1Y1WK

Complete rna polymerase ii elongation complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complete RNA Polymerase II Elongation Complex Structure and Its Interactions with NTP and TFIIS
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
molecule keywords 5'-D(P*AP*GP*TP*AP*CP*TP*TP*AP*CP*GP*CP*CP*TP*GP*GP*TP*CP*AP
total genus 28
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2004-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1y1wK00
3GTLC 2NVQC 2R93K 5IYDK 1SFOC 3S1NK 1R9TK 2WAQL 4C2MK 4C3IK 5M5XK 4G7OA 2Y0SD 4MQ9A 2R7ZK 3HOUC 1I50K 3S17C 2NVXC 1Y1WK 3S16C 3HOWK 3S1MK 4A3IK 1YNNA 5C3EC 5TMFA 4OIOA 4Y52C 2A6HA 5C4JC 4OIPA 2B63C 4BY7K 3HOZC 3HOYC 1TWAK 4BXXC 2PMZL 4ZH4A 3S2HK 4A3LK 1Y1VC 4A3FC 4A3BC 4KMUA 2JA8K 5IP7C 3GTKK 4X6AK 1YNJA 5C3EK 4Q5SA 2PA8L 4BBRC 3S16K 3S1MC 3CQZK 2NVXK 3PO3C 1WCMK 4A3DC 3FKIK 4XLNA 3WODA 2YU9C 2O5IA 3S1RK 4YFNA 1TWAC 1SMYA 2JA6C 3S14C 1SFOK 3S1NC 5TMCA 5IYBC 3GTJK 2NVQK 5FLMC 3GTKC 3K7AK 2R92C 1Y1WC 2A6EA 4A3FK 4A3BK 2JA7C 3HOUK 3HOXC 1TWCC 4A3DK 4A3KK 3RZOC 4BY7C 3CQZC 3PO3K 4BBSK 2Y0SL 5C4JK 4A3GC 4OINA 2NVYC 4A3JK 3I4NK 3GTQK 2PMZD 3RZDK 5IP9K 2VUMK 3GTMC 1I6HK 1ZYRA 3HKZD 4BY1C 3S2HC 4BY1K 2NVTC 2WB1D 2E2IK 5C4XK 3S2DC 4A93C 5IYCC 5C44C 1K83C 3GTLK 3S15C 4Y52K 4OIRA 4QIWL 4A3IC 3RZOK 4BBSC 3HOVK 4C3JK 2WAQD 4A3MC 4Y7NK 3GTPK 4QJVB 3PO2K 1I6VA 1TWFK 1TWGK 3I4MK 4Y7NC 3PO2C 1I6HC 3H3VL 3GTMK 1R9TC 3K7AC 1HQMA 2PPBA 3EQLA 2A69A 2E2JK 1XPPA 5C44K 3S2DK 4A3KC 4G7ZA 3H0GC 1TWCK 2E2IC 3HOXK 4YFKA 4JK1A 2WB1L 3FKIC 3M3YC 1BDFA 1WCMC 5FJ8K 2JA5C 5M5YK 3M4OK 3RZDC 5M3FK 3S1QC 4A3CC 5FLMK 2NVYK 4A3JC 4A3CK 1I3QK 3I4NC 5IYBK 3GTJC 1Y1VK 2A68A 5M3MK 2E2HK 4A3EC 4LK0A 4A3EK 2NVTK 4LK1A 2E2HC 3H0GK 2PA8D 4QJVA 4MEYA 2B63K 2BE5A 4BBRK 4YG2A 4MEXA 3GTGK 3GTGC 4NOIA 3S1QK 4A3GK 4XSXA 4YFXA 4A3LC 4C3HK 1TWGC 4G7HA 3I4MC 2CW0A 2R7ZC 4BXXK 4KN7A 4GZYA 2JA7K 2R92K 1K83K 4OIQA 4A93K 2O5JA 4LJZA 1IW7A 3HOWC 3GTOK 2JA5K 3M4OC 2JA6K 3S14K 1TWFC 3S1RC 4AYBD 4Q4ZA 2YU9K 4QIWD 5D4DA 3HOVC 5IP9C 2VUMC 3HOYK 3GTQC 1TWHK 5M5WK 2R93C 2E2JC 1I3QC 1TWHC 4X6AC 5IYCK 3S15K 5IP7K 5C4XC 4KN4A 2JA8C 3S17K 1I50C 4LLGA 4XLPA 3H3VD 3M3YK 4A3MK 3GTPC 3GTOC 3DXJA 4AYBL 3HOZK 4XSZA 3HKZL 5IYDC
chains in the Genus database with same CATH superfamily
