1Y1ZA

Crystal structure of the nr1 ligand binding core in complex with acbc
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
287
structure length
282
Chain Sequence
RLKIVTIHQEPFVYVKPTMSDGTCKEEFTVNGDPVKKVICTGPNSPRHTVPQCCYGFCIDLLIKLARTMNFTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKGTRITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSHENGFMEDLDKTWVRYQECD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of Partial Agonist Action at the NR1 Subunit of NMDA Receptors.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Ligand binding protein
molecule keywords Glutamate [NMDA] receptor subunit zeta 1
total genus 84
structure length 282
sequence length 287
ec nomenclature
pdb deposition date 2004-11-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1y1zA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1y1zA02
3TUSA 3GLBA 2NXOA 4NF8A 3USDA 1UTHB 3KN8A 5HPQA 1MH3A 3V8XB 2I0BA 1ELJA 1N0TA 4BDMA 4YMAA 2VD2A 2XXHA 3C34A 4P0GA 5AA1A 1LSTA 4M4GA 4F3BA 4XKPA 5I2KA 1Y9UA 4R2BA 2Y7WA 5EYFA 1ZU0A 2AL4A 1MXYA 5ELVA 3KG2A 4G68C 3H6WA 3TELA 1B40A 4F31B 5CBSA 5JEIA 4HCWA 3T9UA 3FJMA 4IO2A 3TEPA 5DVIA 1AH5A 2HZKA 4WEPA 3Q26A 1Y4CA 4XKNA 1ZTYA 3C35A 2RKMA 4GLIA 1AMFA 1P1WA 5AA2B 3FZVA 4ND9A 2XD3A 3K1NA 4QF9A 5M2VA 1B5HA 1NFTA 2ZYMA 4LQ5A 4H5GA 4GWOA 3LUYA 3E3KA 1UTHA 2I3WA 2QPQA 2XXIA 1XVYA 2RC8A 3MVZA 4OYVA 1IIWA 4F19A 4GL8A 3U93A 1B3LA 1TFDA 2ZYKA 1SYHA 4ZE8A 2HEUA 5AE4A 1KWHA 4H0WA 2NWJA 3VVEA 1OLCA 4U1ZA 1JNFA 1DSNA 4H1XA 3TTKA 3DLNA 3HCQA 4OMBA 1MDQA 1H45A 1NNTA 2FNCA 5AA4A 2DXRA 3EHSA 5CMKA 3T9XB 2H5YA 1QKBA 1PB8A 1NNKA 1PC3A 4DXCA 3HSTA 2O69A 1M5CA 2OLBA 4LVQA 3SEXA 2F7CA 2ONRA 3UA8A 4OFOA 1IZ1A 2H99A 4NF4B 1QUIA 3TCFA 3W9WA 1FTMA 3ZKLA 1LB8A 2IEEA 4PFWA 1SD3A 1Y1ZA 4MFIA 3V83A 3TFLA 1OVTA 4G2ZA 2A5TB 4RY1A 3DELB 4LONB 3ZKKA 1JETA 2Z8FA 3MVXA 4BDLA 5B7DA 2Z23A 1Y4TA 2F35A 4I8CA 3IB1A 4I1DA 3OENA 3FVNA 2GH9A 4R73A 1B3EA 1H44A 2OJTA 1B5JA 1VFEA 3UK4A 3FXRA 1GVCA 1MQJA 2HXWA 3OELA 1MDP1 3K6XA 3QSLA 3PUZE 3GBAA 4JB7A 1B3HA 3AXFA 1EZPA 1QUJA 1F9BA 2HAUA 1AOVA 4ESWA 2PYYA 3S9EA 3C32A 3K6UA 3HO7A 3PPPA 4RXLA 3T9VA 2F6PA 5I56B 3TCHA 3PPNA 5TP9A 1ANFA 1PB9A 3KSXA 4G77A 1SDXA 1VR5A 4PFUA 1CE2A 2PT2A 4JSDA 2A5TA 3K00A 4KCDA 2GFEA 1UIUA 2P2AA 4KQPA 1XVXA 4FE8A 2QMXA 3H03A 3E4RA 5F7VA 3OEKA 2Q2CA 2V25A 5DTBA 3LSXA 3U72A 4AQ4A 3IJOB 3KOSA 1GGGA 5I58B 3LR1A 1M5EA 1Y3PA 1IUDA 1POY1 4G8NA 5DVJA 3C36A 5FHOA 4F1UA 2O84X 3M3KA 2Z8DA 3L6HA 2AYSA 4G8HA 1HSJA 1P1OA 1DPEA 4ZS9A 3B7DA 4FEDA 2CZLA 2XXRA 2Y7IA 3FASA 3S9LC 1MH4A 1MY2A 1RYXA 1Q1KA 4P11A 2CMOA 4XKRA 3OO9A 3TTRA 4YICA 2ONKE 4F2OA 1NH7A 2PBWA 2QS1A 3K6VA 4P0IA 1MQGA 1SQYA 1ZMGA 4FEBA 4EF1A 3EHUA 4N6PA 1US5A 3MUQA 4C0RA 3G3HA 5H8FA 4TQUQ 2X7PA 4GRKA 4H67A 1JVYA 1B9JA 2DXYA 2DWHA 2DP8A 4O3AA 1II5A 3OO6A 3IB0A 3EQ1A 4KYSA 4YAHX 1M5DA 1O63A 1NMUA 3O97A 1Z7ME 4WKMA 2ZXTA 5K2XA 3I5OA 2XXUA 4GD5A 3O6IA 1MM6A 3JYRA 2DS9A 3S9NC 1N3WA 3T66A 2D3IA 3QUJA 2DWJA 3SEYA 1FQAA 2ONSA 3CFZA 3CVGA 3O66A 1IITA 4X48A 3THIA 2R9JA 3MVWA 1DTZA 4Q30B 3MZ1A 4F1VA 4YU0A 4DLDA 3BFUA 5I57B 2ALUA 1LAHE 3VDFA 2H98A 1MG1A 1OIBA 2RCBA 3CFXA 5H8QA 1HSEA 3LSWA 3IL1B 2UVGA 3QK6A 2F7BA 3RNNA 2HFBA 3OSQA 1QULA 4H6DA 1N7XA 2ESNA 4LP2B 1FQFA 1XC1A 2OWSA 2O7IA 3PD8A 3D4CA 4RJZA 4EQ9A 5I58A 1BTJA 3A09A 2I58A 5JK4A 4R9FA 3G3JA 3CG3A 3FJ7A 4R6HA 3HN0A 2IA4A 3E13X 3FXQA 4ZDMA 3RTFB 4YMBA 1M5BA 2P1SA 2F7AA 1Y3QA 5TPAB 4FORA 4JSOA 4Q0CA 2Q8JA 3CIJA 1MQDA 4I62A 4YB6A 3ILTB 3MQ9A 5DEXB 3IOWA 1P1UA 2Y7KA 1NNFA 3UN6A 3SEWA 3U94A 2PVUA 3N6UA 3KJTA 5HBCA 1A54A 1LCFA 3A3CA 3MP6A 1I6BA 1FCKA 1N7WA 4IO7A 5ISUA 1B6HA 1BIYA 2A5SA 3D4GA 3PUWE 2NVUB 3VLVA 1O64A 4Z0IA 2D5WA 4IGTA 4OEVA 1CB6A 5AA3A 1XHYA 4PQJA 3PU5A 2QS4A 3I3VA 1DOTA 1N04A 2XXPA 4OEUA 1B4HA 1TXFA 4YKKA 3IOUA 3DP6A 1ATGA 2OK2A 3QUFA 4R75A 4RNSA 2X26A 4U1OA 5L9MA 2RF1A 2O1LA 1OMPA 3IOTA 1LBBA 1UQWA 3EN3A 3OO8A 1IXCA 4DXUA 4F39A 5BUUA 2QS3A 4ONYA 4HS7A 4IO4A 1JW5A 3TQLA 3G3GA 2ANJA 3UORA 1MY4A 1ZBMA 3GZGA 2V3QA 3HHFA 3TYHA 3VLUA 4PETA 3IOVA 4LATA 3UIFA 2ZNTA 2DQVA 1FQDA 2I0CA 3R7XA 2Q89A 3F11A 5KDTA 3FVGA 2O68A 3CI8A 1SVXB 4QFLA 4RPNA 5A5XB 3SETA 4R6YA 1POTA 4R6KA 4ZEIA 4G68B 2I48A 1D4NA 3EPEA 4IY6A 1PBPA 4YKIA 5CMMA 4O3BA 3KZGA 5CMCA 4EQBA 5I56A 3A3UA 4M1VA 4IO3A 4KFQA 4OVJA 2XXQA 4ZEFA 3S4UA 2Z22A 3CFLA 2UVIA 2PT1A 2DWIA 1A7LA 1HSLA 3FV2A 3H7MA 3IR1A 4IO6A 2HQ0A 3QXMA 4RPOA 4LZ7A 2FA7A 1B3GA 3VLWA 3M8UA 1UIVA 3PUVE 4QHQA 4QFKA 1FW0A 5I84A 1S9TA 3UGWA 4GFRA 4X9TA 4EQ7A 5H8NA 4BDOA 4C1TA 3VVFA 5TU0A 1TFAA 4OETA 3TKDA 5IAIA 4GOTA 4WEDA 4POWA 5L9OA 3SDFA 4GF8A 4N07A 3SKPA 1MY0A 1MPCA 3TDJA 2AL5A 3N26A 1D3KA 1YTVA 3KOTA 1MRPA 5DT6A 3H6VA 4NTLA 1LB9A 3PMXA 2XXXA 3O28A 3Q27A 4MH5A 4OWDA 3VVDA 1ZIUA 5DVFA 1MXVA 4H5FA 1URSA 4FATA 1EZ9A 4QRZA 1OQHA 1SYIA 1QVSA 2H4IA 3K02A 2V3TA 1R9QA 4U4XA 3Q28A 2XX7A 5CM6A 1DTGA 3RY3A 5IKBA 2ZMBA 1UTBA 2ABHA 2UXAA 2R71A 2V84A 2YPNA 4IGRA 4EXKA 3RLFE 3KN3A 4DXBA 3DM0A 3FATA 4EDPA 2HZLA 3CR9A 3I6VA 3ODBA 3MAMA 4I9DA 2H25A 3TODA 4H8IA 5KDTB 1P99A 3G3IA 4KI0E 3RGYA 1EH3A 1USYH 1YCJA 3SERA 3FD3A 4H8JA 1AL3A 3KJ7A 3MP8A 5DEXA 2I4BA 4IO5A 2KLFA 1VE4A 3ZS6A 3CG1A 4BDQA 2G93A 4RK9A 2YJPA 2X7QA 5FHMA 3W9VA 5H8HA 2RC7A 4C1UA 1YPNA 1VFDA 5CMBA 2P0SA 4MBPA 3V89B 3VXCA 4OERA 2W7YA 1PEBA 3U1OA 3CRBA 3FUZA 3MPKA 4TLLB 1Y1MA 4PFTA 3IO4A 1FTJA 1MM7A 2F8DA 4XXUA 3K6WA 5AA2A 2V3UA 1BKAA 2O6AA 3IK6B 3O6HA 4KR5A 1O7TA 5JTYB 5ICTA 2QSXA 1MY3A 3H4ZA 5DYHA 4FJPA 1URGA 1US4A 5FTHA 4G4PA 3IO6A 4ELRA 4PE5B 1P1QA 1D9VA 1FQEA 1MXXA 2Z8EA 4G8MA 3TZAA 3WAFA 1Q35A 1LCTA 2F97A 1OQGA 1I6QA 3FIRA 4JDFA 4LA9A 3QAXA 5TPAA 1MQIA 1R9LA 2XX8A 1L5TA 2RINA 3B6QA 3TPAA 4DE8A 1XOCA 3ZSFA 3OXNA 3MZ9A 5HM4B 2DVZA 1LFIA 3G3FA 3IAZA 5I59A 2F6GA 4U21A 4LUBA 2OBGA 2UVJA 1SBPA 2XXWA 3BFTA 3RPWA 1UTBB 3JZJA 4G68A 3T22A 5L9SA 4FIMA 2B3BA 3K1PA 1B2HA 4R2FA 1R1NA 1M5FA 2ZNUA 4UACA 5L8DA 4QFPA 4F3SA 3S9MC 4NE4A 2VGQA 3Q25A 4WXJA 3K4UA 3SEUA 1H76A 3IX1A 1LFGA 3H06B 3CSGA 2UYFA 4ZE9A 3C33A 4OENA 5I57A 3OMBA 4F2QA 4AB5A 1FQCA 4TLMB 5H8HB 5I59B 3U8QA 1QW0A 1MS7A 1XT8A 3MC2A 5I2NA 4QSEA 1A8EA 4RYAA 2G29A 1B05A 1I6AA 3W15C 4POXA 4JWXA 1J1NA 3N6TA 1TT1A 3O2AA 3QIMA 3LC8A 4EUOA 3HHGA 1B46A 1S50A 2QS2A 2R6GE 2Y7PA 4K3FA 4NF6B 5TP9B 1ZJLA 1QUKA 3MP1A 3U92A 3GXAA 3K2DA 4OFJA 4XTCQ 3RTWB 3UP9A 1GV8A 4DCXA 4YB5A 5AA2D 4DCYA 2GRVA 1QKAA 1B0HA 2NUVA 3B6TA 3PPRA 4OXVA 2LAOA 5H8SA 3O9PA 4F29A 3M3FA 1NNPA 3PV0E 3MJNA 3C31A 3N94A 4NWCA 3OO7A 3RQTA 1S7YA 2XX9A 4GXAA 1JQFA 3MBPA 4U4SA 5KZTA 2XHDA 3ECRA 4RA1A 3M3LA 4QSCA 5EHMA 4Q5TA 2M8CA 1NL5A 1B58A 1B7UA 3KN7A 3IORA 3V5AA 1MXUA 3PPOA 2Y84A 