1Y1WK

Complete rna polymerase ii elongation complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(P*AP*GP*TP*AP*CP*TP*TP*AP*CP*GP*CP*CP*TP*GP*GP*TP*CP*AP
publication title Complete RNA Polymerase II Elongation Complex Structure and Its Interactions with NTP and TFIIS
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
total genus 28
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2004-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1y1wK00
3FKIC 3HOXC 4A3MC 4OIPA 4G7OA 2R7ZC 3I4MK 3HKZD 2E2JK 4YFXA 4A3BC 4A3FC 5IP9C 5IP7K 4BY7K 4YG2A 5TMFA 4Y7NC 1TWCK 3S17C 4QIWD 4ZH4A 4XLNA 3S15K 3I4NC 5IP7C 1TWGC 3M4OK 4A3JK 4BY7C 1SFOK 2NVTC 4MEXA 3PO2C 4C3HK 5IYBC 3S15C 5C3EC 4A3GK 4BXXC 3M4OC 4QIWL 3GTGK 1I6HK 2Y0SL 5C4XK 4LK0A 4A3EC 5IYDK 5FLMC 3S14K 3S1NC 3HOWK 4QJVA 3K7AK 4OINA 2A6HA 3GTLK 4BBRC 3GTKC 4XSZA 3FKIK 2JA5C 4A3MK 5M5WK 3S14C 1YNJA 4A3BK 5C4JC 4YFNA 4A3FK 5IP9K 2JA6K 5M3MK 1TWHC 1HQMA 2PA8D 4Y7NK 3GTPC 2YU9C 3S17K 4GZYA 3I4NK 2JA6C 1TWGK 2JA8C 2NVTK 3H0GC 3PO2K 2R93C 5IYBK 2PA8L 3S1RC 3M3YC 4A3DC 5C3EK 5FJ8K 4BXXK 2Y0SD 3CQZC 2E2IC 2O5JA 4QJVB 1Y1VC 3GTQC 4A3EK 1YNNA 2NVXC 4BBSC 2R7ZK 3HOVC 2CW0A 5FLMK 2JA7C 3S16C 3S1MK 3S1NK 2NVYC 4A93C 1TWAC 2R92C 3S2DK 4BBRK 5M5YK 3GTKK 3S1QC 2PPBA 3S2HC 2JA5K 3S1MC 2NVQC 3PO3C 5C4JK 3S2DC 4JK1A 4OIRA 1TWHK 5M5XK 2BE5A 5IYCK 4Y52C 1Y1WC 2YU9K 2WAQD 2O5IA 3GTMC 3GTPK 4C2MK 3HOYC 4A3LK 4Q4ZA 2WB1D 4LK1A 2JA8K 3HOUC 3RZDC 3H0GK 4XLPA 3M3YK 3S1RK 1R9TC 4A3DK 2R93K 1WCMC 5TMCA 4A3LC 2WAQL 3CQZK 2E2IK 2PMZD 5C44C 2B63C 2WB1L 1Y1VK 4OIOA 3GTQK 2NVXK 4BBSK 3HOZC 3HOVK 2JA7K 1XPPA 2VUMK 3S16K 4KN4A 2NVYK 2PMZL 1TWFC 1TWAK 4YFKA 3GTJC 4A3KK 4KN7A 2R92K 4A93K 1I3QK 3S1QK 4A3IC 4BY1C 2VUMC 3S2HK 4X6AC 4C3JK 3WODA 2NVQK 4A3CC 4A3KC 3RZOC 1I3QC 5D4DA 1I50K 1IW7A 4Q5SA 4AYBD 4Y52K 1Y1WK 3GTMK 3HOYK 4NOIA 1I50C 5IYCC 4G7HA 3RZDK 2E2HC 3HOUK 1R9TK 4MEYA 4AYBL 1WCMK 4C3IK 2E2JC 5C44K 3I4MC 3HKZL 3HOZK 4LJZA 2A6EA 1TWCC 3GTLC 5M3FK 4OIQA 3GTJK 1TWFK 4A3JC 4X6AK 1SMYA 1SFOC 4A3IK 4BY1K 4KMUA 4XSXA 3H3VD 3HOWC 4A3CK 4A3GC 3RZOK 2A68A 3EQLA 3GTGC 1BDFA 1ZYRA 3GTOK 1I6HC 1K83K 5C4XC 2B63K 3PO3K 4LLGA 4MQ9A 5IYDC 3H3VL 3HOXK 3GTOC 3DXJA 1K83C 1I6VA 3K7AC 4G7ZA 2E2HK 2A69A
chains in the Genus database with same CATH superfamily