1J98A 2R93K 1SFOC 3QX3A 1XZQA 3HOUC 3S17C 3HOWK 3NUHA 4KMHA 1YNNA 5TMFA 4GTDA 2B63C 4GTCA 3HOYC 3L4KA 2RH6A 4P5BA 2PHCB 4ZH4A 1Y1WA 2JA8K 2XCOA 3N0CA 4PAAA 4Q5SA 3TFHA 1WCMK 3WODA 4FM9A 4YFNA 3S14C 4J3NA 1SFOK 1DCOA 1WOSA 3GTJK 2V6SA 4KB4A 2NVXA 1Y1WC 2A6EA 3HOXC 3FKIA 1O2AA 1ZXOA 4ILDA 1JOEA 5C4JK 2NVYC 4A3JK 3I4NK 1AB4A 4BY1C 4GTEA 4KMAA 3S2DC 5IYCC 3A8KA 4KARA 4KM9A 4QIWL 4A3IC 3RZOK 4BBSC 4C3JK 1J6VA 1XXCA 1TWFK 1I6VA 5EGEA 4Y7NC 2P8TA 3SZYA 1F7VA 1R9TC 1VGXA 2PPBA 5C44K 4G7ZA 3H0GC 4BLAA 1DD5A 2ZFZA 4JK1A 3FKIC 3N0BA 3RZDC 4GTLA 4A3CC 5FLMK 3AD7C 1I3QK 3GTJC 1HI9A 4YG2A 3GTGC 3GEEA 1XZQB 2FQTA 4XSXA 4YFXA 1TWGC 2R7ZC 4BXXK 4GZYA 4GTAA 1ZVUA 4OIQA 2O5JA 2CFAA 1IW7A 2JA5K 1IQ0A 3M4OC 3S14K 3OREA 3S1RC 2YU9K 3HOVC 3GTQC 5M5WK 2R93C 2E2JC 5IYCK 3FHZA 5C4XC 1UV7A 3HXAA 1WQFA 3H3VD 4A3MK 3GTPC 1KQ4A 3HKZL 3ADAC 2EBBA 2NVQC 3S1NK 1L0WA 4G7OA 2NVXC 1IL2A 3S16C 1DCPA 4A3IK 5CHPA 1RU0A 3HOZC 3CQZA 1PJ5A 4BLBA 4A3LK 4A3FC 5IP7C 4X6AK 1WQHA 1YNJA 3S16K 1TWAA 2NVXK 4A3DC 3FKIK 1EFWA 1F7UA 2O5IA 1XXAA 1SMYA 1WOPA 3VA7A 3S1NC 5TMCA 1EK8A 4A3FK 3BP3A 4KMDA 3GTKA 3A8JA 1TWCC 3GEHA 3CQZC 4OINA 4KATA 4GT9A 2W7VA 3AH5A 2NVTC 4C3IC 1IS1A 2XCQA 2XCRB 5IOTA 1ISEA 2JA7A 4A3MC 3GTPK 4Y7NK 4QJVB 1TWGK 3PO2C 1I6HC 3K7AC 3JSTA 2ZUEA 1XPPA 4C45A 2GAHC 3S2DK 2B63A 1TWCK 1USMA 4GTFA 1TWFA 2WB1L 1BDFA 5FJ8K 5M5YK 2NVYK 3LAJA 4A3JC 3I4NC 1ZBSA 4KASA 5M3MK 2E2HK 4LK0A 1PJ7A 3H0GK 4G0UA 3GTOA 5CJ9A 5TJ3A 4MEYA 2B63K 4FZBA 5JVOA 3GTGK 4PABA 1TWHA 4A3LC 1IE0A 4G7HA 3I4MC 5JFEA 5EGHA 3GEIA 3MMLB 1WIHA 4KN7A 3V4GA 1F93A 2Y3PA 4C2MC 3T00A 1K83K 4A93K 1X31C 5IP9C 2VUMC 3S0XA 5IOQA 1TWHK 4KB2A 4X6AC 4WJ4A 3TFJA 5IP7K 4GTBA 3S17K 3M3YK 1ZQ1C 1XZPB 4AYBL 1O28A 5IYDC 5IYDK 2GSNA 4KC6A 4C2MK 2GSOA 4MQ9A 1WCMA 3S1MK 2V6UA 4Y52C 2A6HA 1YX2A 5C4JC 4BY7K 1TWAK 2R7ZA 4BXXC 1Y1VC 1O29A 2PA8L 3S1MC 3CQZK 3IPJA 4DDQA 4XLNA 1B4BA 2YU9C 3S1RK 1VJEA 1YCLA 2JA6C 5FLMC 3K7AK 2R92C 3AD9C 3LAPA 4A3DK 4A3KK 4BY7C 3PO3K 2E2IA 2Y0SL 2PMZD 5IP9K 3L4JA 2VUMK 3HKZD 3S2HC 4BKWA 5C4XK 4A93C 3S15C 1K83C 4LOWA 4M1XA 1EI6A 2D6FC 1O25A 3HOVK 2WAQD 3PO2K 3I4MK 3G4CA 3H3VL 2JA6A 4KDDA 2NVYA 1HQMA 1VLOA 3EQLA 3GDZA 4RMFA 4G0VA 2P5MA 1WQGA 4A3KC 2E2IC 3Q3QA 1J6XA 3HOXK 3BP8C 4YFKA 3GTMA 5L46A 1TWGA 4O2DA 1O2FB 