4ZECA 2XXTA 4DDDA 3ILUB 1LFHA 2DVCA 5F1QA 2O1MA 3CSBA 2RC9A 2QJEA 4F18A 5KCJB 3BKIB 3KGCA 3H6UA 2D21A 1ZLQA 4DIGA 5EHSA 1MXZA 2DOJA 4LQ2A 1JW4A 2O7UA 1B7HA 2I6EA 2REJA 4R72A 3Q29A 4XIGQ 2DE3A 3H6TA 5I2KB 3S2VA 3TTMA 1WODA 3PMWA 4R9GA 3B6WA 3IB2A 4NEDA 2PX1A 3MVYA 4HTGA 5CRYA 4LZ5A 3WAEA 3OOAA 4O3CA 3RT8A 1Y3NA 4YKJA 4TOZA 3T93B 2PMSA 3VFJA 2VHAA 1SW5A 3DP4A 3FV1A 4NF5A 4XKQA 1IEJA 4KYDA 2YLNA 3PD9A 1OVBA 2F36A 2F5XA 2XD2A 3TMGA 1LGBC 2UVHA 2WKYA 4GVOA 1SW4A 4IB2A 4JBZA 3ONMA 5LOMA 4DZ1A 1P1NA 5ICQA 4ZEKA 5CC2A 2E0SA 3TQWA 1PBQA 3GBBA 1WDNA 4NWDA 4E0WA 4ECFA 1B0LA 1SI0A 3O29A 1B5IA 1VSOA 3MWBA 1RYOA 4L17A 4HW8A 2H9BA 1Z7NE 3HPIA 3PUXE 3RT6B 3T96B 4ZEBA 1MQHA 1LAXA 1MY1A 2VD3A 5K2YA 4ESXA 4MLVA 3PGFA 2GHBA 1YAEA 2OWTA 2ZNSA 5H8NB 3OEMA 1RKMA 2I4CA 4ELPA 3VXBA 4AB6A 1PB7A 1SW1A 1MPDA 2B65A 2Y7RA 5A5XA 1AIVA 3L6GA 1JW1A 3K0VA 5CBRA 4KPTA 3PPQA 3G3KA 1A8FA 1A99A 4E0XA 4F1YA 1B1HA 2OZZA 5ITOA 4Q8RA 2THIA 4R74A 5CI5A 5FHNA 2XXVA 5I2NB 4N13A 4OESA 5BWJA 4OTEA 2E1SA 2GHAA 4NF4A 1H43A 1LAGE 2BJJX 2HCAA 3DP8A 4X1DA 4YKPA 1FTKA 2NOOA 3FJGA 1B32A 4NF6A 4NMYA 4QFOA 2QMWA 4JWYA 1A40A 2DSFA 1FTOA 2OCUA 5B70A 3C9HA 1IXIA 3FXUA 4IY5A 4PFYA 4GL0A 5ITPA 1I69A 2UYEA 4F3PA 1IQ7A 1LLSA 4F22A 2Q2AA 3E9XA 4FECA 4ISUA 4MLQA 3KEIA 4NF5B 4BDRA 3KBRA 4BLAA 2Q88A 4U22A 3FVKA 2DWAA 1ZKBA 4ZZEA 3MPLA 1QJMA 1SI1A 4ZZAA 3T9HB 3EF7A 4H65A 1B4ZA 2B3FA 2O51A 4OHNA 2ZYNA 1T0KA 4KHZE 3IJXB 4YB7A 1N76A 4GIZA 3RN8A 2ZYOA 2Q9TA 1D9YA 3LSLA 4KYEA 4BDNA 3EHTA 3H3GA 3SEVA 4MF3A 3PMVA 3PUYE 4RK2A 1N84A 1IXGA 2V93A 1GR2A 1PDAA 3K1MA 3KSJA 3RUMA 1EU8A 1DMBA 3C4MA 1B51A 1LAFE 3HV1A 3N5LA 4UA8A 1A55A 3VV5A 4JXIA 1DPPA 1FQBA 2FYIA 2RCAA 3BBRA 4F3GA 1Y20A 4OZ9A 2F34A 4GXSB 4FAJA 4Z7EA 1GTKA 5KCJA 2VP1A 3MZBA 2DE2A 2I3VA 4ZEDA 2AIXA 3G7WA 4PP0A 1LBCA 4LZ8A 1H3DA 4X1BA 2F78A 3FVOA 1JEVA 3LSFB 4QSDA 1USYE 3TAJA 2DYXA 4EF2A 3QYTA 1WVJA 1B3FA 1SW2A 4KD5A 1R6ZA 3OD7A 1B1XA 2QRYA 3MW0A 3TTNA 4NF8B 3TTLA 4ELOA 1OLAA 5J1DA 4U2RA 4THIA 5H8FB 1B52A 1BP5A 3TCGA 1BLFA 2HAVA 1NH8A 2VOZA 1TWYA 3KFMA 1IXHA 4OQOA 3SESA 4HCYA 3VE1B 4OFLA 3R6UA 4GQOA 1XS5A 1N3XA 1B7ZA 5AA4B 5FTIA 5JTYA 2XXYA 1JEUA 4QFNA 4U23A 5H8QB 3OSRA 2I49A 4JWOA 3FGSA 2DE4A 1MXWA 1NKXA 2QL3A 3P7IA 3K01A 3O6GA 3JV9A 3R26A 2REGA 4EXLA 1EZOA 4ELQA 1FTLA 4YZZA 1MPBA 4KCCA 1JVXA 1URDA 3LBSA
chains in the Genus database with same CATH superfamily
1UTHB 3V8XB 4P0GA 4R2BA 1YXIA 5EYFA 1MXYA 5ELVA 3H6WA 3TELA 5CBSA 3T9UA 4N81A 3TEPA 2PCRA 1NV4A 4XKNA 4QF9A 2XD3A 5M2VA 1B5HA 4H46A 4PBHA 3MVZA 2I3WA 4OYVA 4PC9A 4GL8A 1KA1A 2P3VA 4U1ZA 3TTKA 3HCQA 5AA4A 2O69A 3SEXA 2F7CA 4NF4B 1QUIA 1SD3A 1Y1ZA 1FPGA 2A5TB 5B7DA 2KQZA 3IB1A 1NV6A 1B3EA 1B5JA 2Q74A 3OELA 3AXFA 4PF8A 2HAUA 1FBGA 3T9VA 4EUOA 5TP9A 1ANFA 1PB9A 1IMBA 3ISPA 4KQPA 2P2AA 3E4RA 3OEKA 5I58B 2CZKA 1Y3PA 4G8NA 1POY1 2AYSA 5IZZA 1DPEA 1RYXA 2CMOA 4F2OA 2PBWA 2QS1A 1FJ6A 1SQYA 2P3NA 3EHUA 4C0RA 3G3HA 2DWHA 2DXYA 2WBBA 4O3AA 1II5A 4KYSA 1M5DA 1O63A 4WKMA 5K2XA 3T66A 2ONSA 3O66A 3CVGA 4X48A 3THIA 1DTZA 5LTCA 3BFUA 2ALUA 1LAHE 2RCBA 2UVGA 4NF0A 4MX6A 2OWSA 2O7IA 3D4CA 2Y5LA 3CG3A 3FJ7A 3HN0A 4GWSA 3E13X 4ZDMA 2XWVA 2P1SA 2B4MA 2BJIA 2CZHA 4PFIA 2Q8JA 4YB6A 1P1UA 3KJTA 1A54A 3A3CA 3MP6A 2ZZXA 4Z0IA 2D5WA 4IGTA 1CB6A 4PQJA 3IOUA 2OK2A 4U1OA 2X26A 1OMPA 3IOTA 1UQWA 4ONYA 4IO4A 1ZBMA 3TYHA 4LATA 2DQVA 3F11A 2O68A 1SVXB 4P9KA 4OVTA 4P8BA 4R6YA 1POTA 4YKIA 5CMCA 4KFQA 4ZEFA 2PT1A 2DWIA 1NV0A 4LZ7A 1B3GA 4QHQA 1FW0A 4EQ7A 4OETA 3TKDA 4X04A 3SDFA 1MPCA 3N26A 1D3KA 1YTVA 1MRPA 3H6VA 3PMXA 3Q27A 4MH5A 1VDWA 1LBYA 4OWDA 3VVDA 5DVFA 4H5FA 1URSA 4GBVA 2V3TA 4U4XA 3Q28A 5CM6A 4EXKA 2UXAA 2R71A 2YPNA 4IGRA 3KN3A 5EQ8A 2HZLA 3CR9A 3ODBA 3TODA 1FPKA 2H25A 1P99A 4KI0E 1YCJA 3MP8A 3ZS6A 1VE4A 4BDQA 4RK9A 2YJPA 2X7QA 4C1UA 1VFDA 3U1OA 5CMKA 1Y1MA 5AA2A 2V3UA 4KR5A 2O6AA 5DYHA 3FXBA 1FQEA 1LBVA 1LCTA 4LA9A 5TPAA 1MQIA 2XX8A 2RINA 3B6QA 3TPAA 5HM4B 4GWZA 5I59A 2HHMA 4LUBA 3BFTA 3K1PA 4R2FA 4F3SA 2VGQA 4WXJA 1H76A 1LFGA 3H06B 4ZE9A 3OMBA 5I59B 5I2NA 4RYAA 2G29A 4POXA 4JWXA 1IMCA 3O2AA 2Y7PA 2QS2A 4K3FA 4NF6B 4X8RA 1ZJLA 3MP1A 3MSTA 2JJKA 3U92A 2XWOA 4XTCQ 3UP9A 5L9SA 2GQ1A 3PPRA 3M3FA 3N94A 3C31A 2ZZWA 3OO7A 2QVUA 4QSCA 2QFLA 3KN7A 3IORA 1EYIA 3V5AA 3PPOA 2XXTA 3PTYA 2O1MA 3CSBA 3KGCA 1ZLQA 1JW4A 5I2KB 1B7HA 4IR8A 3Q29A 3H6TA 1WODA 4R9GA 4HTGA 3T93B 2PMSA 3DP4A 3FV1A 4KYDA 4IB2A 2WKYA 5ICQA 1PBQA 3GBBA 4NWDA 4ECFA 3CHGA 1RYOA 4HW8A 3T96B 3HPIA 3PUXE 1MQHA 1LAXA 5K2YA 4GX3A 1YAEA 2I4CA 4AB6A 1PB7A 1SW1A 2B65A 1JW1A 3PPQA 4G61A 4JVCA 2OZZA 5CI5A 4N4UA 2GHAA 3BIHA 2HCAA 1FTKA 4QFOA 4JWYA 4P47A 1A40A 2DSFA 1IXIA 5ITPA 3GYYA 4MLQA 4MMPA 3KBRA 4U22A 3FVKA 3T9HB 5EYHA 1B4ZA 4YB7A 1N76A 4BDNA 3H3GA 4MF3A 3PUYE 1N84A 5IZ3A 3KSJA 3C4MA 1A55A 1SPIA 4JXIA 2Y5KA 4LN5A 2RCAA 1Y20A 4GXSB 1G0IA 3MZBA 2AIXA 4LZ8A 4QSDA 4XEQA 4KD5A 1R6ZA 3TTNA 4ELOA 4NF8B 1OLAA 4OQOA 3SESA 4GWXA 1JEUA 2DE4A 2REGA 4H65A 3IL1B 5DW8A 3LBSA 3TUSA 4NF8A 3USDA 5HPQA 2I0BA 4BDMA 1Y9UA 2Y7WA 1ZU0A 3KG2A 4G68C 1KZ8A 4HCWA 3FJMA 2HZKA 3Q26A 1NV7A 2RKMA 1YYZA 4ND9A 4LQ5A 1TFDA 2HEUA 2NWJA 1JNFA 1DSNA 3RYDA 1H45A 3EHSA 3T9XB 1PB8A 3UA8A 1M5CA 2CZIA 1FTMA 2IEEA 4RY1A 1DBZA 1NUZA 3DELB 3ZKKA 3MVXA 2Z23A 4I8CA 3FVNA 2GH9A 1H44A 1MQJA 3QSLA 3PUZE 4HXVA 1QGXA 1QUJA 1YZ0A 2PYYA 3S9EA 4RXLA 3HO7A 4JSDA 3K00A 2QMXA 5F7VA 3LR1A 1IUDA 3C36A 2O84X 3M3KA 2Z8DA 3L6HA 4O7IA 1HSJA 4ZS9A 2CZLA 2XXRA 3FASA 3TTRA 4XKRA 4YICA 2ONKE 4NGUA 4P0IA 1FBEA 1US5A 3MUQA 4PBQA 5H8FA 4H67A 4GX4A 3OO6A 3EQ1A 1Z7ME 4OVQA 2XXUA 4PDDA 3JYRA 1N3WA 2DWJA 3CFZA 3MVWA 4Q30B 5I57B 4DLDA 1FBCA 3CFXA 1Q9DA 5EQ7A 2HFBA 1N7XA 2ESNA 4LP2B 4RJZA 5I58A 3A09A 4NAPA 3RTFB 2V4CA 2F7AA 4JSOA 2CEXA 1NUWA 3CIJA 4I62A 3MQ9A 3UN6A 2Y7KA 3U94A 2PVUA 5HBCA 1FCKA 4IO7A 1B6HA 1BIYA 2A5SA 3D1RA 4OA4A 2QS4A 3I3VA 3IFCA 2OWZA 2XXPA 4YKKA 3DP6A 4R75A 4RNSA 2O1LA 1LBBA 3EN3A 1EYJA 1FBFA 5T3JA 4HS7A 3TQLA 1JW5A 3UORA 3GZGA 2V3QA 3HHFA 1IMEA 3IOVA 3UIFA 2FIEA 1FQDA 3R7XA 4GX6A 2L5VA 3CI8A 4QFLA 3SETA 2I48A 4IY6A 5CMMA 4O3BA 4IO3A 4OVJA 1CNQA 3CFLA 4N8YA 2UVIA 1HSLA 3H7MA 4I3EA 2FA7A 3M8UA 3PUVE 4QFKA 5H8NA 4BDOA 4C1TA 3VVFA 1TFAA 5IAIA 4N07A 4NTLA 5ESYA 2H4IA 3K02A 1R9QA 1DTGA 1UTBA 2V84A 3RLFE 4AS4A 4I9DA 1EH3A 4H8JA 1AL3A 3KJ7A 2I4BA 4IO5A 2KLFA 5H8HA 1YPNA 2P0SA 4MBPA 1PEBA 4TLLB 4XXUA 2F8DA 3O6HA 1O7TA 1MY3A 1LEVA 3H4ZA 2WBDA 1URGA 1US4A 5FTHA 2XA5A 3WAFA 2F97A 3FIRA 4AS5A 1FPFA 1XOCA 3MZ9A 2DVZA 3G3FA 3IAZA 2F6GA 4U21A 3RPWA 3T22A 4G68A 4FIMA 2B3BA 4GWYA 1R1NA 1M5FA 2F3DA 2ZNUA 4UACA 3S9MC 4NE4A 4O8MA 3Q25A 2UYFA 3C33A 4OENA 4PFRA 3U8QA 4QSEA 1I6AA 2B4LA 1J1NA 3LC8A 3HHGA 1S50A 