4KB2A 3FKIC 3HOXC 4OIPA 1O28A 4YFXA 3FOFA 3AD8C 1EFWA 1XZQA 1BS2A 4QIWD 5IP7C 3ADAC 1TWGC 5IOSA 1SFOK 4C3HK 5C3EC 4A3GK 3GTGK 1PJ6A 1I6HK 2V6SA 4FM9A 1ZXOA 1USMA 3V4GA 4OINA 2A6HA 3GTKC 1XXAA 1TWHC 1TWGA 3S17K 1JVIA 2NVXA 3H0GC 2PA8L 1UV7A 3CQZC 2E2IC 2R92A 5CHPA 1Y1VC 1YX2A 4KM8A 2P5MA 2W7VA 4KC6A 3G4CA 5FLMK 3GTKA 3L4KA 1TWAC 2XCOA 4BBRK 2JA5K 4KB4A 1PJ7A 5C4JK 1XZPA 2XCQA 2Y3PA 3S2DC 4JK1A 1WCMA 1J6VA 2RH6A 1VLOA 4Y52C 3H0GA 3OREA 4KMDA 3HOUC 3CQZA 2E2IA 4J3NA 3S1RK 1Y1VA 4KMHA 1XXCA 1ZBSA 5C44C 4RMFA 1YCLA 4OIOA 1USOA 3HOZC 1L0WA 3IPJA 1TWAA 1B4AA 4WJ4A 1XPPA 1I3QA 1F93A 2PMZL 1TWFC 4A3KK 4PABA 4X6AC 3NUHA 4A3IC 2VUMC 4C3JK 3TFIA 5EGEA 5D4DA 1I50K 2ZUEA 3BP3A 4AYBD 1WOPA 3GTMK 2GSUA 3HOYK 2KWAA 2FQOA 3L4JA 1R9TK 2E2JC 1SFOA 1TWFA 3T02A 4G0VA 3GTGA 2JH3A 1O2AA 2GAHC 4A3JC 4KMAA 4XSXA 1K83A 1WOOA 3CAGA 5C4XC 2B63K 3PO3K 2PHCB 2R7ZA 3H3VL 3HOXK 3GTOC 3DXJA 3K7AC 4G7ZA 2E2HK 3GTLC 1G51A 1AB4A 4A3MC 1WOSA 2XCRB 2V6UA 3HKZD 3I4MK 4A3BC 5IP9C 5IP7K 4YG2A 5TMFA 4Y7NC 1TWCK 3T00A 1KQ4A 3I4NC 4MEXA 3PO2C 1V5VA 3S15C 4BXXC 3M4OC 3LPXA 3JSTA 3OEPA 3AD9C 4A3EC 3GTLA 1WSVA 5IYDK 5IOQA 1JQWA 3S1NC 1RU0A 4QJVA 3GEHA 1C0AA 2JA6A 4O2DA 4C45A 4A3FK 1HQMA 1DCOA 2YU9C 1ISEA 1JOEA 1XXBA 2NVTK 1WIHA 5IYBK 3M3YC 4A3DC 1J6XA 1WSRA 4BBSC 2NVXC 3HOVC 3FHZA 2JA7C 3S16C 3GDZA 2NVYC 4A93C 3S2DK 2R92C 3S1QC 2PPBA 2D6FC 3S1MC 3PO3C 1EH1A 2YU9A 5M5XK 1R9TA 2BE5A 3GTPK 1EK8A 1Y1WC 2WAQD 2O5IA 4C2MK 4Q4ZA 2JA8K 2R93K 1WCMC 5TMCA 2WB1L 2JA7A 3SZZA 3GTQK 2NVYA 1X31C 2VUMK 5CJ9A 4YFKA 3GTJC 3S0XA 3N0CA 3SZYA 4BY1C 4G0UA 3S2HK 1WQFA 2NVQK 2ZUFA 2E2HA 4GT9A 1I3QC 1Y1WA 1O2FB 4Q5SA 3AQPA 4M1XA 3FOEA 2CFAB 2V6TA 3RZDK 4MEYA 3N3YA 3HKZL 3GTJA 4KASA 4C3IC 5M3FK 4OIQA 1SFOC 3BP8C 4KMUA 4C3HC 1O2BA 4A3CK 4A3GC 3RZOK 3TFJA 3GTGC 3GTOK 1ZYRA 1I6HC 4GTLA 2ZFZA 1VRQC 1K83C 5IYCK 1INNA 1VJEA 4G7OA 2R7ZC 4GTEA 3BUEA 3N0BA 3GSIA 3S17C 4ZH4A 3S15K 3M4OK 4BY7C 4GFQA 5JVOA 4BLBA 1O29A 4QIWL 1GE9A 5FLMC 3HOWK 4LOWA 5HL8A 4BBRC 3FKIK 2JA5C 3S14C 1XZQB 1YNJA 5C4JC 3OPFA 1IL2A 5M3MK 1PJ5A 2PA8D 1ZVUA 4GZYA 4BLAA 2JA6C 1TWGK 3GTQA 4PAAA 3A8JA 3S1RC 5C3EK 5FJ8K 2O5JA 2Y0SD 4GTCA 2CW0A 3S1MK 2JA5A 3GTKK 4C3JC 4LQYA 1TWHK 3Q3QA 4G0WA 3A8KA 3GTMC 4LR2A 3HOYC 3QX3A 3H0GK 1R9TC 1IQ0A 5E68A 4A3LC 3CQZK 