1J6WA 1DCHA 4LQYA 3GTLA 1TWCA 4LK1A 2V6TA 1R9TA 2VUMA 1I50A 1JQWA 3G4AA 2FQOA 3N3YA 1BJTA 1C0AA 4C3HK 3T02A 2ZUFA 3H0GA 2R92K 1WSVA 5IOSA 3BUEA 4LJZA 3HOWC 2JA6K 1TWFC 1BS2A 1WOOA 3CAGA 1PJ6A 4WILA 1K83A 1I3QC 3FOFA 3S15K 1XXBA 2GAGC 2JA8C 1I50C 4LLGA 1WSRA 4XLPA 2R92A 1IBAA 3AQOA 1WORA 3GTLK 1VRQC 3GTLC 1R9TK 2WAQL 4C3IK 5M5XK 2Y0SD 2R7ZK 1I50K 1Y1WK 5C3EC 1VH2A 4G0WA 4OIOA 4OIPA 1INNA 2PMZL 1USOA 3S2HK 4A3BC 3TTGA 4KMUA 3GTKK 5C3EK 1B4AA 4AH6A 2KWAA 4BBRC 1GE9A 3PO3C 3GTQA 1TWAC 4C3HC 4KM8A 2NVQK 5IYBC 1JVIA 3FOEA 3GTKC 4A3BK 3T01A 3OEPA 2JA7C 3HOUK 4XCHA 1O2BA 3A8IA 3RZOC 4BBSK 1SFOA 4A3GC 3GTJA 3OPFA 3GTQK 3GTMC 3RZDK 3GTGA 1I6HK 1ZYRA 4BY1K 2WB1D 2E2IK 5C44C 1O27A 2GSUA 5E68A 4OIRA 4Y52K 4WJ3M 3AQPA 4LR2A 3SZZA 3GIRA 1EQRA 2RGRA 3GTMK 2E2HA 2CFAB 3TFIA 2A69A 2E2JK 1EH1A 1I3QA 3M3YC 1WCMC 2JA5C 3M4OK 5M3FK 4GFQA 5IORA 3S1QC 3GTPA 4A3CK 3AD8C 5IYBK 2JH3A 1Y1VK 2A68A 4A3EC 2NVTK 4A3EK 2E2HC 1BGWA 4P5AA 2PA8D 4QJVA 1F9NA 2BE5A 4BBRK 1G51A 4MEXA 4NOIA 1V5VA 3S1QK 4A3GK 2JA5A 3GSIA 2YU9A 1XZPA 2CW0A 3ERED 2JA7K 5HL8A 3GTOK 3LPXA 2R93A 4AYBD 4P9SA 4Q4ZA 1O24A 4QIWD 5D4DA 3HOYK 1O26A 1TWHC 4KN4A 4C3JC 3GTOC 4KAWX 3DXJA 3HOZK 4XSZA 1Y1VA
chains in the Genus database with same CATH topology
3GTLC 2NVQC 2R93K 5IYDK 1SFOC 3S1NK 1R9TK 2WAQL 4C2MK 4C3IK 5M5XK 4G7OA 2Y0SD 4MQ9A 2R7ZK 3HOUC 1I50K 3S17C 2NVXC 1Y1WK 3S16C 3HOWK 3S1MK 4A3IK 1YNNA 5C3EC 5TMFA 4OIOA 4Y52C 2A6HA 5C4JC 4OIPA 2B63C 4BY7K 3HOZC 3HOYC 1TWAK 4BXXC 2PMZL 4ZH4A 3S2HK 4A3LK 1Y1VC 4A3FC 4A3BC 4KMUA 2JA8K 5IP7C 3GTKK 4X6AK 1YNJA 5C3EK 4Q5SA 2PA8L 4BBRC 3S16K 3S1MC 3CQZK 2NVXK 3PO3C 1WCMK 4A3DC 3FKIK 4XLNA 3WODA 2YU9C 2O5IA 3S1RK 4YFNA 1TWAC 1SMYA 2JA6C 3S14C 1SFOK 3S1NC 5TMCA 5IYBC 3GTJK 2NVQK 5FLMC 3GTKC 3K7AK 2R92C 1Y1WC 2A6EA 4A3FK 4A3BK 2JA7C 3HOUK 3HOXC 1TWCC 4A3DK 4A3KK 3RZOC 4BY7C 3CQZC 3PO3K 4BBSK 2Y0SL 5C4JK 4A3GC 4OINA 2NVYC 4A3JK 3I4NK 3GTQK 2PMZD 3RZDK 5IP9K 2VUMK 3GTMC 1I6HK 1ZYRA 3HKZD 4BY1C 3S2HC 4BY1K 2NVTC 2WB1D 2E2IK 5C4XK 3S2DC 4A93C 5IYCC 5C44C 1K83C 3GTLK 3S15C 4Y52K 4OIRA 4QIWL 4A3IC 3RZOK 4BBSC 3HOVK 4C3JK 2WAQD 4A3MC 4Y7NK 3GTPK 4QJVB 3PO2K 1I6VA 1TWFK 1TWGK 3I4MK 4Y7NC 3PO2C 1I6HC 3H3VL 3GTMK 1R9TC 3K7AC 1HQMA 2PPBA 3EQLA 2A69A 2E2JK 1XPPA 5C44K 3S2DK 4A3KC 4G7ZA 3H0GC 