4O7MA 1QUKA 1INPA 3GXAA 3RTWB 4DCXA 1GV8A 4DCYA 4OXVA 2LAOA 5H8SA 1NNPA 4GXAA 5KZTA 2XHDA 4RA1A 3M3LA 1B58A 1B7UA 1MXUA 3RPLA 2Y84A 1NV1A 4DDDA 4P1LA 5F1QA 5KCJB 5EHSA 5ET7A 4LQ2A 4R72A 2I6EA 2DE3A 3PMWA 1DCUA 4MEVA 2PX1A 5CRYA 3RT8A 1Y3NA 4PF6A 1SW5A 4XKQA 1IEJA 2F5XA 3TMGA 1LGBC 2UVHA 4JBZA 5LOMA 3ONMA 4HE2A 1VSOA 3MWBA 1Z7NE 4MLVA 4PAKA 1RDZA 1RKMA 4ELPA 3VXBA 4N6KA 1MPDA 2Y7RA 5A5XA 4KPTA 3SZPA 5EYGA 1IMDA 3G3KA 1A99A 4F1YA 1B1HA 5ITOA 4Q8RA 5FHNA 4N13A 4NF4A 2BJJX 3DP8A 4NMYA 2QMWA 1XI6A 2F3BA 3C9HA 1I69A 2UYEA 3E9XA 4NF5B 2Q88A 2DWAA 3MPLA 1SI1A 4ZZAA 3EF7A 2VPNA 3RN8A 4N6DA 3LSLA 4KYEA 3RUMA 1EU8A 3N5LA 1DPPA 4XF5A 4OZ9A 4Z7EA 4FAJA 5KCJA 2CEYA 1LBCA 1JEVA 3QYTA 1WVJA 1B3FA 1B1XA 2QRYA 3MW0A 4U2RA 4FBPA 1BP5A 1BLFA 3KFMA 1TWYA 4OFLA 3R6UA 2DDKA 5AA4B 2XXYA 5H8QB 2I49A 2QL3A 1MXWA 3O6GA 4EXLA 2XXKA 1MPBA 2NXOA 2WEFA 3KN8A 1MH3A 4YMAA 3C34A 2XXHA 1LSTA 4F3BA 4XKPA 5I2KA 4P56A 1FPJA 5JEIA 5J16A 4PGNA 5DVIA 1AH5A 1ZTYA 3C35A 4GLIA 1AMFA 1P1WA 5AA2B 3K1NA 2ZYMA 4GWOA 2XXIA 2QPQA 1IIWA 4OANA 4F19A 2ZYKA 1KWHA 4H0WA 4MNIA 2WYKA 4OMBA 2VT5A 4DXCA 1QKBA 1NNKA 3HSTA 2OLBA 4JVDA 2ONRA 1IZ1A 2H99A 3W9WA 3ZKLA 4G2ZA 4LONB 1EYKA 2Z8FA 1Y4TA 2F35A 3OENA 4R73A 3LV0A 4PDHA 2HXWA 1MDP1 4JB7A 1EZPA 1AOVA 1FPBA 3C32A 3PPPA 5I56B 2F6PA 3TCHA 3PPNA 3KSXA 4G77A 1SDXA 3KC0A 2PT2A 2GFEA 1UIUA 1XVXA 4FE8A 3U72A 3LSXA 3IJOB 1GGGA 4QBAA 4HE0A 5FHOA 3S9LC 1MH4A 1MY2A 4P11A 1Q1KA 3OO9A 1NH7A 1MQGA 4H45A 4FEBA 4TQUQ 1JVYA 1B9JA 2FBPA 3IB0A 3HFUA 1K9ZA 3O6IA 1MM6A 5I7IA 2D3IA 3QUJA 3SEYA 1IITA 4F1VA 4YU0A 3U65A 3VDFA 2H98A 1MG1A 1OIBA 3LSWA 1QULA 3MYUA 4NX1A 1XC1A 1BTJA 2I58A 5JK4A 4R9FA 3G3JA 4R6HA 3FXQA 3E79A 1Y3QA 4FORA 5DEXB 3IOWA 3SEWA 4GWWA 3N6UA 2QVRA 3QMFA 3D4GA 3VLVA 1O64A 1XHYA 3PU5A 4OEUA 1DOTA 1N04A 1TXFA 2OX3A 5L9MA 1ATGA 2RF1A 4F39A 3OO8A 4DXUA 2ANJA 5EQAA 4PETA 3A29A 2I0CA 2Q89A 5KDTA 3LUZA 4RPNA 4DI3D 4R6KA 4ZEIA 1D4NA 3EPEA 3KZGA 5I56A 4M1VA 2FIXA 1LBWA 3S4UA 1A7LA 3FV2A 4IO6A 2HPGA 4RPOA 1LBZA 3UGWA 4X9TA 5TU0A 4MJOA 4POWA 3SKPA 1MY0A 2AL5A 3B8BA 5DT6A 2XXXA 1ZIUA 1MXVA 4FATA 1OQHA 2XX7A 3RY3A 5IKBA 5IZ3B 4I3YA 3FATA 4EDPA 3MAMA 3RGYA 3SERA 3FD3A 5DEXA 4NHBA 5FHMA 5I5PA 4MIJA 5CMBA 3V89B 3VXCA 3FUZA 3MPKA 4NQ8A 4PFTA 3IO4A 1FTJA 4XFEA 5JTYB 1BKAA 3IK6B 5ICTA 3IO6A 1FBHA 4PE5B 1P1QA 2Z8EA 1MXXA 2WYPA 3TZAA 1Q35A 4JDFA 1R9LA 4DE8A 3ZSFA 1LFIA 1SBPA 1FJ9A 3JZJA 4HE1A 1B2HA 3SEUA 3IX1A 4OVSA 4F2QA 4AB5A 5ET6A 4I40A 1FQCA 1QW0A 1XT8A 3MC2A 3BIGA 1B05A 3W15C 1TT1A 1B46A 1NI9A 3K2DA 5AA2D 4YB5A 2GRVA 1QKAA 3B6TA 1DK4A 3MJNA 4GBWA 3RQTA 1S7YA 3MBPA 3ECRA 5EHMA 4Q5TA 2M8CA 2DVCA 2RC9A 4F18A 2D21A 4DIGA 1FTAA 4PE3A 2WX9A 4XIGQ 3TTMA 3IB2A 4LZ5A 4YKJA 4TOZA 3VFJA 4NF5A 3PD9A 1OVBA 2F36A 2XD2A 4GVOA 1SW4A 2Q8MA 1P1NA 5CC2A 4EF1A 4E0WA 1B0LA 4N15A 5ET8A 2H9BA 4ZEBA 1MY1A 2FVZA 4ESXA 2OWTA 2ZNSA 5H8NB 5ET5A 1A8FA 4E0XA 4NG7A 4R74A 4GWUA 5BWJA 1NUXA 2PFYA 2E1SA 1LAGE 3KBZA 2NOOA 3FJGA 4NF6A 1FTOA 2OCUA 5B70A 3FXUA 4IY5A 4GL0A 1IQ7A 1LLSA 2PFZA 2Q2AA 4F22A 2ZZVA 1ZKBA 1QJMA 1K9YA 2B3FA 2O51A 2ZYNA 3IJXB 4GIZA 2Q9TA 5I3SA 3EHTA 1BK4A 3PMVA 4RK2A 1IXGA 1GR2A 1DMBA 1LAFE 3VV5A 1RDXA 2FYIA 4F3GA 2DE2A 2I3VA 3G7WA 4X1BA 2F78A 1USYE 2DYXA 4EF2A 1SW2A 2XWIA 3OD7A 5J1DA 4THIA 5H8FB 2HAVA 1NH8A 2VOZA 1IXHA 3VE1B 4HCYA 1XS5A 1B7ZA 5FTIA 5JTYA 4QFNA 4JWOA 3P7IA 3K01A 3JV9A 4ELQA 1FTLA 3GLBA 1FBDA 1ELJA 1N0TA 2VD2A 5AA1A 4M4GA 3NOHA 2AL4A 4F31B 5IGAA 1B40A 2XWKA 1NUYA 4IO2A 4WEPA 1Y4CA 3FZVA 1NFTA 4H5GA 3LUYA 3E3KA 1UTHA 1XVYA 2RC8A 3U93A 1B3LA 4ZE8A 1SYHA 5AE4A 3VVEA 1OLCA 4OVRA 4H1XA 3DLNA 1MDQA 1NNTA 2FNCA 2MKZA 2DXRA 2H5YA 1PC3A 1IMFA 4LVQA 4OFOA 3TCFA 1LB8A 4PFWA 3V83A 4MFIA 3ROJA 3TFLA 1OVTA 3T0JA 4P3LA 4BDLA 1JETA 4I1DA 4MNPA 2OJTA 1FPEA 1VFEA 3FXRA 3UK4A 1GVCA 2VPOA 3K6XA 4UABA 3GBAA 1B3HA 1NV3A 1F9BA 4ESWA 3K6UA 1RDYA 3IFAA 4PFUA 1VR5A 1CE2A 2A5TA 4KCDA 3H03A 5DTBA 2Q2CA 2V25A 3KOSA 1M5EA 5DVJA 4F1UA 4G8HA 1P1OA 2FHYA 3B7DA 4FEDA 2Y7IA 1NV2A 3K6VA 1ZMGA 4N6PA 5A5LA 2X7PA 4GRKA 4MHFA 2DP8A 4YAHX 3O97A 1NMUA 2ZXTA 3I5OA 4GD5A 3S9NC 2DS9A 3B50A 1FQAA 2R9JA 3MZ1A 5H8QA 1HSEA 3QK6A 2F7BA 3RNNA 3OSQA 4H6DA 4PAIA 3FBPA 1FQFA 4EQ9A 3PD8A 4KXPA 2IA4A 4YMBA 1M5BA 5TPAB 4Q0CA 1MQDA 3ILTB 1NNFA 4QXDA 1LCFA 1I6BA 1N7WA 5ISUA 2NVUB 3PUWE 4OEVA 2KR0A 5AA3A 1LBXA 1B4HA 3QUFA 5BUUA 1IXCA 2QS3A 3G3GA 1MY4A 3VLUA 4P1EA 2ZNTA 3FVGA 4O94A 5A5XB 4G68B 5LDZA 1PBPA 4EQBA 3A3UA 4MAGA 2XXQA 2Z22A 3IR1A 2HQ0A 3QXMA 4MCOA 3VLWA 1UIVA 5I84A 1S9TA 4GFRA 4GOTA 4WEDA 1NV5A 5L9OA 4GF8A 3EKIA 3TDJA 3KOTA 1LB9A 3O28A 1EZ9A 4QRZA 1SYIA 1QVSA 2ZMBA 2ABHA 4DXBA 3DM0A 3I6VA 3RPLB 5KDTB 4H8IA 3G3IA 1USYH 4N91A 3CG1A 4ZECA 2G93A 3W9VA 2RC7A 4NN3A 4JVIA 4PTKA 4OERA 2W7YA 3CRBA 4AQ4A 4PFBA 1MM7A 3K6WA 2QSXA 4FJPA 4G4PA 5IZ1A 4ELRA 1D9VA 4G8MA 5F24A 1OQGA 1I6QA 3QAXA 1L5TA 1FPLA 3OXNA 1FBPA 2OBGA 2UVJA 2XXWA 1JP4A 1UTBB 4OVPA 5L8DA 4QFPA 3K4UA 5I57A 3CSGA 4TLMB 5H8HB 1MS7A 1A8EA 3N6TA 3QIMA 1G0HA 2R6GE 5TP9B 4OFJA 4MNCA 1KA0A 2NUVA 1B0HA 4F29A 3O9PA 3PV0E 4NWCA 2QVVA 2XX9A 1IMAA 1JQFA 4U4SA 1FPDA 1NL5A 3ILUB 1LFHA 2QJEA 1FPIA 3BKIB 5EQ9A 3H6UA 1MXZA 2DOJA 2O7UA 3S2VA 2REJA 3B6WA 4NEDA 3MVYA 3WAEA 3OOAA 4O3CA 4DI4B 3KC1A 2VHAA 2YLNA 4DZ1A 4PCDA 4ZEKA 2E0SA 3TQWA 1WDNA 1SI0A 3O29A 1B5IA 4L17A 3RT6B 1D9QA 2VD3A 3PGFA 2GHBA 3OEMA 1AIVA 3L6GA 3K0VA 5CBRA 2THIA 5I2NB 2XXVA 4OESA 4OTEA 1H43A 4X1DA 4YKPA 1B32A 4PFYA 4F3PA 4BDRA 4FECA 4ISUA 3KEIA 2HXRA 4BLAA 3T1BA 4ZZEA 5FBPA 4OHNA 1T0KA 4KHZE 4N17A 2ZYOA 4PGPA 1D9YA 1AWBA 3SEVA 2V93A 3K1MA 1PDAA 5IM2A 1B51A 3HV1A 4UA8A 1FQBA 3BBRA 2F34A 1GTKA 2VP1A 4ZEDA 4PP0A 1H3DA 3FVOA 3LSFB 3TAJA 3TTLA 3E78A 1B52A 4N8GA 3TCGA 4GQOA 1N3XA 4U23A 3OSRA 1FRPA 3FGSA 1NKXA 3R26A 4PAFA 1EZOA 2R8TA 1FSAA 4YZZA 4KCCA 1JVXA 1URDA
chains in the Genus database with same CATH topology