2E2IK 4KDDA 2PMZD 2GAGC 2EBBA 1Y1VK 1DD5A 4GTFA 1O24A 1XZPB 1TWAK 1I3QK 1I50A 3WODA 1WQHA 3GTMA 1O26A 3AD7C 4Y52K 4NOIA 3HOUK 2E2HC 5EGHA 4GTAA 4AYBL 1J6WA 4C3IK 3I4MC 5C44K 5TJ3A 3HOZK 1O25A 1TWCC 1TWFK 4KATA 4X6AK 3TFHA 4A3IK 3H3VD 2B63A 3EQLA 1BDFA 3FKIA 1K83K 5IORA 5IYDC 4GTBA 1HI9A 2R7ZK 3AH5A 1IS1A 5L46A 3LAJA 5IOTA 2E2JK 4A3FC 1J98A 1TWCA 4BY7K 3GEIA 4KAWX 3T01A 4XLNA 4A3JK 2NVTC 5IYBC 3GIRA 1F7UA 4KARA 2Y0SL 1WORA 5C4XK 4LK0A 3G4AA 3S14K 1TWHA 3K7AK 3GTLK 1O27A 2P8TA 4XSZA 4A3MK 5M5WK 4A3BK 4YFNA 5IP9K 2JA6K 2RGRA 4Y7NK 1EI6A 4AH6A 3GTPC 4C2MC 3I4NK 2JA8C 1IBAA 4GTDA 3PO2K 2R93C 4BXXK 4QJVB 3GTQC 4A3EK 1YNNA 3LAPA 3S1NK 5M5YK 3S2HC 2NVQC 3MMLB 1VGXA 3GTPA 4OIRA 4DDQA 2YU9K 1WQGA 4A3LK 1BGWA 2WB1D 4LK1A 2R93A 3RZDC 3AQOA 4XLPA 3M3YK 4A3DK 4WILA 2WAQL 2CFAA 1B4BA 4ILDA 2VUMA 4BBSK 2NVXK 3HOVK 3GEEA 4P5BA 1F7VA 2JA7K 3S16K 1F9NA 4KN4A 2NVYK 4A93K 4FZBA 2R92K 4KN7A 3S1QK 4A3CC 1EQRA 4A3KC 3RZOC 3HXAA 4KM9A 1IW7A 2GSNA 1Y1WK 2GSOA 4XCHA 1I50C 1BJTA 5IYCC 4G7HA 4BKWA 1WCMK 4P9SA 5JFEA 3TTGA 4P5AA 3VA7A 3ERED 1DCHA 4LJZA 2A6EA 1ZQ1C 3GTJK 1SMYA 1VH2A 4BY1K 1IE0A 3GTOA 3A8IA 2FQTA 1DCPA 2A68A 4WJ3M 4LLGA 4MQ9A 3HOWC 1I6VA 2B63C 2A69A
chains in the Genus database with same CATH topology
3FKIC 3HOXC 4A3MC 4OIPA 4G7OA 2R7ZC 3I4MK 3HKZD 2E2JK 4YFXA 4A3BC 4A3FC 5IP9C 5IP7K 4BY7K 4YG2A 5TMFA 4Y7NC 1TWCK 3S17C 4QIWD 4ZH4A 4XLNA 3S15K 3I4NC 5IP7C 1TWGC 3M4OK 4A3JK 4BY7C 1SFOK 2NVTC 4MEXA 3PO2C 4C3HK 5IYBC 3S15C 5C3EC 4A3GK 4BXXC 3M4OC 4QIWL 3GTGK 1I6HK 2Y0SL 5C4XK 4LK0A 4A3EC 5IYDK 5FLMC 3S14K 3S1NC 3HOWK 4QJVA 3K7AK 4OINA 2A6HA 3GTLK 4BBRC 3GTKC 4XSZA 3FKIK 2JA5C 4A3MK 5M5WK 3S14C 1YNJA 4A3BK 5C4JC 4YFNA 4A3FK 5IP9K 2JA6K 5M3MK 1TWHC 1HQMA 2PA8D 4Y7NK 3GTPC 2YU9C 3S17K 4GZYA 3I4NK 2JA6C 1TWGK 2JA8C 2NVTK 3H0GC 3PO2K 2R93C 5IYBK 2PA8L 3S1RC 3M3YC 4A3DC 5C3EK 5FJ8K 4BXXK 2Y0SD 3CQZC 2E2IC 2O5JA 4QJVB 1Y1VC 3GTQC 4A3EK 1YNNA 2NVXC 4BBSC 2R7ZK 3HOVC 2CW0A 5FLMK 2JA7C 3S16C 3S1MK 3S1NK 2NVYC 4A93C 1TWAC 2R92C 3S2DK 4BBRK 5M5YK 3GTKK 3S1QC 2PPBA 3S2HC 2JA5K 3S1MC 2NVQC 3PO3C 5C4JK 3S2DC 4JK1A 4OIRA 1TWHK 5M5XK 2BE5A 5IYCK 4Y52C 1Y1WC 2YU9K 2WAQD 2O5IA 3GTMC 3GTPK 4C2MK 3HOYC 4A3LK 4Q4ZA 2WB1D 4LK1A 2JA8K 3HOUC 3RZDC 3H0GK 4XLPA 3M3YK 3S1RK 1R9TC 4A3DK 2R93K 1WCMC 