1TWCK 2E2IC 3HOXK 4YFKA 4JK1A 2WB1L 3FKIC 3M3YC 1BDFA 1WCMC 5FJ8K 2JA5C 5M5YK 3M4OK 3RZDC 5M3FK 3S1QC 4A3CC 5FLMK 2NVYK 4A3JC 4A3CK 1I3QK 3I4NC 5IYBK 3GTJC 1Y1VK 2A68A 5M3MK 2E2HK 4A3EC 4LK0A 4A3EK 2NVTK 4LK1A 2E2HC 3H0GK 2PA8D 4QJVA 4MEYA 2B63K 2BE5A 4BBRK 4YG2A 4MEXA 3GTGK 3GTGC 4NOIA 3S1QK 4A3GK 4XSXA 4YFXA 4A3LC 4C3HK 1TWGC 4G7HA 3I4MC 2CW0A 2R7ZC 4BXXK 4KN7A 4GZYA 2JA7K 2R92K 1K83K 4OIQA 4A93K 2O5JA 4LJZA 1IW7A 3HOWC 3GTOK 2JA5K 3M4OC 2JA6K 3S14K 1TWFC 3S1RC 4AYBD 4Q4ZA 2YU9K 4QIWD 5D4DA 3HOVC 5IP9C 2VUMC 3HOYK 3GTQC 1TWHK 5M5WK 2R93C 2E2JC 1I3QC 1TWHC 4X6AC 5IYCK 3S15K 5IP7K 5C4XC 4KN4A 2JA8C 3S17K 1I50C 4LLGA 4XLPA 3H3VD 3M3YK 4A3MK 3GTPC 3GTOC 3DXJA 4AYBL 3HOZK 4XSZA 3HKZL 5IYDC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTL C;  2NVQ C;  2R93 K;  5IYD K;  1SFO C;  3S1N K;  1R9T K;  2WAQ L;  4C2M K;  4C3I K;  5M5X K;  4G7O A;  2Y0S D;  4MQ9 A;  2R7Z K;  3HOU C;  1I50 K;  3S17 C;  2NVX C;  1Y1W K;  3S16 C;  3HOW K;  3S1M K;  4A3I K;  1YNN A;  5C3E C;  5TMF A;  4OIO A;  4Y52 C;  2A6H A;  5C4J C;  4OIP A;  2B63 C;  4BY7 K;  3HOZ C;  3HOY C;  1TWA K;  4BXX C;  2PMZ L;  4ZH4 A;  3S2H K;  4A3L K;  1Y1V C;  4A3F C;  4A3B C;  4KMU A;  2JA8 K;  5IP7 C;  3GTK K;  4X6A K;  1YNJ A;  5C3E K;  4Q5S A;  2PA8 L;  4BBR C;  3S16 K;  3S1M C;  3CQZ K;  2NVX K;  3PO3 C;  1WCM K;  4A3D C;  3FKI K;  4XLN A;  3WOD A;  2YU9 C;  2O5I A;  3S1R K;  4YFN A;  1TWA C;  1SMY A;  2JA6 C;  3S14 C;  1SFO K;  3S1N C;  5TMC A;  5IYB C;  3GTJ K;  2NVQ K;  5FLM C;  3GTK C;  3K7A K;  2R92 C;  1Y1W C;  2A6E A;  4A3F K;  4A3B K;  2JA7 C;  3HOU K;  3HOX C;  1TWC C;  4A3D K;  4A3K K;  3RZO C;  4BY7 C;  3CQZ C;  3PO3 K;  4BBS K;  2Y0S L;  5C4J K;  4A3G C;  4OIN A;  2NVY C;  4A3J K;  3I4N K;  3GTQ K;  2PMZ D;  3RZD K;  5IP9 K;  2VUM K;  3GTM C;  1I6H K;  1ZYR A;  3HKZ D;  4BY1 C;  3S2H C;  4BY1 K;  2NVT C;  2WB1 D;  2E2I K;  5C4X K;  3S2D C;  4A93 C;  5IYC C;  5C44 C;  1K83 C;  3GTL K;  3S15 C;  4Y52 K;  4OIR A;  4QIW L;  4A3I C;  3RZO K;  4BBS C;  3HOV K;  4C3J K;  2WAQ D;  4A3M C;  4Y7N K;  3GTP K;  4QJV B;  3PO2 K;  1I6V A;  1TWF K;  1TWG K;  3I4M K;  4Y7N C;  3PO2 C;  1I6H C;  3H3V L;  3GTM K;  1R9T C;  3K7A C;  1HQM A;  2PPB A;  3EQL A;  2A69 A;  2E2J K;  1XPP A;  5C44 K;  