3TUSA 3GLBA 2NXOA 4NF8A 3USDA 1UTHB 3KN8A 5HPQA 1MH3A 3V8XB 2I0BA 1ELJA 1N0TA 4BDMA 4YMAA 2VD2A 2XXHA 3C34A 4P0GA 5AA1A 1LSTA 4M4GA 4F3BA 4XKPA 5I2KA 1Y9UA 4R2BA 2Y7WA 5EYFA 1ZU0A 2AL4A 1MXYA 5ELVA 3KG2A 4G68C 3H6WA 3TELA 1B40A 4F31B 5CBSA 5JEIA 4HCWA 3T9UA 3FJMA 4IO2A 3TEPA 5DVIA 1AH5A 2HZKA 4WEPA 3Q26A 1Y4CA 4XKNA 1ZTYA 3C35A 2RKMA 4GLIA 1AMFA 1P1WA 5AA2B 3FZVA 4ND9A 2XD3A 3K1NA 4QF9A 5M2VA 1B5HA 1NFTA 2ZYMA 4LQ5A 4H5GA 4GWOA 3LUYA 3E3KA 1UTHA 2I3WA 2QPQA 2XXIA 1XVYA 2RC8A 3MVZA 4OYVA 1IIWA 4F19A 4GL8A 3U93A 1B3LA 1TFDA 2ZYKA 1SYHA 4ZE8A 2HEUA 5AE4A 1KWHA 4H0WA 2NWJA 3VVEA 1OLCA 4U1ZA 1JNFA 1DSNA 4H1XA 3TTKA 3DLNA 3HCQA 4OMBA 1MDQA 1H45A 1NNTA 2FNCA 5AA4A 2DXRA 3EHSA 5CMKA 3T9XB 2H5YA 1QKBA 1PB8A 1NNKA 1PC3A 4DXCA 3HSTA 2O69A 1M5CA 2OLBA 4LVQA 3SEXA 2F7CA 2ONRA 3UA8A 4OFOA 1IZ1A 2H99A 4NF4B 1QUIA 3TCFA 3W9WA 1FTMA 3ZKLA 1LB8A 2IEEA 4PFWA 1SD3A 1Y1ZA 4MFIA 3V83A 3TFLA 1OVTA 4G2ZA 2A5TB 4RY1A 3DELB 4LONB 3ZKKA 1JETA 2Z8FA 3MVXA 4BDLA 5B7DA 2Z23A 1Y4TA 2F35A 4I8CA 3IB1A 4I1DA 3OENA 3FVNA 2GH9A 4R73A 1B3EA 1H44A 2OJTA 1B5JA 1VFEA 3UK4A 3FXRA 1GVCA 1MQJA 2HXWA 3OELA 1MDP1 3K6XA 3QSLA 3PUZE 3GBAA 4JB7A 1B3HA 3AXFA 1EZPA 1QUJA 1F9BA 2HAUA 1AOVA 4ESWA 2PYYA 3S9EA 3C32A 3K6UA 3HO7A 3PPPA 4RXLA 3T9VA 2F6PA 5I56B 3TCHA 3PPNA 5TP9A 1ANFA 1PB9A 3KSXA 4G77A 1SDXA 1VR5A 4PFUA 1CE2A 2PT2A 4JSDA 2A5TA 3K00A 4KCDA 2GFEA 1UIUA 2P2AA 4KQPA 1XVXA 4FE8A 2QMXA 3H03A 3E4RA 5F7VA 3OEKA 2Q2CA 2V25A 5DTBA 3LSXA 3U72A 4AQ4A 3IJOB 3KOSA 1GGGA 5I58B 3LR1A 1M5EA 1Y3PA 1IUDA 1POY1 4G8NA 5DVJA 3C36A 5FHOA 4F1UA 2O84X 3M3KA 2Z8DA 3L6HA 2AYSA 4G8HA 1HSJA 1P1OA 1DPEA 4ZS9A 3B7DA 4FEDA 2CZLA 2XXRA 2Y7IA 3FASA 3S9LC 1MH4A 1MY2A 1RYXA 1Q1KA 4P11A 2CMOA 4XKRA 3OO9A 3TTRA 4YICA 2ONKE 4F2OA 1NH7A 2PBWA 2QS1A 3K6VA 4P0IA 1MQGA 1SQYA 1ZMGA 4FEBA 4EF1A 3EHUA 4N6PA 1US5A 3MUQA 4C0RA 3G3HA 5H8FA 4TQUQ 2X7PA 4GRKA 4H67A 1JVYA 1B9JA 2DXYA 2DWHA 2DP8A 4O3AA 1II5A 3OO6A 3IB0A 3EQ1A 4KYSA 4YAHX 1M5DA 1O63A 1NMUA 3O97A 1Z7ME 4WKMA 2ZXTA 5K2XA 3I5OA 2XXUA 4GD5A 3O6IA 1MM6A 3JYRA 2DS9A 3S9NC 1N3WA 3T66A 2D3IA 3QUJA 2DWJA 3SEYA 1FQAA 2ONSA 3CFZA 3CVGA 3O66A 1IITA 4X48A 3THIA 2R9JA 3MVWA 1DTZA 4Q30B 3MZ1A 4F1VA 4YU0A 4DLDA 3BFUA 5I57B 2ALUA 1LAHE 3VDFA 2H98A 1MG1A 1OIBA 2RCBA 3CFXA 5H8QA 1HSEA 3LSWA 3IL1B 2UVGA 3QK6A 2F7BA 3RNNA 2HFBA 3OSQA 1QULA 4H6DA 1N7XA 2ESNA 4LP2B 1FQFA 1XC1A 2OWSA 2O7IA 3PD8A 3D4CA 4RJZA 4EQ9A 5I58A 1BTJA 3A09A 2I58A 5JK4A 4R9FA 3G3JA 3CG3A 3FJ7A 4R6HA 3HN0A 2IA4A 3E13X 3FXQA 4ZDMA 3RTFB 4YMBA 1M5BA 2P1SA 2F7AA 1Y3QA 5TPAB 4FORA 4JSOA 4Q0CA 2Q8JA 3CIJA 1MQDA 4I62A 4YB6A 3ILTB 3MQ9A 5DEXB 3IOWA 1P1UA 2Y7KA 1NNFA 3UN6A 3SEWA 3U94A 2PVUA 3N6UA 3KJTA 5HBCA 1A54A 1LCFA 3A3CA 3MP6A 1I6BA 1FCKA 1N7WA 4IO7A 5ISUA 1B6HA 1BIYA 2A5SA 3D4GA 3PUWE 2NVUB 3VLVA 1O64A 4Z0IA 2D5WA 4IGTA 4OEVA 1CB6A 5AA3A 1XHYA 4PQJA 3PU5A 2QS4A 3I3VA 1DOTA 1N04A 2XXPA 4OEUA 1B4HA 1TXFA 4YKKA 3IOUA 3DP6A 1ATGA 2OK2A 3QUFA 4R75A 4RNSA 2X26A 4U1OA 5L9MA 2RF1A 2O1LA 1OMPA 3IOTA 1LBBA 1UQWA 3EN3A 3OO8A 1IXCA 4DXUA 4F39A 5BUUA 2QS3A 4ONYA 4HS7A 4IO4A 1JW5A 3TQLA 3G3GA 2ANJA 3UORA 1MY4A 1ZBMA 3GZGA 2V3QA 3HHFA 3TYHA 3VLUA 4PETA 3IOVA 4LATA 3UIFA 2ZNTA 2DQVA 1FQDA 2I0CA 3R7XA 2Q89A 3F11A 5KDTA 3FVGA 2O68A 3CI8A 1SVXB 4QFLA 4RPNA 5A5XB 3SETA 4R6YA 1POTA 4R6KA 4ZEIA 4G68B 2I48A 1D4NA 3EPEA 4IY6A 1PBPA 4YKIA 5CMMA 4O3BA 3KZGA 5CMCA 4EQBA 5I56A 3A3UA 4M1VA 4IO3A 4KFQA 4OVJA 2XXQA 4ZEFA 3S4UA 2Z22A 3CFLA 2UVIA 2PT1A 2DWIA 1A7LA 1HSLA 3FV2A 3H7MA 3IR1A 4IO6A 2HQ0A 3QXMA 4RPOA 4LZ7A 2FA7A 1B3GA 3VLWA 3M8UA 1UIVA 3PUVE 4QHQA 4QFKA 1FW0A 5I84A 1S9TA 3UGWA 4GFRA 4X9TA 4EQ7A 5H8NA 4BDOA 4C1TA 3VVFA 5TU0A 1TFAA 4OETA 3TKDA 5IAIA 4GOTA 4WEDA 4POWA 5L9OA 3SDFA 4GF8A 4N07A 3SKPA 1MY0A 1MPCA 3TDJA 2AL5A 3N26A 1D3KA 1YTVA 3KOTA 1MRPA 5DT6A 3H6VA 4NTLA 1LB9A 3PMXA 2XXXA 3O28A 3Q27A 4MH5A 4OWDA 3VVDA 1ZIUA 5DVFA 1MXVA 4H5FA 1URSA 4FATA 1EZ9A 4QRZA 1OQHA 1SYIA 1QVSA 2H4IA 3K02A 2V3TA 1R9QA 4U4XA 3Q28A 2XX7A 5CM6A 1DTGA 3RY3A 5IKBA 2ZMBA 1UTBA 2ABHA 2UXAA 2R71A 2V84A 2YPNA 4IGRA 4EXKA 3RLFE 3KN3A 4DXBA 3DM0A 3FATA 4EDPA 2HZLA 3CR9A 3I6VA 3ODBA 3MAMA 4I9DA 2H25A 3TODA 4H8IA 5KDTB 1P99A 3G3IA 4KI0E 3RGYA 1EH3A 1USYH 1YCJA 3SERA 3FD3A 4H8JA 1AL3A 3KJ7A 3MP8A 5DEXA 2I4BA 4IO5A 2KLFA 1VE4A 3ZS6A 3CG1A 4BDQA 2G93A 4RK9A 2YJPA 2X7QA 5FHMA 3W9VA 5H8HA 2RC7A 4C1UA 1YPNA 1VFDA 5CMBA 2P0SA 4MBPA 3V89B 3VXCA 4OERA 2W7YA 1PEBA 3U1OA 3CRBA 3FUZA 3MPKA 4TLLB 1Y1MA 4PFTA 3IO4A 1FTJA 1MM7A 2F8DA 4XXUA 3K6WA 5AA2A 2V3UA 1BKAA 2O6AA 3IK6B 3O6HA 4KR5A 1O7TA 5JTYB 5ICTA 2QSXA 1MY3A 3H4ZA 5DYHA 4FJPA 1URGA 1US4A 5FTHA 4G4PA 3IO6A 4ELRA 4PE5B 1P1QA 1D9VA 1FQEA 1MXXA 2Z8EA 4G8MA 3TZAA 3WAFA 1Q35A 1LCTA 2F97A 1OQGA 1I6QA 3FIRA 4JDFA 4LA9A 3QAXA 5TPAA 1MQIA 1R9LA 2XX8A 1L5TA 2RINA 3B6QA 3TPAA 4DE8A 1XOCA 3ZSFA 3OXNA 3MZ9A 5HM4B 2DVZA 1LFIA 3G3FA 3IAZA 5I59A 2F6GA 4U21A 4LUBA 2OBGA 2UVJA 1SBPA 2XXWA 3BFTA 3RPWA 1UTBB 3JZJA 4G68A 3T22A 5L9SA 4FIMA 2B3BA 3K1PA 1B2HA 4R2FA 1R1NA 1M5FA 2ZNUA 4UACA 5L8DA 4QFPA 4F3SA 3S9MC 4NE4A 2VGQA 3Q25A 4WXJA 3K4UA 3SEUA 1H76A 3IX1A 1LFGA 3H06B 3CSGA 2UYFA 4ZE9A 3C33A 4OENA 5I57A 3OMBA 4F2QA 4AB5A 1FQCA 4TLMB 5H8HB 5I59B 3U8QA 1QW0A 1MS7A 1XT8A 3MC2A 5I2NA 4QSEA 1A8EA 4RYAA 2G29A 1B05A 1I6AA 3W15C 4POXA 4JWXA 1J1NA 3N6TA 1TT1A 3O2AA 3QIMA 3LC8A 4EUOA 3HHGA 1B46A 1S50A 2QS2A 2R6GE 2Y7PA 4K3FA 4NF6B 5TP9B 1ZJLA 1QUKA 3MP1A 3U92A 3GXAA 3K2DA 4OFJA 4XTCQ 3RTWB 3UP9A 1GV8A 4DCXA 4YB5A 5AA2D 4DCYA 2GRVA 1QKAA 1B0HA 2NUVA 3B6TA 3PPRA 4OXVA 2LAOA 5H8SA 3O9PA 4F29A 3M3FA 1NNPA 3PV0E 3MJNA 3C31A 3N94A 4NWCA 3OO7A 3RQTA 1S7YA 2XX9A 4GXAA 1JQFA 3MBPA 4U4SA 5KZTA 2XHDA 3ECRA 4RA1A 3M3LA 4QSCA 5EHMA 4Q5TA 2M8CA 1NL5A 1B58A 1B7UA 3KN7A 3IORA 3V5AA 1MXUA 3PPOA 2Y84A 4ZECA 2XXTA 4DDDA 3ILUB 1LFHA 2DVCA 5F1QA 2O1MA 3CSBA 2RC9A 2QJEA 4F18A 5KCJB 3BKIB 3KGCA 3H6UA 2D21A 1ZLQA 4DIGA 5EHSA 1MXZA 2DOJA 4LQ2A 1JW4A 2O7UA 1B7HA 2I6EA 2REJA 4R72A 3Q29A 4XIGQ 2DE3A 3H6TA 5I2KB 3S2VA 3TTMA 1WODA 3PMWA 4R9GA 3B6WA 3IB2A 4NEDA 2PX1A 3MVYA 4HTGA 5CRYA 4LZ5A 3WAEA 3OOAA 4O3CA 3RT8A 1Y3NA 4YKJA 4TOZA 3T93B 2PMSA 3VFJA 2VHAA 1SW5A 3DP4A 3FV1A 4NF5A 4XKQA 1IEJA 4KYDA 2YLNA 3PD9A 1OVBA 2F36A 2F5XA 2XD2A 3TMGA 1LGBC 2UVHA 2WKYA 4GVOA 1SW4A 4IB2A 4JBZA 3ONMA 5LOMA 4DZ1A 1P1NA 5ICQA 4ZEKA 5CC2A 2E0SA 3TQWA 1PBQA 3GBBA 1WDNA 4NWDA 4E0WA 4ECFA 1B0LA 1SI0A 3O29A 1B5IA 1VSOA 3MWBA 1RYOA 4L17A 4HW8A 2H9BA 1Z7NE 3HPIA 3PUXE 3RT6B 3T96B 4ZEBA 1MQHA 1LAXA 1MY1A 2VD3A 5K2YA 4ESXA 4MLVA 3PGFA 2GHBA 1YAEA 2OWTA 2ZNSA 5H8NB 3OEMA 1RKMA 2I4CA 4ELPA 3VXBA 4AB6A 1PB7A 1SW1A 1MPDA 2B65A 2Y7RA 5A5XA 1AIVA 3L6GA 1JW1A 3K0VA 5CBRA 4KPTA 3PPQA 3G3KA 1A8FA 1A99A 4E0XA 4F1YA 1B1HA 2OZZA 5ITOA 4Q8RA 2THIA 4R74A 5CI5A 5FHNA 2XXVA 5I2NB 4N13A 4OESA 5BWJA 4OTEA 2E1SA 2GHAA 4NF4A 1H43A 1LAGE 2BJJX 2HCAA 3DP8A 4X1DA 4YKPA 1FTKA 2NOOA 3FJGA 1B32A 4NF6A 4NMYA 4QFOA 2QMWA 4JWYA 1A40A 2DSFA 1FTOA 2OCUA 5B70A 3C9HA 1IXIA 3FXUA 4IY5A 4PFYA 4GL0A 5ITPA 1I69A 2UYEA 4F3PA 1IQ7A 1LLSA 4F22A 2Q2AA 3E9XA 4FECA 4ISUA 4MLQA 3KEIA 4NF5B 4BDRA 3KBRA 4BLAA 2Q88A 4U22A 3FVKA 2DWAA 1ZKBA 4ZZEA 3MPLA 1QJMA 1SI1A 4ZZAA 3T9HB 3EF7A 4H65A 1B4ZA 2B3FA 2O51A 4OHNA 2ZYNA 1T0KA 4KHZE 3IJXB 4YB7A 1N76A 4GIZA 3RN8A 2ZYOA 2Q9TA 1D9YA 3LSLA 4KYEA 4BDNA 3EHTA 3H3GA 3SEVA 4MF3A 3PMVA 3PUYE 4RK2A 1N84A 1IXGA 2V93A 1GR2A 1PDAA 3K1MA 3KSJA 3RUMA 1EU8A 1DMBA 3C4MA 1B51A 1LAFE 3HV1A 3N5LA 4UA8A 1A55A 3VV5A 4JXIA 1DPPA 1FQBA 2FYIA 2RCAA 