5TMCA 4A3LC 2WAQL 3CQZK 2E2IK 2PMZD 5C44C 2B63C 2WB1L 1Y1VK 4OIOA 3GTQK 2NVXK 4BBSK 3HOZC 3HOVK 2JA7K 1XPPA 2VUMK 3S16K 4KN4A 2NVYK 2PMZL 1TWFC 1TWAK 4YFKA 3GTJC 4A3KK 4KN7A 2R92K 4A93K 1I3QK 3S1QK 4A3IC 4BY1C 2VUMC 3S2HK 4X6AC 4C3JK 3WODA 2NVQK 4A3CC 4A3KC 3RZOC 1I3QC 5D4DA 1I50K 1IW7A 4Q5SA 4AYBD 4Y52K 1Y1WK 3GTMK 3HOYK 4NOIA 1I50C 5IYCC 4G7HA 3RZDK 2E2HC 3HOUK 1R9TK 4MEYA 4AYBL 1WCMK 4C3IK 2E2JC 5C44K 3I4MC 3HKZL 3HOZK 4LJZA 2A6EA 1TWCC 3GTLC 5M3FK 4OIQA 3GTJK 1TWFK 4A3JC 4X6AK 1SMYA 1SFOC 4A3IK 4BY1K 4KMUA 4XSXA 3H3VD 3HOWC 4A3CK 4A3GC 3RZOK 2A68A 3EQLA 3GTGC 1BDFA 1ZYRA 3GTOK 1I6HC 1K83K 5C4XC 2B63K 3PO3K 4LLGA 4MQ9A 5IYDC 3H3VL 3HOXK 3GTOC 3DXJA 1K83C 1I6VA 3K7AC 4G7ZA 2E2HK 2A69A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FKI C;  3HOX C;  4A3M C;  4OIP A;  4G7O A;  2R7Z C;  3I4M K;  3HKZ D;  2E2J K;  4YFX A;  4A3B C;  4A3F C;  5IP9 C;  5IP7 K;  4BY7 K;  4YG2 A;  5TMF A;  4Y7N C;  1TWC K;  3S17 C;  4QIW D;  4ZH4 A;  4XLN A;  3S15 K;  3I4N C;  5IP7 C;  1TWG C;  3M4O K;  4A3J K;  4BY7 C;  1SFO K;  2NVT C;  4MEX A;  3PO2 C;  4C3H K;  5IYB C;  3S15 C;  5C3E C;  4A3G K;  4BXX C;  3M4O C;  4QIW L;  3GTG K;  1I6H K;  2Y0S L;  5C4X K;  4LK0 A;  4A3E C;  5IYD K;  5FLM C;  3S14 K;  3S1N C;  3HOW K;  4QJV A;  3K7A K;  4OIN A;  2A6H A;  3GTL K;  4BBR C;  3GTK C;  4XSZ A;  3FKI K;  2JA5 C;  4A3M K;  5M5W K;  3S14 C;  1YNJ A;  4A3B K;  5C4J C;  4YFN A;  4A3F K;  5IP9 K;  2JA6 K;  5M3M K;  1TWH C;  1HQM A;  2PA8 D;  4Y7N K;  3GTP C;  2YU9 C;  3S17 K;  4GZY A;  3I4N K;  2JA6 C;  1TWG K;  2JA8 C;  2NVT K;  3H0G C;  3PO2 K;  2R93 C;  5IYB K;  2PA8 L;  3S1R C;  3M3Y C;  4A3D C;  5C3E K;  5FJ8 K;  4BXX K;  2Y0S D;  3CQZ C;  2E2I C;  2O5J A;  4QJV B;  1Y1V C;  3GTQ C;  4A3E K;  1YNN A;  2NVX C;  4BBS C;  2R7Z K;  3HOV C;  2CW0 A;  5FLM K;  2JA7 C;  3S16 C;  3S1M K;  3S1N K;  2NVY C;  4A93 C;  1TWA C;  2R92 C;  3S2D K;  4BBR K;  5M5Y K;  3GTK K;  3S1Q C;  2PPB A;  3S2H C;  2JA5 K;  3S1M C;  2NVQ C;  3PO3 C;  5C4J K;  3S2D C;  4JK1 A;  4OIR A;  1TWH K;  5M5X K;  2BE5 A;  5IYC K;  4Y52 C;  1Y1W C;  2YU9 K;  2WAQ D;  2O5I A;  3GTM C;  3GTP K;  4C2M K;  3HOY C;  4A3L K;  4Q4Z A;  2WB1 D;  4LK1 A;  2JA8 K;  3HOU C;  3RZD C;  3H0G K;  4XLP A;  3M3Y K;  3S1R K;  