3S2D K;  4A3K C;  4G7Z A;  3H0G C;  1TWC K;  2E2I C;  3HOX K;  4YFK A;  4JK1 A;  2WB1 L;  3FKI C;  3M3Y C;  1BDF A;  1WCM C;  5FJ8 K;  2JA5 C;  5M5Y K;  3M4O K;  3RZD C;  5M3F K;  3S1Q C;  4A3C C;  5FLM K;  2NVY K;  4A3J C;  4A3C K;  1I3Q K;  3I4N C;  5IYB K;  3GTJ C;  1Y1V K;  2A68 A;  5M3M K;  2E2H K;  4A3E C;  4LK0 A;  4A3E K;  2NVT K;  4LK1 A;  2E2H C;  3H0G K;  2PA8 D;  4QJV A;  4MEY A;  2B63 K;  2BE5 A;  4BBR K;  4YG2 A;  4MEX A;  3GTG K;  3GTG C;  4NOI A;  3S1Q K;  4A3G K;  4XSX A;  4YFX A;  4A3L C;  4C3H K;  1TWG C;  4G7H A;  3I4M C;  2CW0 A;  2R7Z C;  4BXX K;  4KN7 A;  4GZY A;  2JA7 K;  2R92 K;  1K83 K;  4OIQ A;  4A93 K;  2O5J A;  4LJZ A;  1IW7 A;  3HOW C;  3GTO K;  2JA5 K;  3M4O C;  2JA6 K;  3S14 K;  1TWF C;  3S1R C;  4AYB D;  4Q4Z A;  2YU9 K;  4QIW D;  5D4D A;  3HOV C;  5IP9 C;  2VUM C;  3HOY K;  3GTQ C;  1TWH K;  5M5W K;  2R93 C;  2E2J C;  1I3Q C;  1TWH C;  4X6A C;  5IYC K;  3S15 K;  5IP7 K;  5C4X C;  4KN4 A;  2JA8 C;  3S17 K;  1I50 C;  4LLG A;  4XLP A;  3H3V D;  3M3Y K;  4A3M K;  3GTP C;  3GTO C;  3DXJ A;  4AYB L;  3HOZ K;  4XSZ A;  3HKZ L;  5IYD C; 
#chains in the Genus database with same CATH topology
 1J98 A;  2R93 K;  1SFO C;  3QX3 A;  1XZQ A;  3HOU C;  3S17 C;  3HOW K;  3NUH A;  4KMH A;  1YNN A;  5TMF A;  4GTD A;  2B63 C;  4GTC A;  3HOY C;  3L4K A;  2RH6 A;  4P5B A;  2PHC B;  4ZH4 A;  1Y1W A;  2JA8 K;  2XCO A;  3N0C A;  4PAA A;  4Q5S A;  3TFH A;  1WCM K;  3WOD A;  4FM9 A;  4YFN A;  3S14 C;  4J3N A;  1SFO K;  1DCO A;  1WOS A;  3GTJ K;  2V6S A;  4KB4 A;  2NVX A;  1Y1W C;  2A6E A;  3HOX C;  3FKI A;  1O2A A;  1ZXO A;  4ILD A;  1JOE A;  5C4J K;  2NVY C;  4A3J K;  3I4N K;  1AB4 A;  4BY1 C;  4GTE A;  4KMA A;  3S2D C;  5IYC C;  3A8K A;  4KAR A;  4KM9 A;  4QIW L;  4A3I C;  3RZO K;  4BBS C;  4C3J K;  1J6V A;  1XXC A;  1TWF K;  1I6V A;  5EGE A;  4Y7N C;  2P8T A;  3SZY A;  1F7V A;  1R9T C;  1VGX A;  2PPB A;  5C44 K;  4G7Z A;  3H0G C;  4BLA A;  1DD5 A;  2ZFZ A;  4JK1 A;  3FKI C;  3N0B A;  3RZD C;  4GTL A;  4A3C C;  5FLM K;  3AD7 C;  1I3Q K;  3GTJ C;  1HI9 A;  4YG2 A;  3GTG C;  3GEE A;  1XZQ B;  2FQT A;  4XSX A;  4YFX A;  1TWG C;  2R7Z C;  4BXX K;  4GZY A;  4GTA A;  1ZVU A;  4OIQ A;  2O5J A;  2CFA A;  1IW7 A;  2JA5 K;  1IQ0 A;  3M4O C;  3S14 K;  3ORE