3BBRA 4F3GA 1Y20A 4OZ9A 2F34A 4GXSB 4FAJA 4Z7EA 1GTKA 5KCJA 2VP1A 3MZBA 2DE2A 2I3VA 4ZEDA 2AIXA 3G7WA 4PP0A 1LBCA 4LZ8A 1H3DA 4X1BA 2F78A 3FVOA 1JEVA 3LSFB 4QSDA 1USYE 3TAJA 2DYXA 4EF2A 3QYTA 1WVJA 1B3FA 1SW2A 4KD5A 1R6ZA 3OD7A 1B1XA 2QRYA 3MW0A 3TTNA 4NF8B 3TTLA 4ELOA 1OLAA 5J1DA 4U2RA 4THIA 5H8FB 1B52A 1BP5A 3TCGA 1BLFA 2HAVA 1NH8A 2VOZA 1TWYA 3KFMA 1IXHA 4OQOA 3SESA 4HCYA 3VE1B 4OFLA 3R6UA 4GQOA 1XS5A 1N3XA 1B7ZA 5AA4B 5FTIA 5JTYA 2XXYA 1JEUA 4QFNA 4U23A 5H8QB 3OSRA 2I49A 4JWOA 3FGSA 2DE4A 1MXWA 1NKXA 2QL3A 3P7IA 3K01A 3O6GA 3JV9A 3R26A 2REGA 4EXLA 1EZOA 4ELQA 1FTLA 4YZZA 1MPBA 4KCCA 1JVXA 1URDA 3LBSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TUS A;  3GLB A;  2NXO A;  4NF8 A;  3USD A;  1UTH B;  3KN8 A;  5HPQ A;  1MH3 A;  3V8X B;  2I0B A;  1ELJ A;  1N0T A;  4BDM A;  4YMA A;  2VD2 A;  2XXH A;  3C34 A;  4P0G A;  5AA1 A;  1LST A;  4M4G A;  4F3B A;  4XKP A;  5I2K A;  1Y9U A;  4R2B A;  2Y7W A;  5EYF A;  1ZU0 A;  2AL4 A;  1MXY A;  5ELV A;  3KG2 A;  4G68 C;  3H6W A;  3TEL A;  1B40 A;  4F31 B;  5CBS A;  5JEI A;  4HCW A;  3T9U A;  3FJM A;  4IO2 A;  3TEP A;  5DVI A;  1AH5 A;  2HZK A;  4WEP A;  3Q26 A;  1Y4C A;  4XKN A;  1ZTY A;  3C35 A;  2RKM A;  4GLI A;  1AMF A;  1P1W A;  5AA2 B;  3FZV A;  4ND9 A;  2XD3 A;  3K1N A;  4QF9 A;  5M2V A;  1B5H A;  1NFT A;  2ZYM A;  4LQ5 A;  4H5G A;  4GWO A;  3LUY A;  3E3K A;  1UTH A;  2I3W A;  2QPQ A;  2XXI A;  1XVY A;  2RC8 A;  3MVZ A;  4OYV A;  1IIW A;  4F19 A;  4GL8 A;  3U93 A;  1B3L A;  1TFD A;  2ZYK A;  1SYH A;  4ZE8 A;  2HEU A;  5AE4 A;  1KWH A;  4H0W A;  2NWJ A;  3VVE A;  1OLC A;  4U1Z A;  1JNF A;  1DSN A;  4H1X A;  3TTK A;  3DLN A;  3HCQ A;  4OMB A;  1MDQ A;  1H45 A;  1NNT A;  2FNC A;  5AA4 A;  2DXR A;  3EHS A;  5CMK A;  3T9X B;  2H5Y A;  1QKB A;  1PB8 A;  1NNK A;  1PC3 A;  4DXC A;  3HST A;  2O69 A;  1M5C A;  2OLB A;  4LVQ A;  3SEX A;  2F7C A;  2ONR A;  3UA8 A;  4OFO A;  1IZ1 A;  2H99 A;  4NF4 B;  1QUI A;  3TCF A;  3W9W A;  1FTM A;  3ZKL A;  1LB8 A;  2IEE A;  4PFW A;  1SD3 A;  1Y1Z A;  4MFI A;  3V83 A;  3TFL A;  1OVT A;  4G2Z A;  2A5T B;  4RY1 A;  3DEL B;  4LON B;  3ZKK A;  1JET A;  2Z8F A;  3MVX A;  4BDL A;  5B7D A;  2Z23 A;  1Y4T A;  2F35 A;  4I8C A;  3IB1 A;  4I1D A;  3OEN A;  3FVN A;  2GH9 A;  4R73 A;  1B3E A;  1H44 A;  2OJT A;  1B5J A;  1VFE A;  3UK4 A;  3FXR A;  1GVC A;  1MQJ A;  2HXW A;  3OEL A;  1MDP 1;  3K6X A;  3QSL A;  3PUZ E;  3GBA A;  4JB7 A;  1B3H A;  3AXF A;  1EZP A;  1QUJ A;  1F9B A;  2HAU A;  1AOV A;  4ESW A;  2PYY A;  3S9E A;  3C32 A;  3K6U A;  3HO7 A;  3PPP A;  4RXL A;  3T9V A;  2F6P A;  5I56 B;  3TCH A;  3PPN A;  5TP9 A;  1ANF A;  1PB9 A;  3KSX A;  4G77 A;  1SDX A;  1VR5 A;  4PFU A;  1CE2 A;  2PT2 A;  4JSD A;  2A5T A;  3K00 A;  4KCD A;  2GFE A;  1UIU A;  2P2A A;  4KQP A;  1XVX A;  4FE8 A;  2QMX A;  3H03 A;  3E4R A;  5F7V A;  3OEK A;  2Q2C A;  2V25 A;  5DTB A;  3LSX A;  3U72 A;  4AQ4 A;  3IJO B;  3KOS A;  1GGG A;  5I58 B;  3LR1 A;  1M5E A;  1Y3P A;  1IUD A;  1POY 1;  4G8N A;  5DVJ A;  3C36 A;  5FHO A;  4F1U A;  2O84 X;  3M3K A;  2Z8D A;  3L6H A;  2AYS A;  4G8H A;  1HSJ A;  1P1O A;  1DPE A;  4ZS9 A;  3B7D A;  4FED A;  2CZL A;  2XXR A;  2Y7I A;  3FAS A;  3S9L C;  1MH4 A;  1MY2 A;  1RYX A;  1Q1K A;  4P11 A;  2CMO A;  4XKR A;  3OO9 A;  3TTR A;  4YIC A;  2ONK E;  4F2O A;  1NH7 A;  2PBW A;  2QS1 A;  3K6V A;  4P0I A;  1MQG A;  1SQY A;  1ZMG A;  4FEB A;  4EF1 A;  3EHU A;  4N6P A;  1US5 A;  3MUQ A;  4C0R A;  3G3H A;  5H8F A;  4TQU Q;  2X7P A;  4GRK A;  4H67 A;  1JVY A;  1B9J A;  2DXY A;  2DWH A;  2DP8 A;  4O3A A;  1II5 A;  3OO6 A;  3IB0 A;  3EQ1 A;  4KYS A;  4YAH X;  1M5D A;  1O63 A;  1NMU A;  3O97 A;  1Z7M E;  4WKM A;  2ZXT A;  5K2X A;  3I5O A;  2XXU A;  4GD5 A;  3O6I A;  1MM6 A;  3JYR A;  2DS9 A;  3S9N C;  1N3W A;  3T66 A;  2D3I A;  3QUJ A;  2DWJ A;  3SEY A;  1FQA A;  2ONS A;  3CFZ A;  3CVG A;  3O66 A;  1IIT A;  4X48 A;  3THI A;  2R9J A;  3MVW A;  1DTZ A;  4Q30 B;  3MZ1 A;  4F1V A;  4YU0 A;  4DLD A;  3BFU A;  5I57 B;  2ALU A;  1LAH E;  3VDF A;  2H98 A;  1MG1 A;  1OIB A;  2RCB A;  3CFX A;  5H8Q A;  1HSE A;  3LSW A;  3IL1 B;  2UVG A;  3QK6 A;  2F7B A;  3RNN A;  2HFB A;  3OSQ A;  1QUL A;  4H6D A;  1N7X A;  2ESN A;  4LP2 B;  1FQF A;  1XC1 A;  2OWS A;  2O7I A;  3PD8 A;  3D4C A;  4RJZ A;  4EQ9 A;  5I58 A;  1BTJ A;  3A09 A;  2I58 A;  5JK4 A;  4R9F A;  3G3J A;  3CG3 A;  3FJ7 A;  4R6H A;  3HN0 A;  2IA4 A;  3E13 X;  3FXQ A;  4ZDM A;  3RTF B;  4YMB A;  1M5B A;  2P1S A;  2F7A A;  1Y3Q A;  5TPA B;  4FOR A;  4JSO A;  4Q0C A;  2Q8J A;  3CIJ A;  1MQD A;  4I62 A;  4YB6 A;  3ILT B;  3MQ9 A;  5DEX B;  3IOW A;  1P1U A;  2Y7K A;  1NNF A;  3UN6 A;  3SEW A;  3U94 A;  2PVU A;  3N6U A;  3KJT A;  5HBC A;  1A54 A;  1LCF A;  3A3C A;  3MP6 A;  1I6B A;  1FCK A;  1N7W A;  4IO7 A;  5ISU A;  1B6H A;  1BIY A;  2A5S A;  3D4G A;  3PUW E;  2NVU B;  3VLV A;  1O64 A;  4Z0I A;  2D5W A;  4IGT A;  4OEV A;  1CB6 A;  5AA3 A;  1XHY A;  4PQJ A;  3PU5 A;  2QS4 A;  3I3V A;  1DOT A;  1N04 A;  2XXP A;  4OEU A;  1B4H A;  1TXF A;  4YKK A;  3IOU A;  3DP6 A;  1ATG A;  2OK2 A;  3QUF A;  4R75 A;  4RNS A;  2X26 A;  4U1O A;  5L9M A;  2RF1 A;  2O1L A;  1OMP A;  3IOT A;  1LBB A;  1UQW A;  3EN3 A;  3OO8 A;  1IXC A;  4DXU A;  4F39 A;  5BUU A;  2QS3 A;  4ONY A;  4HS7 A;  4IO4 A;  1JW5 A;  3TQL A;  3G3G A;  2ANJ A;  3UOR A;  1MY4 A;  1ZBM A;  3GZG A;  2V3Q A;  3HHF A;  3TYH A;  3VLU A;  4PET A;  3IOV A;  4LAT A;  3UIF A;  2ZNT A;  2DQV A;  1FQD A;  2I0C A;  3R7X A;  2Q89 A;  3F11 A;  5KDT A;  3FVG A;  2O68 A;  3CI8 A;  1SVX B;  4QFL A;  4RPN A;  5A5X B;  3SET A;  4R6Y A;  1POT A;  4R6K A;  4ZEI A;  4G68 B;  2I48 A;  1D4N A;  3EPE A;  4IY6 A;  1PBP A;  4YKI A;  5CMM A;  4O3B A;  3KZG A;  5CMC A;  4EQB A;  5I56 A;  3A3U A;  4M1V A;  4IO3 A;  4KFQ A;  4OVJ A;  2XXQ A;  4ZEF A;  3S4U A;  2Z22 A;  3CFL A;  2UVI A;  2PT1 A;  2DWI A;  1A7L A;  1HSL A;  3FV2 A;  3H7M A;  3IR1 A;  4IO6 A;  2HQ0 A;  3QXM A;  4RPO A;  4LZ7 A;  2FA7 A;  1B3G A;  3VLW A;  3M8U A;  1UIV A;  3PUV E;  4QHQ A;  4QFK A;  1FW0 A;  5I84 A;  1S9T A;  3UGW A;  4GFR A;  4X9T A;  4EQ7 A;  5H8N A;  4BDO A;  4C1T A;  3VVF A;  5TU0 A;  1TFA A;  4OET A;  3TKD A;  5IAI A;  4GOT A;  4WED A;  4POW A;  5L9O A;  3SDF A;  4GF8 A;  4N07 A;  3SKP A;  1MY0 A;  1MPC A;  3TDJ A;  2AL5 A;  3N26 A;  1D3K A;  1YTV A;  3KOT A;  1MRP A;  5DT6 A;  3H6V A;  4NTL A;  1LB9 A;  3PMX A;  2XXX A;  3O28 A;  3Q27 A;  4MH5 A;  4OWD A;  3VVD A;  1ZIU A;  5DVF A;  1MXV A;  4H5F A;  1URS A;  4FAT A;  1EZ9 A;  4QRZ A;  1OQH A;  1SYI A;  1QVS A;  2H4I A;  3K02 A;  2V3T A;  1R9Q A;  