1R9T C;  4A3D K;  2R93 K;  1WCM C;  5TMC A;  4A3L C;  2WAQ L;  3CQZ K;  2E2I K;  2PMZ D;  5C44 C;  2B63 C;  2WB1 L;  1Y1V K;  4OIO A;  3GTQ K;  2NVX K;  4BBS K;  3HOZ C;  3HOV K;  2JA7 K;  1XPP A;  2VUM K;  3S16 K;  4KN4 A;  2NVY K;  2PMZ L;  1TWF C;  1TWA K;  4YFK A;  3GTJ C;  4A3K K;  4KN7 A;  2R92 K;  4A93 K;  1I3Q K;  3S1Q K;  4A3I C;  4BY1 C;  2VUM C;  3S2H K;  4X6A C;  4C3J K;  3WOD A;  2NVQ K;  4A3C C;  4A3K C;  3RZO C;  1I3Q C;  5D4D A;  1I50 K;  1IW7 A;  4Q5S A;  4AYB D;  4Y52 K;  1Y1W K;  3GTM K;  3HOY K;  4NOI A;  1I50 C;  5IYC C;  4G7H A;  3RZD K;  2E2H C;  3HOU K;  1R9T K;  4MEY A;  4AYB L;  1WCM K;  4C3I K;  2E2J C;  5C44 K;  3I4M C;  3HKZ L;  3HOZ K;  4LJZ A;  2A6E A;  1TWC C;  3GTL C;  5M3F K;  4OIQ A;  3GTJ K;  1TWF K;  4A3J C;  4X6A K;  1SMY A;  1SFO C;  4A3I K;  4BY1 K;  4KMU A;  4XSX A;  3H3V D;  3HOW C;  4A3C K;  4A3G C;  3RZO K;  2A68 A;  3EQL A;  3GTG C;  1BDF A;  1ZYR A;  3GTO K;  1I6H C;  1K83 K;  5C4X C;  2B63 K;  3PO3 K;  4LLG A;  4MQ9 A;  5IYD C;  3H3V L;  3HOX K;  3GTO C;  3DXJ A;  1K83 C;  1I6V A;  3K7A C;  4G7Z A;  2E2H K;  2A69 A; 
#chains in the Genus database with same CATH topology
 4KB2 A;  3FKI C;  3HOX C;  4OIP A;  1O28 A;  4YFX A;  3FOF A;  3AD8 C;  1EFW A;  1XZQ A;  1BS2 A;  4QIW D;  5IP7 C;  3ADA C;  1TWG C;  5IOS A;  1SFO K;  4C3H K;  5C3E C;  4A3G K;  3GTG K;  1PJ6 A;  1I6H K;  2V6S A;  4FM9 A;  1ZXO A;  1USM A;  3V4G A;  4OIN A;  2A6H A;  3GTK C;  1XXA A;  1TWH C;  1TWG A;  3S17 K;  1JVI A;  2NVX A;  3H0G C;  2PA8 L;  1UV7 A;  3CQZ C;  2E2I C;  2R92 A;  5CHP A;  1Y1V C;  1YX2 A;  4KM8 A;  2P5M A;  2W7V A;  4KC6 A;  3G4C A;  5FLM K;  3GTK A;  3L4K A;  1TWA C;  2XCO A;  4BBR K;  2JA5 K;  4KB4 A;  1PJ7 A;  5C4J K;  1XZP A;  2XCQ A;  2Y3P A;  3S2D C;  4JK1 A;  1WCM A;  1J6V A;  2RH6 A;  1VLO A;  4Y52 C;  3H0G A;  3ORE A;  4KMD A;  3HOU C;  3CQZ A;  2E2I A;  4J3N A;  3S1R K;  1Y1V A;  4KMH A;  1XXC A;  1ZBS A;  5C44 C;  4RMF A;  1YCL A;  4OIO A;  1USO A;  3HOZ C;  1L0W A;  3IPJ A;  1TWA A;  1B4A A;  4WJ4 A;  1XPP A;  1I3Q A;  1F93 A;  2PMZ L;  1TWF C;  4A3K K;  4PAB A;  4X6A C;  3NUH A;  4A3I C;  2VUM C;  4C3J K;  3TFI A;  5EGE A;  5D4D A;  1I50 K;  2ZUE A;  3BP3 A;  4AYB D;  1WOP A;  3GTM K;  2GSU A;  3HOY K;  2KWA