A;  3S1R C;  2YU9 K;  3HOV C;  3GTQ C;  5M5W K;  2R93 C;  2E2J C;  5IYC K;  3FHZ A;  5C4X C;  1UV7 A;  3HXA A;  1WQF A;  3H3V D;  4A3M K;  3GTP C;  1KQ4 A;  3HKZ L;  3ADA C;  2EBB A;  2NVQ C;  3S1N K;  1L0W A;  4G7O A;  2NVX C;  1IL2 A;  3S16 C;  1DCP A;  4A3I K;  5CHP A;  1RU0 A;  3HOZ C;  3CQZ A;  1PJ5 A;  4BLB A;  4A3L K;  4A3F C;  5IP7 C;  4X6A K;  1WQH A;  1YNJ A;  3S16 K;  1TWA A;  2NVX K;  4A3D C;  3FKI K;  1EFW A;  1F7U A;  2O5I A;  1XXA A;  1SMY A;  1WOP A;  3VA7 A;  3S1N C;  5TMC A;  1EK8 A;  4A3F K;  3BP3 A;  4KMD A;  3GTK A;  3A8J A;  1TWC C;  3GEH A;  3CQZ C;  4OIN A;  4KAT A;  4GT9 A;  2W7V A;  3AH5 A;  2NVT C;  4C3I C;  1IS1 A;  2XCQ A;  2XCR B;  5IOT A;  1ISE A;  2JA7 A;  4A3M C;  3GTP K;  4Y7N K;  4QJV B;  1TWG K;  3PO2 C;  1I6H C;  3K7A C;  3JST A;  2ZUE A;  1XPP A;  4C45 A;  2GAH C;  3S2D K;  2B63 A;  1TWC K;  1USM A;  4GTF A;  1TWF A;  2WB1 L;  1BDF A;  5FJ8 K;  5M5Y K;  2NVY K;  3LAJ A;  4A3J C;  3I4N C;  1ZBS A;  4KAS A;  5M3M K;  2E2H K;  4LK0 A;  1PJ7 A;  3H0G K;  4G0U A;  3GTO A;  5CJ9 A;  5TJ3 A;  4MEY A;  2B63 K;  4FZB A;  5JVO A;  3GTG K;  4PAB A;  1TWH A;  4A3L C;  1IE0 A;  4G7H A;  3I4M C;  5JFE A;  5EGH A;  3GEI A;  3MML B;  1WIH A;  4KN7 A;  3V4G A;  1F93 A;  2Y3P A;  4C2M C;  3T00 A;  1K83 K;  4A93 K;  1X31 C;  5IP9 C;  2VUM C;  3S0X A;  5IOQ A;  1TWH K;  4KB2 A;  4X6A C;  4WJ4 A;  3TFJ A;  5IP7 K;  4GTB A;  3S17 K;  3M3Y K;  1ZQ1 C;  1XZP B;  4AYB L;  1O28 A;  5IYD C;  5IYD K;  2GSN A;  4KC6 A;  4C2M K;  2GSO A;  4MQ9 A;  1WCM A;  3S1M K;  2V6U A;  4Y52 C;  2A6H A;  1YX2 A;  5C4J C;  4BY7 K;  1TWA K;  2R7Z A;  4BXX C;  1Y1V C;  1O29 A;  2PA8 L;  3S1M C;  3CQZ K;  3IPJ A;  4DDQ A;  4XLN A;  1B4B A;  2YU9 C;  3S1R K;  1VJE A;  1YCL A;  2JA6 C;  5FLM C;  3K7A K;  2R92 C;  3AD9 C;  3LAP A;  4A3D K;  4A3K K;  4BY7 C;  3PO3 K;  2E2I A;  2Y0S L;  2PMZ D;  5IP9 K;  3L4J A;  2VUM K;  3HKZ D;  3S2H C;  4BKW A;  5C4X K;  4A93 C;  3S15 C;  1K83 C;  4LOW A;  4M1X A;  1EI6 A;  2D6F C;  1O25 A;  3HOV K;  2WAQ D;  3PO2 K;  3I4M K;  3G4C A;  3H3V L;  2JA6 A;  4KDD A;  2NVY A;  1HQM A;  1VLO A;  3EQL A;  3GDZ A;  4RMF A;  4G0V A;  2P5M A;  1WQG A;  4A3K C;  2E2I C;  3Q3Q A;  1J6X A;  3HOX K;  3BP8 C;  4YFK A;  3GTM A;  5L46 A;  1TWG