4U4X A;  3Q28 A;  2XX7 A;  5CM6 A;  1DTG A;  3RY3 A;  5IKB A;  2ZMB A;  1UTB A;  2ABH A;  2UXA A;  2R71 A;  2V84 A;  2YPN A;  4IGR A;  4EXK A;  3RLF E;  3KN3 A;  4DXB A;  3DM0 A;  3FAT A;  4EDP A;  2HZL A;  3CR9 A;  3I6V A;  3ODB A;  3MAM A;  4I9D A;  2H25 A;  3TOD A;  4H8I A;  5KDT B;  1P99 A;  3G3I A;  4KI0 E;  3RGY A;  1EH3 A;  1USY H;  1YCJ A;  3SER A;  3FD3 A;  4H8J A;  1AL3 A;  3KJ7 A;  3MP8 A;  5DEX A;  2I4B A;  4IO5 A;  2KLF A;  1VE4 A;  3ZS6 A;  3CG1 A;  4BDQ A;  2G93 A;  4RK9 A;  2YJP A;  2X7Q A;  5FHM A;  3W9V A;  5H8H A;  2RC7 A;  4C1U A;  1YPN A;  1VFD A;  5CMB A;  2P0S A;  4MBP A;  3V89 B;  3VXC A;  4OER A;  2W7Y A;  1PEB A;  3U1O A;  3CRB A;  3FUZ A;  3MPK A;  4TLL B;  1Y1M A;  4PFT A;  3IO4 A;  1FTJ A;  1MM7 A;  2F8D A;  4XXU A;  3K6W A;  5AA2 A;  2V3U A;  1BKA A;  2O6A A;  3IK6 B;  3O6H A;  4KR5 A;  1O7T A;  5JTY B;  5ICT A;  2QSX A;  1MY3 A;  3H4Z A;  5DYH A;  4FJP A;  1URG A;  1US4 A;  5FTH A;  4G4P A;  3IO6 A;  4ELR A;  4PE5 B;  1P1Q A;  1D9V A;  1FQE A;  1MXX A;  2Z8E A;  4G8M A;  3TZA A;  3WAF A;  1Q35 A;  1LCT A;  2F97 A;  1OQG A;  1I6Q A;  3FIR A;  4JDF A;  4LA9 A;  3QAX A;  5TPA A;  1MQI A;  1R9L A;  2XX8 A;  1L5T A;  2RIN A;  3B6Q A;  3TPA A;  4DE8 A;  1XOC A;  3ZSF A;  3OXN A;  3MZ9 A;  5HM4 B;  2DVZ A;  1LFI A;  3G3F A;  3IAZ A;  5I59 A;  2F6G A;  4U21 A;  4LUB A;  2OBG A;  2UVJ A;  1SBP A;  2XXW A;  3BFT A;  3RPW A;  1UTB B;  3JZJ A;  4G68 A;  3T22 A;  5L9S A;  4FIM A;  2B3B A;  3K1P A;  1B2H A;  4R2F A;  1R1N A;  1M5F A;  2ZNU A;  4UAC A;  5L8D A;  4QFP A;  4F3S A;  3S9M C;  4NE4 A;  2VGQ A;  3Q25 A;  4WXJ A;  3K4U A;  3SEU A;  1H76 A;  3IX1 A;  1LFG A;  3H06 B;  3CSG A;  2UYF A;  4ZE9 A;  3C33 A;  4OEN A;  5I57 A;  3OMB A;  4F2Q A;  4AB5 A;  1FQC A;  4TLM B;  5H8H B;  5I59 B;  3U8Q A;  1QW0 A;  1MS7 A;  1XT8 A;  3MC2 A;  5I2N A;  4QSE A;  1A8E A;  4RYA A;  2G29 A;  1B05 A;  1I6A A;  3W15 C;  4POX A;  4JWX A;  1J1N A;  3N6T A;  1TT1 A;  3O2A A;  3QIM A;  3LC8 A;  4EUO A;  3HHG A;  1B46 A;  1S50 A;  2QS2 A;  2R6G E;  2Y7P A;  4K3F A;  4NF6 B;  5TP9 B;  1ZJL A;  1QUK A;  3MP1 A;  3U92 A;  3GXA A;  3K2D A;  4OFJ A;  4XTC Q;  3RTW B;  3UP9 A;  1GV8 A;  4DCX A;  4YB5 A;  5AA2 D;  4DCY A;  2GRV A;  1QKA A;  1B0H A;  2NUV A;  3B6T A;  3PPR A;  4OXV A;  2LAO A;  5H8S A;  3O9P A;  4F29 A;  3M3F A;  1NNP A;  3PV0 E;  3MJN A;  3C31 A;  3N94 A;  4NWC A;  3OO7 A;  3RQT A;  1S7Y A;  2XX9 A;  4GXA A;  1JQF A;  3MBP A;  4U4S A;  5KZT A;  2XHD A;  3ECR A;  4RA1 A;  3M3L A;  4QSC A;  5EHM A;  4Q5T A;  2M8C A;  1NL5 A;  1B58 A;  1B7U A;  3KN7 A;  3IOR A;  3V5A A;  1MXU A;  3PPO A;  2Y84 A;  4ZEC A;  2XXT A;  4DDD A;  3ILU B;  1LFH A;  2DVC A;  5F1Q A;  2O1M A;  3CSB A;  2RC9 A;  2QJE A;  4F18 A;  5KCJ B;  3BKI B;  3KGC A;  3H6U A;  2D21 A;  1ZLQ A;  4DIG A;  5EHS A;  1MXZ A;  2DOJ A;  4LQ2 A;  1JW4 A;  2O7U A;  1B7H A;  2I6E A;  2REJ A;  4R72 A;  3Q29 A;  4XIG Q;  2DE3 A;  3H6T A;  5I2K B;  3S2V A;  3TTM A;  1WOD A;  3PMW A;  4R9G A;  3B6W A;  3IB2 A;  4NED A;  2PX1 A;  3MVY A;  4HTG A;  5CRY A;  4LZ5 A;  3WAE A;  3OOA A;  4O3C A;  3RT8 A;  1Y3N A;  4YKJ A;  4TOZ A;  3T93 B;  2PMS A;  3VFJ A;  2VHA A;  1SW5 A;  3DP4 A;  3FV1 A;  4NF5 A;  4XKQ A;  1IEJ A;  4KYD A;  2YLN A;  3PD9 A;  1OVB A;  2F36 A;  2F5X A;  2XD2 A;  3TMG A;  1LGB C;  2UVH A;  2WKY A;  4GVO A;  1SW4 A;  4IB2 A;  4JBZ A;  3ONM A;  5LOM A;  4DZ1 A;  1P1N A;  5ICQ A;  4ZEK A;  5CC2 A;  2E0S A;  3TQW A;  1PBQ A;  3GBB A;  1WDN A;  4NWD A;  4E0W A;  4ECF A;  1B0L A;  1SI0 A;  3O29 A;  1B5I A;  1VSO A;  3MWB A;  1RYO A;  4L17 A;  4HW8 A;  2H9B A;  1Z7N E;  3HPI A;  3PUX E;  3RT6 B;  3T96 B;  4ZEB A;  1MQH A;  1LAX A;  1MY1 A;  2VD3 A;  5K2Y A;  4ESX A;  4MLV A;  3PGF A;  2GHB A;  1YAE A;  2OWT A;  2ZNS A;  5H8N B;  3OEM A;  1RKM A;  2I4C A;  4ELP A;  3VXB A;  4AB6 A;  1PB7 A;  1SW1 A;  1MPD A;  2B65 A;  2Y7R A;  5A5X A;  1AIV A;  3L6G A;  1JW1 A;  3K0V A;  5CBR A;  4KPT A;  3PPQ A;  3G3K A;  1A8F A;  1A99 A;  4E0X A;  4F1Y A;  1B1H A;  2OZZ A;  5ITO A;  4Q8R A;  2THI A;  4R74 A;  5CI5 A;  5FHN A;  2XXV A;  5I2N B;  4N13 A;  4OES A;  5BWJ A;  4OTE A;  2E1S A;  2GHA A;  4NF4 A;  1H43 A;  1LAG E;  2BJJ X;  2HCA A;  3DP8 A;  4X1D A;  4YKP A;  1FTK A;  2NOO A;  3FJG A;  1B32 A;  4NF6 A;  4NMY A;  4QFO A;  2QMW A;  4JWY A;  1A40 A;  2DSF A;  1FTO A;  2OCU A;  5B70 A;  3C9H A;  1IXI A;  3FXU A;  4IY5 A;  4PFY A;  4GL0 A;  5ITP A;  1I69 A;  2UYE A;  4F3P A;  1IQ7 A;  1LLS A;  4F22 A;  2Q2A A;  3E9X A;  4FEC A;  4ISU A;  4MLQ A;  3KEI A;  4NF5 B;  4BDR A;  3KBR A;  4BLA A;  2Q88 A;  4U22 A;  3FVK A;  2DWA A;  1ZKB A;  4ZZE A;  3MPL A;  1QJM A;  1SI1 A;  4ZZA A;  3T9H B;  3EF7 A;  4H65 A;  1B4Z A;  2B3F A;  2O51 A;  4OHN A;  2ZYN A;  1T0K A;  4KHZ E;  3IJX B;  4YB7 A;  1N76 A;  4GIZ A;  3RN8 A;  2ZYO A;  2Q9T A;  1D9Y A;  3LSL A;  4KYE A;  4BDN A;  3EHT A;  3H3G A;  3SEV A;  4MF3 A;  3PMV A;  3PUY E;  4RK2 A;  1N84 A;  1IXG A;  2V93 A;  1GR2 A;  1PDA A;  3K1M A;  3KSJ A;  3RUM A;  1EU8 A;  1DMB A;  3C4M A;  1B51 A;  1LAF E;  3HV1 A;  3N5L A;  4UA8 A;  1A55 A;  3VV5 A;  4JXI A;  1DPP A;  1FQB A;  2FYI A;  2RCA A;  3BBR A;  4F3G A;  1Y20 A;  4OZ9 A;  2F34 A;  4GXS B;  4FAJ A;  4Z7E A;  1GTK A;  5KCJ A;  2VP1 A;  3MZB A;  2DE2 A;  2I3V A;  4ZED A;  2AIX A;  3G7W A;  4PP0 A;  1LBC A;  4LZ8 A;  1H3D A;  4X1B A;  2F78 A;  3FVO A;  1JEV A;  3LSF B;  4QSD A;  1USY E;  3TAJ A;  2DYX A;  4EF2 A;  3QYT A;  1WVJ A;  1B3F A;  1SW2 A;  4KD5 A;  1R6Z A;  3OD7 A;  1B1X A;  2QRY A;  3MW0 A;  3TTN A;  4NF8 B;  3TTL A;  4ELO A;  1OLA A;  5J1D A;  4U2R A;  4THI A;  5H8F B;  1B52 A;  1BP5 A;  3TCG A;  1BLF A;  2HAV A;  1NH8 A;  2VOZ A;  1TWY A;  3KFM A;  1IXH A;  4OQO A;  3SES A;  4HCY A;  3VE1 B;  4OFL A;  3R6U A;  4GQO A;  1XS5 A;  1N3X A;  1B7Z A;  5AA4 B;  5FTI A;  5JTY A;  2XXY A;  1JEU A;  4QFN A;  4U23 A;  5H8Q B;  3OSR A;  2I49 A;  4JWO A;  3FGS A;  2DE4 A;  1MXW A;  1NKX A;  2QL3 A;  3P7I A;  3K01 A;  3O6G A;  3JV9 A;  3R26 A;  2REG A;  4EXL A;  1EZO A;  4ELQ A;  1FTL A;  4YZZ A;  1MPB A;  4KCC A;  1JVX A;  1URD A;  3LBS A; 
#chains in the Genus database with same CATH topology