A;  2FQO A;  3L4J A;  1R9T K;  2E2J C;  1SFO A;  1TWF A;  3T02 A;  4G0V A;  3GTG A;  2JH3 A;  1O2A A;  2GAH C;  4A3J C;  4KMA A;  4XSX A;  1K83 A;  1WOO A;  3CAG A;  5C4X C;  2B63 K;  3PO3 K;  2PHC B;  2R7Z A;  3H3V L;  3HOX K;  3GTO C;  3DXJ A;  3K7A C;  4G7Z A;  2E2H K;  3GTL C;  1G51 A;  1AB4 A;  4A3M C;  1WOS A;  2XCR B;  2V6U A;  3HKZ D;  3I4M K;  4A3B C;  5IP9 C;  5IP7 K;  4YG2 A;  5TMF A;  4Y7N C;  1TWC K;  3T00 A;  1KQ4 A;  3I4N C;  4MEX A;  3PO2 C;  1V5V A;  3S15 C;  4BXX C;  3M4O C;  3LPX A;  3JST A;  3OEP A;  3AD9 C;  4A3E C;  3GTL A;  1WSV A;  5IYD K;  5IOQ A;  1JQW A;  3S1N C;  1RU0 A;  4QJV A;  3GEH A;  1C0A A;  2JA6 A;  4O2D A;  4C45 A;  4A3F K;  1HQM A;  1DCO A;  2YU9 C;  1ISE A;  1JOE A;  1XXB A;  2NVT K;  1WIH A;  5IYB K;  3M3Y C;  4A3D C;  1J6X A;  1WSR A;  4BBS C;  2NVX C;  3HOV C;  3FHZ A;  2JA7 C;  3S16 C;  3GDZ A;  2NVY C;  4A93 C;  3S2D K;  2R92 C;  3S1Q C;  2PPB A;  2D6F C;  3S1M C;  3PO3 C;  1EH1 A;  2YU9 A;  5M5X K;  1R9T A;  2BE5 A;  3GTP K;  1EK8 A;  1Y1W C;  2WAQ D;  2O5I A;  4C2M K;  4Q4Z A;  2JA8 K;  2R93 K;  1WCM C;  5TMC A;  2WB1 L;  2JA7 A;  3SZZ A;  3GTQ K;  2NVY A;  1X31 C;  2VUM K;  5CJ9 A;  4YFK A;  3GTJ C;  3S0X A;  3N0C A;  3SZY A;  4BY1 C;  4G0U A;  3S2H K;  1WQF A;  2NVQ K;  2ZUF A;  2E2H A;  4GT9 A;  1I3Q C;  1Y1W A;  1O2F B;  4Q5S A;  3AQP A;  4M1X A;  3FOE A;  2CFA B;  2V6T A;  3RZD K;  4MEY A;  3N3Y A;  3HKZ L;  3GTJ A;  4KAS A;  4C3I C;  5M3F K;  4OIQ A;  1SFO C;  3BP8 C;  4KMU A;  4C3H C;  1O2B A;  4A3C K;  4A3G C;  3RZO K;  3TFJ A;  3GTG C;  3GTO K;  1ZYR A;  1I6H C;  4GTL A;  2ZFZ A;  1VRQ C;  1K83 C;  5IYC K;  1INN A;  1VJE A;  4G7O A;  2R7Z C;  4GTE A;  3BUE A;  3N0B A;  3GSI A;  3S17 C;  4ZH4 A;  3S15 K;  3M4O K;  4BY7 C;  4GFQ A;  5JVO A;  4BLB A;  1O29 A;  4QIW L;  1GE9 A;  5FLM C;  3HOW K;  4LOW A;  5HL8 A;  4BBR C;  3FKI K;  2JA5 C;  3S14 C;  1XZQ B;  1YNJ A;  5C4J C;  3OPF A;  1IL2 A;  5M3M K;  1PJ5 A;  2PA8 D;  1ZVU A;  4GZY A;  4BLA A;  2JA6 C;  1TWG K;  3GTQ A;  4PAA A;  3A8J A;  3S1R C;  5C3E K;  5FJ8 K;  2O5J A;  2Y0S D;  4GTC A;  2CW0 A;  3S1M K;  2JA5 A;  3GTK K;  4C3J C;  4LQY A;  1TWH K;  3Q3Q A;  4G0W A;  3A8K A;  3GTM C;  4LR2 A;  3HOY C;  3QX3 A;  3H0G K;  1R9T C;  1IQ0 A;  5E68 