A;  4O2D A;  1O2F B;  1J6W A;  1DCH A;  4LQY A;  3GTL A;  1TWC A;  4LK1 A;  2V6T A;  1R9T A;  2VUM A;  1I50 A;  1JQW A;  3G4A A;  2FQO A;  3N3Y A;  1BJT A;  1C0A A;  4C3H K;  3T02 A;  2ZUF A;  3H0G A;  2R92 K;  1WSV A;  5IOS A;  3BUE A;  4LJZ A;  3HOW C;  2JA6 K;  1TWF C;  1BS2 A;  1WOO A;  3CAG A;  1PJ6 A;  4WIL A;  1K83 A;  1I3Q C;  3FOF A;  3S15 K;  1XXB A;  2GAG C;  2JA8 C;  1I50 C;  4LLG A;  1WSR A;  4XLP A;  2R92 A;  1IBA A;  3AQO A;  1WOR A;  3GTL K;  1VRQ C;  3GTL C;  1R9T K;  2WAQ L;  4C3I K;  5M5X K;  2Y0S D;  2R7Z K;  1I50 K;  1Y1W K;  5C3E C;  1VH2 A;  4G0W A;  4OIO A;  4OIP A;  1INN A;  2PMZ L;  1USO A;  3S2H K;  4A3B C;  3TTG A;  4KMU A;  3GTK K;  5C3E K;  1B4A A;  4AH6 A;  2KWA A;  4BBR C;  1GE9 A;  3PO3 C;  3GTQ A;  1TWA C;  4C3H C;  4KM8 A;  2NVQ K;  5IYB C;  1JVI A;  3FOE A;  3GTK C;  4A3B K;  3T01 A;  3OEP A;  2JA7 C;  3HOU K;  4XCH A;  1O2B A;  3A8I A;  3RZO C;  4BBS K;  1SFO A;  4A3G C;  3GTJ A;  3OPF A;  3GTQ K;  3GTM C;  3RZD K;  3GTG A;  1I6H K;  1ZYR A;  4BY1 K;  2WB1 D;  2E2I K;  5C44 C;  1O27 A;  2GSU A;  5E68 A;  4OIR A;  4Y52 K;  4WJ3 M;  3AQP A;  4LR2 A;  3SZZ A;  3GIR A;  1EQR A;  2RGR A;  3GTM K;  2E2H A;  2CFA B;  3TFI A;  2A69 A;  2E2J K;  1EH1 A;  1I3Q A;  3M3Y C;  1WCM C;  2JA5 C;  3M4O K;  5M3F K;  4GFQ A;  5IOR A;  3S1Q C;  3GTP A;  4A3C K;  3AD8 C;  5IYB K;  2JH3 A;  1Y1V K;  2A68 A;  4A3E C;  2NVT K;  4A3E K;  2E2H C;  1BGW A;  4P5A A;  2PA8 D;  4QJV A;  1F9N A;  2BE5 A;  4BBR K;  1G51 A;  4MEX A;  4NOI A;  1V5V A;  3S1Q K;  4A3G K;  2JA5 A;  3GSI A;  2YU9 A;  1XZP A;  2CW0 A;  3ERE D;  2JA7 K;  5HL8 A;  3GTO K;  3LPX A;  2R93 A;  4AYB D;  4P9S A;  4Q4Z A;  1O24 A;  4QIW D;  5D4D A;  3HOY K;  1O26 A;  1TWH C;  4KN4 A;  4C3J C;  3GTO C;  4KAW X;  3DXJ A;  3HOZ K;  4XSZ A;  1Y1V A; 
#chains in the Genus database with same CATH homology
 3GTL C;  2NVQ C;  2R93 K;  5IYD K;  1SFO C;  3S1N K;  1R9T K;  2WAQ L;  4C2M K;  4C3I K;  5M5X K;  4G7O A;  2Y0S D;  4MQ9 A;  2R7Z K;  3HOU C;  1I50 K;  3S17 C;  2NVX C;  1Y1W K;  3S16 C;  3HOW K;  3S1M K;  4A3I K;  1YNN A;  5C3E C;  5TMF A;  4OIO A;  4Y52 C;  2A6H A;  5C4J C;  4OIP A;  2B63 C;  4BY7 K;  3HOZ C;  3HOY C;  1TWA K;  4BXX C;  2PMZ L;  4ZH4 A;  3S2H K;  4A3L K;  1Y1V