 1UTH B;  3V8X B;  4P0G A;  4R2B A;  1YXI A;  5EYF A;  1MXY A;  5ELV A;  3H6W A;  3TEL A;  5CBS A;  3T9U A;  4N81 A;  3TEP A;  2PCR A;  1NV4 A;  4XKN A;  4QF9 A;  2XD3 A;  5M2V A;  1B5H A;  4H46 A;  4PBH A;  3MVZ A;  2I3W A;  4OYV A;  4PC9 A;  4GL8 A;  1KA1 A;  2P3V A;  4U1Z A;  3TTK A;  3HCQ A;  5AA4 A;  2O69 A;  3SEX A;  2F7C A;  4NF4 B;  1QUI A;  1SD3 A;  1Y1Z A;  1FPG A;  2A5T B;  5B7D A;  2KQZ A;  3IB1 A;  1NV6 A;  1B3E A;  1B5J A;  2Q74 A;  3OEL A;  3AXF A;  4PF8 A;  2HAU A;  1FBG A;  3T9V A;  4EUO A;  5TP9 A;  1ANF A;  1PB9 A;  1IMB A;  3ISP A;  4KQP A;  2P2A A;  3E4R A;  3OEK A;  5I58 B;  2CZK A;  1Y3P A;  4G8N A;  1POY 1;  2AYS A;  5IZZ A;  1DPE A;  1RYX A;  2CMO A;  4F2O A;  2PBW A;  2QS1 A;  1FJ6 A;  1SQY A;  2P3N A;  3EHU A;  4C0R A;  3G3H A;  2DWH A;  2DXY A;  2WBB A;  4O3A A;  1II5 A;  4KYS A;  1M5D A;  1O63 A;  4WKM A;  5K2X A;  3T66 A;  2ONS A;  3O66 A;  3CVG A;  4X48 A;  3THI A;  1DTZ A;  5LTC A;  3BFU A;  2ALU A;  1LAH E;  2RCB A;  2UVG A;  4NF0 A;  4MX6 A;  2OWS A;  2O7I A;  3D4C A;  2Y5L A;  3CG3 A;  3FJ7 A;  3HN0 A;  4GWS A;  3E13 X;  4ZDM A;  2XWV A;  2P1S A;  2B4M A;  2BJI A;  2CZH A;  4PFI A;  2Q8J A;  4YB6 A;  1P1U A;  3KJT A;  1A54 A;  3A3C A;  3MP6 A;  2ZZX A;  4Z0I A;  2D5W A;  4IGT A;  1CB6 A;  4PQJ A;  3IOU A;  2OK2 A;  4U1O A;  2X26 A;  1OMP A;  3IOT A;  1UQW A;  4ONY A;  4IO4 A;  1ZBM A;  3TYH A;  4LAT A;  2DQV A;  3F11 A;  2O68 A;  1SVX B;  4P9K A;  4OVT A;  4P8B A;  4R6Y A;  1POT A;  4YKI A;  5CMC A;  4KFQ A;  4ZEF A;  2PT1 A;  2DWI A;  1NV0 A;  4LZ7 A;  1B3G A;  4QHQ A;  1FW0 A;  4EQ7 A;  4OET A;  3TKD A;  4X04 A;  3SDF A;  1MPC A;  3N26 A;  1D3K A;  1YTV A;  1MRP A;  3H6V A;  3PMX A;  3Q27 A;  4MH5 A;  1VDW A;  1LBY A;  4OWD A;  3VVD A;  5DVF A;  4H5F A;  1URS A;  4GBV A;  2V3T A;  4U4X A;  3Q28 A;  5CM6 A;  4EXK A;  2UXA A;  2R71 A;  2YPN A;  4IGR A;  3KN3 A;  5EQ8 A;  2HZL A;  3CR9 A;  3ODB A;  3TOD A;  1FPK A;  2H25 A;  1P99 A;  4KI0 E;  1YCJ A;  3MP8 A;  3ZS6 A;  1VE4 A;  4BDQ A;  4RK9 A;  2YJP A;  2X7Q A;  4C1U A;  1VFD A;  3U1O A;  5CMK A;  1Y1M A;  5AA2 A;  2V3U A;  4KR5 A;  2O6A A;  5DYH A;  3FXB A;  1FQE A;  1LBV A;  1LCT A;  4LA9 A;  5TPA A;  1MQI A;  2XX8 A;  2RIN A;  3B6Q A;  3TPA A;  5HM4 B;  4GWZ A;  5I59 A;  2HHM A;  4LUB A;  3BFT A;  3K1P A;  4R2F A;  4F3S A;  2VGQ A;  4WXJ A;  1H76 A;  1LFG A;  3H06 B;  4ZE9 A;  3OMB A;  5I59 B;  5I2N A;  4RYA A;  2G29 A;  4POX A;  4JWX A;  1IMC A;  3O2A A;  2Y7P A;  2QS2 A;  4K3F A;  4NF6 B;  4X8R A;  1ZJL A;  3MP1 A;  3MST A;  2JJK A;  3U92 A;  2XWO A;  4XTC Q;  3UP9 A;  5L9S A;  2GQ1 A;  3PPR A;  3M3F A;  3N94 A;  3C31 A;  2ZZW A;  3OO7 A;  2QVU A;  4QSC A;  2QFL A;  3KN7 A;  3IOR A;  1EYI A;  3V5A A;  3PPO A;  2XXT A;  3PTY A;  2O1M A;  3CSB A;  3KGC A;  1ZLQ A;  1JW4 A;  5I2K B;  1B7H A;  4IR8 A;  3Q29 A;  3H6T A;  1WOD A;  4R9G A;  4HTG A;  3T93 B;  2PMS A;  3DP4 A;  3FV1 A;  4KYD A;  4IB2 A;  2WKY A;  5ICQ A;  1PBQ A;  3GBB A;  4NWD A;  4ECF A;  3CHG A;  1RYO A;  4HW8 A;  3T96 B;  3HPI A;  3PUX E;  1MQH A;  1LAX A;  5K2Y A;  4GX3 A;  1YAE A;  2I4C A;  4AB6 A;  1PB7 A;  1SW1 A;  2B65 A;  1JW1 A;  3PPQ A;  4G61 A;  4JVC A;  2OZZ A;  5CI5 A;  4N4U A;  2GHA A;  3BIH A;  2HCA A;  1FTK A;  4QFO A;  4JWY A;  4P47 A;  1A40 A;  2DSF A;  1IXI A;  5ITP A;  3GYY A;  4MLQ A;  4MMP A;  3KBR A;  4U22 A;  3FVK A;  3T9H B;  5EYH A;  1B4Z A;  4YB7 A;  1N76 A;  4BDN A;  3H3G A;  4MF3 A;  3PUY E;  1N84 A;  5IZ3 A;  3KSJ A;  3C4M A;  1A55 A;  1SPI A;  4JXI A;  2Y5K A;  4LN5 A;  2RCA A;  1Y20 A;  4GXS B;  1G0I A;  3MZB A;  2AIX A;  4LZ8 A;  4QSD A;  4XEQ A;  4KD5 A;  1R6Z A;  3TTN A;  4ELO A;  4NF8 B;  1OLA A;  4OQO A;  3SES A;  4GWX A;  1JEU A;  2DE4 A;  2REG A;  4H65 A;  3IL1 B;  5DW8 A;  3LBS A;  3TUS A;  4NF8 A;  3USD A;  5HPQ A;  2I0B A;  4BDM A;  1Y9U A;  2Y7W A;  1ZU0 A;  3KG2 A;  4G68 C;  1KZ8 A;  4HCW A;  3FJM A;  2HZK A;  3Q26 A;  1NV7 A;  2RKM A;  1YYZ A;  4ND9 A;  4LQ5 A;  1TFD A;  2HEU A;  2NWJ A;  1JNF A;  1DSN A;  3RYD A;  1H45 A;  3EHS A;  3T9X B;  1PB8 A;  3UA8 A;  1M5C A;  2CZI A;  1FTM A;  2IEE A;  4RY1 A;  1DBZ A;  1NUZ A;  3DEL B;  3ZKK A;  3MVX A;  2Z23 A;  4I8C A;  3FVN A;  2GH9 A;  1H44 A;  1MQJ A;  3QSL A;  3PUZ E;  4HXV A;  1QGX A;  1QUJ A;  1YZ0 A;  2PYY A;  3S9E A;  4RXL A;  3HO7 A;  4JSD A;  3K00 A;  2QMX A;  5F7V A;  3LR1 A;  1IUD A;  3C36 A;  2O84 X;  3M3K A;  2Z8D A;  3L6H A;  4O7I A;  1HSJ A;  4ZS9 A;  2CZL A;  2XXR A;  3FAS A;  3TTR A;  4XKR A;  4YIC A;  2ONK E;  4NGU A;  4P0I A;  1FBE A;  1US5 A;  3MUQ A;  4PBQ A;  5H8F A;  4H67 A;  4GX4 A;  3OO6 A;  3EQ1 A;  1Z7M E;  4OVQ A;  2XXU A;  4PDD A;  3JYR A;  1N3W A;  2DWJ A;  3CFZ A;  3MVW A;  4Q30 B;  5I57 B;  4DLD A;  1FBC A;  3CFX A;  1Q9D A;  5EQ7 A;  2HFB A;  1N7X A;  2ESN A;  4LP2 B;  4RJZ A;  5I58 A;  3A09 A;  4NAP A;  3RTF B;  2V4C A;  2F7A A;  4JSO A;  2CEX A;  1NUW A;  3CIJ A;  4I62 A;  3MQ9 A;  3UN6 A;  2Y7K A;  3U94 A;  2PVU A;  5HBC A;  1FCK A;  4IO7 A;  1B6H A;  1BIY A;  2A5S A;  3D1R A;  4OA4 A;  2QS4 A;  3I3V A;  3IFC A;  2OWZ A;  2XXP A;  4YKK A;  3DP6 A;  4R75 A;  4RNS A;  2O1L A;  1LBB A;  3EN3 A;  1EYJ A;  1FBF A;  5T3J A;  4HS7 A;  3TQL A;  1JW5 A;  3UOR A;  3GZG A;  2V3Q A;  3HHF A;  1IME A;  3IOV A;  3UIF A;  2FIE A;  1FQD A;  3R7X A;  4GX6 A;  2L5V A;  3CI8 A;  4QFL A;  3SET A;  2I48 A;  4IY6 A;  5CMM A;  4O3B A;  4IO3 A;  4OVJ A;  1CNQ A;  3CFL A;  4N8Y A;  2UVI A;  1HSL A;  3H7M A;  4I3E A;  2FA7 A;  3M8U A;  3PUV E;  4QFK A;  5H8N A;  4BDO A;  4C1T A;  3VVF A;  1TFA A;  5IAI A;  4N07 A;  4NTL A;  5ESY A;  2H4I A;  3K02 A;  1R9Q A;  1DTG A;  1UTB A;  2V84 A;  3RLF E;  4AS4 A;  4I9D A;  1EH3 A;  4H8J A;  1AL3 A;  3KJ7 A;  2I4B A;  4IO5 A;  2KLF A;  5H8H A;  1YPN A;  2P0S A;  4MBP A;  1PEB A;  4TLL B;  4XXU A;  2F8D A;  3O6H A;  1O7T A;  1MY3 A;  1LEV A;  3H4Z A;  2WBD A;  1URG A;  1US4 A;  5FTH A;  2XA5 A;  3WAF A;  2F97 A;  3FIR A;  4AS5 A;  1FPF A;  1XOC A;  3MZ9 A;  2DVZ A;  3G3F A;  3IAZ A;  2F6G A;  4U21 A;  3RPW A;  3T22 A;  4G68 A;  4FIM A;  2B3B A;  4GWY A;  1R1N A;  1M5F A;  2F3D A;  2ZNU A;  4UAC A;  3S9M C;  4NE4 A;  4O8M A;  3Q25 A;  2UYF A;  3C33 A;  4OEN A;  4PFR A;  3U8Q A;  4QSE A;  1I6A A;  2B4L A;  1J1N A;  3LC8 A;  3HHG A;  1S50 A;  4O7M A;  1QUK A;  1INP A;  3GXA A;  3RTW B;  4DCX A;  1GV8 A;  4DCY A;  4OXV A;  2LAO A;  5H8S A;  1NNP A;  4GXA A;  5KZT A;  2XHD A;  4RA1 A;  3M3L A;  1B58 A;  1B7U A;  1MXU A;  3RPL A;  2Y84 A;  1NV1 A;  4DDD A;  4P1L A;  5F1Q A;  5KCJ B;  5EHS A;  5ET7 A;  4LQ2 A;  4R72 A;  2I6E A;  2DE3 A;  3PMW A;  1DCU A;  4MEV A;  2PX1 A;  5CRY A;  3RT8 A;  1Y3N A;  4PF6 A;  1SW5 A;  4XKQ A;  1IEJ A;  2F5X A;  3TMG A;  1LGB C;  2UVH A;  4JBZ A;  5LOM A;  3ONM A;  4HE2 A;  1VSO A;  3MWB A;  1Z7N E;  4MLV A;  4PAK A;  1RDZ A;  1RKM A;  4ELP A;  3VXB A;  4N6K A;  1MPD A;  2Y7R A;  5A5X A;  4KPT A;  3SZP A;  5EYG A;  1IMD A;  3G3K A;  1A99 A;  