A;  4A3L C;  3CQZ K;  2E2I K;  4KDD A;  2PMZ D;  2GAG C;  2EBB A;  1Y1V K;  1DD5 A;  4GTF A;  1O24 A;  1XZP B;  1TWA K;  1I3Q K;  1I50 A;  3WOD A;  1WQH A;  3GTM A;  1O26 A;  3AD7 C;  4Y52 K;  4NOI A;  3HOU K;  2E2H C;  5EGH A;  4GTA A;  4AYB L;  1J6W A;  4C3I K;  3I4M C;  5C44 K;  5TJ3 A;  3HOZ K;  1O25 A;  1TWC C;  1TWF K;  4KAT A;  4X6A K;  3TFH A;  4A3I K;  3H3V D;  2B63 A;  3EQL A;  1BDF A;  3FKI A;  1K83 K;  5IOR A;  5IYD C;  4GTB A;  1HI9 A;  2R7Z K;  3AH5 A;  1IS1 A;  5L46 A;  3LAJ A;  5IOT A;  2E2J K;  4A3F C;  1J98 A;  1TWC A;  4BY7 K;  3GEI A;  4KAW X;  3T01 A;  4XLN A;  4A3J K;  2NVT C;  5IYB C;  3GIR A;  1F7U A;  4KAR A;  2Y0S L;  1WOR A;  5C4X K;  4LK0 A;  3G4A A;  3S14 K;  1TWH A;  3K7A K;  3GTL K;  1O27 A;  2P8T A;  4XSZ A;  4A3M K;  5M5W K;  4A3B K;  4YFN A;  5IP9 K;  2JA6 K;  2RGR A;  4Y7N K;  1EI6 A;  4AH6 A;  3GTP C;  4C2M C;  3I4N K;  2JA8 C;  1IBA A;  4GTD A;  3PO2 K;  2R93 C;  4BXX K;  4QJV B;  3GTQ C;  4A3E K;  1YNN A;  3LAP A;  3S1N K;  5M5Y K;  3S2H C;  2NVQ C;  3MML B;  1VGX A;  3GTP A;  4OIR A;  4DDQ A;  2YU9 K;  1WQG A;  4A3L K;  1BGW A;  2WB1 D;  4LK1 A;  2R93 A;  3RZD C;  3AQO A;  4XLP A;  3M3Y K;  4A3D K;  4WIL A;  2WAQ L;  2CFA A;  1B4B A;  4ILD A;  2VUM A;  4BBS K;  2NVX K;  3HOV K;  3GEE A;  4P5B A;  1F7V A;  2JA7 K;  3S16 K;  1F9N A;  4KN4 A;  2NVY K;  4A93 K;  4FZB A;  2R92 K;  4KN7 A;  3S1Q K;  4A3C C;  1EQR A;  4A3K C;  3RZO C;  3HXA A;  4KM9 A;  1IW7 A;  2GSN A;  1Y1W K;  2GSO A;  4XCH A;  1I50 C;  1BJT A;  5IYC C;  4G7H A;  4BKW A;  1WCM K;  4P9S A;  5JFE A;  3TTG A;  4P5A A;  3VA7 A;  3ERE D;  1DCH A;  4LJZ A;  2A6E A;  1ZQ1 C;  3GTJ K;  1SMY A;  1VH2 A;  4BY1 K;  1IE0 A;  3GTO A;  3A8I A;  2FQT A;  1DCP A;  2A68 A;  4WJ3 M;  4LLG A;  4MQ9 A;  3HOW C;  1I6V A;  2B63 C;  2A69 A; 
#chains in the Genus database with same CATH homology
 3FKI C;  3HOX C;  4A3M C;  4OIP A;  4G7O A;  2R7Z C;  3I4M K;  3HKZ D;  2E2J K;  4YFX A;  4A3B C;  4A3F C;  5IP9 C;  5IP7 K;  4BY7 K;  4YG2 A;  5TMF A;  4Y7N C;  1TWC K;  3S17 C;  4QIW D;  4ZH4 A;  4XLN A;  3S15 K;  3I4N C;  5IP7 C;  1TWG C;  3M4O K;  4A3J K;  4BY7 C;  1SFO K;  2NVT C;  4MEX A;  3PO2 C;  4C3H K;  5IYB C;  3S15 C;  5C3E C;  4A3G K;  4BXX C;  3M4O C;  4QIW L;  3GTG