C;  4A3F C;  4A3B C;  4KMU A;  2JA8 K;  5IP7 C;  3GTK K;  4X6A K;  1YNJ A;  5C3E K;  4Q5S A;  2PA8 L;  4BBR C;  3S16 K;  3S1M C;  3CQZ K;  2NVX K;  3PO3 C;  1WCM K;  4A3D C;  3FKI K;  4XLN A;  3WOD A;  2YU9 C;  2O5I A;  3S1R K;  4YFN A;  1TWA C;  1SMY A;  2JA6 C;  3S14 C;  1SFO K;  3S1N C;  5TMC A;  5IYB C;  3GTJ K;  2NVQ K;  5FLM C;  3GTK C;  3K7A K;  2R92 C;  1Y1W C;  2A6E A;  4A3F K;  4A3B K;  2JA7 C;  3HOU K;  3HOX C;  1TWC C;  4A3D K;  4A3K K;  3RZO C;  4BY7 C;  3CQZ C;  3PO3 K;  4BBS K;  2Y0S L;  5C4J K;  4A3G C;  4OIN A;  2NVY C;  4A3J K;  3I4N K;  3GTQ K;  2PMZ D;  3RZD K;  5IP9 K;  2VUM K;  3GTM C;  1I6H K;  1ZYR A;  3HKZ D;  4BY1 C;  3S2H C;  4BY1 K;  2NVT C;  2WB1 D;  2E2I K;  5C4X K;  3S2D C;  4A93 C;  5IYC C;  5C44 C;  1K83 C;  3GTL K;  3S15 C;  4Y52 K;  4OIR A;  4QIW L;  4A3I C;  3RZO K;  4BBS C;  3HOV K;  4C3J K;  2WAQ D;  4A3M C;  4Y7N K;  3GTP K;  4QJV B;  3PO2 K;  1I6V A;  1TWF K;  1TWG K;  3I4M K;  4Y7N C;  3PO2 C;  1I6H C;  3H3V L;  3GTM K;  1R9T C;  3K7A C;  1HQM A;  2PPB A;  3EQL A;  2A69 A;  2E2J K;  1XPP A;  5C44 K;  3S2D K;  4A3K C;  4G7Z A;  3H0G C;  1TWC K;  2E2I C;  3HOX K;  4YFK A;  4JK1 A;  2WB1 L;  3FKI C;  3M3Y C;  1BDF A;  1WCM C;  5FJ8 K;  2JA5 C;  5M5Y K;  3M4O K;  3RZD C;  5M3F K;  3S1Q C;  4A3C C;  5FLM K;  2NVY K;  4A3J C;  4A3C K;  1I3Q K;  3I4N C;  5IYB K;  3GTJ C;  1Y1V K;  2A68 A;  5M3M K;  2E2H K;  4A3E C;  4LK0 A;  4A3E K;  2NVT K;  4LK1 A;  2E2H C;  3H0G K;  2PA8 D;  4QJV A;  4MEY A;  2B63 K;  2BE5 A;  4BBR K;  4YG2 A;  4MEX A;  3GTG K;  3GTG C;  4NOI A;  3S1Q K;  4A3G K;  4XSX A;  4YFX A;  4A3L C;  4C3H K;  1TWG C;  4G7H A;  3I4M C;  2CW0 A;  2R7Z C;  4BXX K;  4KN7 A;  4GZY A;  2JA7 K;  2R92 K;  1K83 K;  4OIQ A;  4A93 K;  2O5J A;  4LJZ A;  1IW7 A;  3HOW C;  3GTO K;  2JA5 K;  3M4O C;  2JA6 K;  3S14 K;  1TWF C;  3S1R C;  4AYB D;  4Q4Z A;  2YU9 K;  4QIW D;  5D4D A;  3HOV C;  5IP9 C;  2VUM C;  3HOY K;  3GTQ C;  1TWH K;  5M5W K;  2R93 C;  2E2J C;  1I3Q C;  1TWH C;  4X6A C;  5IYC K;  3S15 K;  5IP7 K;  5C4X C;  4KN4 A;  2JA8 C;  3S17 K;  1I50 C;  4LLG A;  4XLP A;  3H3V D;  3M3Y K;  4A3M K;  3GTP C;  3GTO C;  3DXJ A;  4AYB L;  3HOZ K;  4XSZ A;  3HKZ L;  5IYD C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...