;  4A3F K;  3H3V L;  3GTG K;  1TWF C;  4KMU A;  4NOI A;  2PPB A;  3S1M C;  4X6A K;  5M3M K;  1K83 K;  3HOZ K;  2YU9 K;  2BE5 A;  4BY7 K;  2O5J A;  4LJZ A;  4BY1 C;  3GTK K;  1ZYR A;  1Y1V K;  3HOY C;  3PO3 K;  1SFO K;  2PMZ D;  2A68 A;  3GTL C;  4OIN A;  1XPP A;  3M3Y K;  3K7A K;  4MQ9 A;  3S16 C;  4BXX K;  3HKZ L;  4JK1 A;  4Y52 K;  4A3C K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...