K;  1I6H K;  2Y0S L;  5C4X K;  4LK0 A;  4A3E C;  5IYD K;  5FLM C;  3S14 K;  3S1N C;  3HOW K;  4QJV A;  3K7A K;  4OIN A;  2A6H A;  3GTL K;  4BBR C;  3GTK C;  4XSZ A;  3FKI K;  2JA5 C;  4A3M K;  5M5W K;  3S14 C;  1YNJ A;  4A3B K;  5C4J C;  4YFN A;  4A3F K;  5IP9 K;  2JA6 K;  5M3M K;  1TWH C;  1HQM A;  2PA8 D;  4Y7N K;  3GTP C;  2YU9 C;  3S17 K;  4GZY A;  3I4N K;  2JA6 C;  1TWG K;  2JA8 C;  2NVT K;  3H0G C;  3PO2 K;  2R93 C;  5IYB K;  2PA8 L;  3S1R C;  3M3Y C;  4A3D C;  5C3E K;  5FJ8 K;  4BXX K;  2Y0S D;  3CQZ C;  2E2I C;  2O5J A;  4QJV B;  1Y1V C;  3GTQ C;  4A3E K;  1YNN A;  2NVX C;  4BBS C;  2R7Z K;  3HOV C;  2CW0 A;  5FLM K;  2JA7 C;  3S16 C;  3S1M K;  3S1N K;  2NVY C;  4A93 C;  1TWA C;  2R92 C;  3S2D K;  4BBR K;  5M5Y K;  3GTK K;  3S1Q C;  2PPB A;  3S2H C;  2JA5 K;  3S1M C;  2NVQ C;  3PO3 C;  5C4J K;  3S2D C;  4JK1 A;  4OIR A;  1TWH K;  5M5X K;  2BE5 A;  5IYC K;  4Y52 C;  1Y1W C;  2YU9 K;  2WAQ D;  2O5I A;  3GTM C;  3GTP K;  4C2M K;  3HOY C;  4A3L K;  4Q4Z A;  2WB1 D;  4LK1 A;  2JA8 K;  3HOU C;  3RZD C;  3H0G K;  4XLP A;  3M3Y K;  3S1R K;  1R9T C;  4A3D K;  2R93 K;  1WCM C;  5TMC A;  4A3L C;  2WAQ L;  3CQZ K;  2E2I K;  2PMZ D;  5C44 C;  2B63 C;  2WB1 L;  1Y1V K;  4OIO A;  3GTQ K;  2NVX K;  4BBS K;  3HOZ C;  3HOV K;  2JA7 K;  1XPP A;  2VUM K;  3S16 K;  4KN4 A;  2NVY K;  2PMZ L;  1TWF C;  1TWA K;  4YFK A;  3GTJ C;  4A3K K;  4KN7 A;  2R92 K;  4A93 K;  1I3Q K;  3S1Q K;  4A3I C;  4BY1 C;  2VUM C;  3S2H K;  4X6A C;  4C3J K;  3WOD A;  2NVQ K;  4A3C C;  4A3K C;  3RZO C;  1I3Q C;  5D4D A;  1I50 K;  1IW7 A;  4Q5S A;  4AYB D;  4Y52 K;  1Y1W K;  3GTM K;  3HOY K;  4NOI A;  1I50 C;  5IYC C;  4G7H A;  3RZD K;  2E2H C;  3HOU K;  1R9T K;  4MEY A;  4AYB L;  1WCM K;  4C3I K;  2E2J C;  5C44 K;  3I4M C;  3HKZ L;  3HOZ K;  4LJZ A;  2A6E A;  1TWC C;  3GTL C;  5M3F K;  4OIQ A;  3GTJ K;  1TWF K;  4A3J C;  4X6A K;  1SMY A;  1SFO C;  4A3I K;  4BY1 K;  4KMU A;  4XSX A;  3H3V D;  3HOW C;  4A3C K;  4A3G C;  3RZO K;  2A68 A;  3EQL A;  3GTG C;  1BDF A;  1ZYR A;  3GTO K;  1I6H C;  1K83 K;  5C4X C;  2B63 K;  3PO3 K;  4LLG A;  4MQ9 A;  5IYD C;  3H3V L;  3HOX K;  3GTO C;  3DXJ A;  1K83 C;  1I6V A;  3K7A C;  4G7Z A;  2E2H K;  2A69 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...