4F1Y A;  1B1H A;  5ITO A;  4Q8R A;  5FHN A;  4N13 A;  4NF4 A;  2BJJ X;  3DP8 A;  4NMY A;  2QMW A;  1XI6 A;  2F3B A;  3C9H A;  1I69 A;  2UYE A;  3E9X A;  4NF5 B;  2Q88 A;  2DWA A;  3MPL A;  1SI1 A;  4ZZA A;  3EF7 A;  2VPN A;  3RN8 A;  4N6D A;  3LSL A;  4KYE A;  3RUM A;  1EU8 A;  3N5L A;  1DPP A;  4XF5 A;  4OZ9 A;  4Z7E A;  4FAJ A;  5KCJ A;  2CEY A;  1LBC A;  1JEV A;  3QYT A;  1WVJ A;  1B3F A;  1B1X A;  2QRY A;  3MW0 A;  4U2R A;  4FBP A;  1BP5 A;  1BLF A;  3KFM A;  1TWY A;  4OFL A;  3R6U A;  2DDK A;  5AA4 B;  2XXY A;  5H8Q B;  2I49 A;  2QL3 A;  1MXW A;  3O6G A;  4EXL A;  2XXK A;  1MPB A;  2NXO A;  2WEF A;  3KN8 A;  1MH3 A;  4YMA A;  3C34 A;  2XXH A;  1LST A;  4F3B A;  4XKP A;  5I2K A;  4P56 A;  1FPJ A;  5JEI A;  5J16 A;  4PGN A;  5DVI A;  1AH5 A;  1ZTY A;  3C35 A;  4GLI A;  1AMF A;  1P1W A;  5AA2 B;  3K1N A;  2ZYM A;  4GWO A;  2XXI A;  2QPQ A;  1IIW A;  4OAN A;  4F19 A;  2ZYK A;  1KWH A;  4H0W A;  4MNI A;  2WYK A;  4OMB A;  2VT5 A;  4DXC A;  1QKB A;  1NNK A;  3HST A;  2OLB A;  4JVD A;  2ONR A;  1IZ1 A;  2H99 A;  3W9W A;  3ZKL A;  4G2Z A;  4LON B;  1EYK A;  2Z8F A;  1Y4T A;  2F35 A;  3OEN A;  4R73 A;  3LV0 A;  4PDH A;  2HXW A;  1MDP 1;  4JB7 A;  1EZP A;  1AOV A;  1FPB A;  3C32 A;  3PPP A;  5I56 B;  2F6P A;  3TCH A;  3PPN A;  3KSX A;  4G77 A;  1SDX A;  3KC0 A;  2PT2 A;  2GFE A;  1UIU A;  1XVX A;  4FE8 A;  3U72 A;  3LSX A;  3IJO B;  1GGG A;  4QBA A;  4HE0 A;  5FHO A;  3S9L C;  1MH4 A;  1MY2 A;  4P11 A;  1Q1K A;  3OO9 A;  1NH7 A;  1MQG A;  4H45 A;  4FEB A;  4TQU Q;  1JVY A;  1B9J A;  2FBP A;  3IB0 A;  3HFU A;  1K9Z A;  3O6I A;  1MM6 A;  5I7I A;  2D3I A;  3QUJ A;  3SEY A;  1IIT A;  4F1V A;  4YU0 A;  3U65 A;  3VDF A;  2H98 A;  1MG1 A;  1OIB A;  3LSW A;  1QUL A;  3MYU A;  4NX1 A;  1XC1 A;  1BTJ A;  2I58 A;  5JK4 A;  4R9F A;  3G3J A;  4R6H A;  3FXQ A;  3E79 A;  1Y3Q A;  4FOR A;  5DEX B;  3IOW A;  3SEW A;  4GWW A;  3N6U A;  2QVR A;  3QMF A;  3D4G A;  3VLV A;  1O64 A;  1XHY A;  3PU5 A;  4OEU A;  1DOT A;  1N04 A;  1TXF A;  2OX3 A;  5L9M A;  1ATG A;  2RF1 A;  4F39 A;  3OO8 A;  4DXU A;  2ANJ A;  5EQA A;  4PET A;  3A29 A;  2I0C A;  2Q89 A;  5KDT A;  3LUZ A;  4RPN A;  4DI3 D;  4R6K A;  4ZEI A;  1D4N A;  3EPE A;  3KZG A;  5I56 A;  4M1V A;  2FIX A;  1LBW A;  3S4U A;  1A7L A;  3FV2 A;  4IO6 A;  2HPG A;  4RPO A;  1LBZ A;  3UGW A;  4X9T A;  5TU0 A;  4MJO A;  4POW A;  3SKP A;  1MY0 A;  2AL5 A;  3B8B A;  5DT6 A;  2XXX A;  1ZIU A;  1MXV A;  4FAT A;  1OQH A;  2XX7 A;  3RY3 A;  5IKB A;  5IZ3 B;  4I3Y A;  3FAT A;  4EDP A;  3MAM A;  3RGY A;  3SER A;  3FD3 A;  5DEX A;  4NHB A;  5FHM A;  5I5P A;  4MIJ A;  5CMB A;  3V89 B;  3VXC A;  3FUZ A;  3MPK A;  4NQ8 A;  4PFT A;  3IO4 A;  1FTJ A;  4XFE A;  5JTY B;  1BKA A;  3IK6 B;  5ICT A;  3IO6 A;  1FBH A;  4PE5 B;  1P1Q A;  2Z8E A;  1MXX A;  2WYP A;  3TZA A;  1Q35 A;  4JDF A;  1R9L A;  4DE8 A;  3ZSF A;  1LFI A;  1SBP A;  1FJ9 A;  3JZJ A;  4HE1 A;  1B2H A;  3SEU A;  3IX1 A;  4OVS A;  4F2Q A;  4AB5 A;  5ET6 A;  4I40 A;  1FQC A;  1QW0 A;  1XT8 A;  3MC2 A;  3BIG A;  1B05 A;  3W15 C;  1TT1 A;  1B46 A;  1NI9 A;  3K2D A;  5AA2 D;  4YB5 A;  2GRV A;  1QKA A;  3B6T A;  1DK4 A;  3MJN A;  4GBW A;  3RQT A;  1S7Y A;  3MBP A;  3ECR A;  5EHM A;  4Q5T A;  2M8C A;  2DVC A;  2RC9 A;  4F18 A;  2D21 A;  4DIG A;  1FTA A;  4PE3 A;  2WX9 A;  4XIG Q;  3TTM A;  3IB2 A;  4LZ5 A;  4YKJ A;  4TOZ A;  3VFJ A;  4NF5 A;  3PD9 A;  1OVB A;  2F36 A;  2XD2 A;  4GVO A;  1SW4 A;  2Q8M A;  1P1N A;  5CC2 A;  4EF1 A;  4E0W A;  1B0L A;  4N15 A;  5ET8 A;  2H9B A;  4ZEB A;  1MY1 A;  2FVZ A;  4ESX A;  2OWT A;  2ZNS A;  5H8N B;  5ET5 A;  1A8F A;  4E0X A;  4NG7 A;  4R74 A;  4GWU A;  5BWJ A;  1NUX A;  2PFY A;  2E1S A;  1LAG E;  3KBZ A;  2NOO A;  3FJG A;  4NF6 A;  1FTO A;  2OCU A;  5B70 A;  3FXU A;  4IY5 A;  4GL0 A;  1IQ7 A;  1LLS A;  2PFZ A;  2Q2A A;  4F22 A;  2ZZV A;  1ZKB A;  1QJM A;  1K9Y A;  2B3F A;  2O51 A;  2ZYN A;  3IJX B;  4GIZ A;  2Q9T A;  5I3S A;  3EHT A;  1BK4 A;  3PMV A;  4RK2 A;  1IXG A;  1GR2 A;  1DMB A;  1LAF E;  3VV5 A;  1RDX A;  2FYI A;  4F3G A;  2DE2 A;  2I3V A;  3G7W A;  4X1B A;  2F78 A;  1USY E;  2DYX A;  4EF2 A;  1SW2 A;  2XWI A;  3OD7 A;  5J1D A;  4THI A;  5H8F B;  2HAV A;  1NH8 A;  2VOZ A;  1IXH A;  3VE1 B;  4HCY A;  1XS5 A;  1B7Z A;  5FTI A;  5JTY A;  4QFN A;  4JWO A;  3P7I A;  3K01 A;  3JV9 A;  4ELQ A;  1FTL A;  3GLB A;  1FBD A;  1ELJ A;  1N0T A;  2VD2 A;  5AA1 A;  4M4G A;  3NOH A;  2AL4 A;  4F31 B;  5IGA A;  1B40 A;  2XWK A;  1NUY A;  4IO2 A;  4WEP A;  1Y4C A;  3FZV A;  1NFT A;  4H5G A;  3LUY A;  3E3K A;  1UTH A;  1XVY A;  2RC8 A;  3U93 A;  1B3L A;  4ZE8 A;  1SYH A;  5AE4 A;  3VVE A;  1OLC A;  4OVR A;  4H1X A;  3DLN A;  1MDQ A;  1NNT A;  2FNC A;  2MKZ A;  2DXR A;  2H5Y A;  1PC3 A;  1IMF A;  4LVQ A;  4OFO A;  3TCF A;  1LB8 A;  4PFW A;  3V83 A;  4MFI A;  3ROJ A;  3TFL A;  1OVT A;  3T0J A;  4P3L A;  4BDL A;  1JET A;  4I1D A;  4MNP A;  2OJT A;  1FPE A;  1VFE A;  3FXR A;  3UK4 A;  1GVC A;  2VPO A;  3K6X A;  4UAB A;  3GBA A;  1B3H A;  1NV3 A;  1F9B A;  4ESW A;  3K6U A;  1RDY A;  3IFA A;  4PFU A;  1VR5 A;  1CE2 A;  2A5T A;  4KCD A;  3H03 A;  5DTB A;  2Q2C A;  2V25 A;  3KOS A;  1M5E A;  5DVJ A;  4F1U A;  4G8H A;  1P1O A;  2FHY A;  3B7D A;  4FED A;  2Y7I A;  1NV2 A;  3K6V A;  1ZMG A;  4N6P A;  5A5L A;  2X7P A;  4GRK A;  4MHF A;  2DP8 A;  4YAH X;  3O97 A;  1NMU A;  2ZXT A;  3I5O A;  4GD5 A;  3S9N C;  2DS9 A;  3B50 A;  1FQA A;  2R9J A;  3MZ1 A;  5H8Q A;  1HSE A;  3QK6 A;  2F7B A;  3RNN A;  3OSQ A;  4H6D A;  4PAI A;  3FBP A;  1FQF A;  4EQ9 A;  3PD8 A;  4KXP A;  2IA4 A;  4YMB A;  1M5B A;  5TPA B;  4Q0C A;  1MQD A;  3ILT B;  1NNF A;  4QXD A;  1LCF A;  1I6B A;  1N7W A;  5ISU A;  2NVU B;  3PUW E;  4OEV A;  2KR0 A;  5AA3 A;  1LBX A;  1B4H A;  3QUF A;  5BUU A;  1IXC A;  2QS3 A;  3G3G A;  1MY4 A;  3VLU A;  4P1E A;  2ZNT A;  3FVG A;  4O94 A;  5A5X B;  4G68 B;  5LDZ A;  1PBP A;  4EQB A;  3A3U A;  4MAG A;  2XXQ A;  2Z22 A;  3IR1 A;  2HQ0 A;  3QXM A;  4MCO A;  3VLW A;  1UIV A;  5I84 A;  1S9T A;  4GFR A;  4GOT A;  4WED A;  1NV5 A;  5L9O A;  4GF8 A;  3EKI A;  3TDJ A;  3KOT A;  1LB9 A;  3O28 A;  1EZ9 A;  4QRZ A;  1SYI A;  1QVS A;  2ZMB A;  2ABH A;  4DXB A;  3DM0 A;  3I6V A;  3RPL B;  5KDT B;  4H8I A;  3G3I A;  1USY H;  4N91 A;  3CG1 A;  4ZEC A;  2G93 A;  3W9V A;  2RC7 A;  4NN3 A;  4JVI A;  4PTK A;  4OER A;  2W7Y A;  3CRB A;  4AQ4 A;  4PFB A;  1MM7 A;  3K6W A;  2QSX A;  4FJP A;  4G4P A;  5IZ1 A;  4ELR A;  1D9V A;  4G8M A;  5F24 A;  1OQG A;  1I6Q A;  3QAX A;  1L5T A;  1FPL A;  3OXN A;  1FBP A;  2OBG A;  2UVJ A;  2XXW A;  1JP4 A;  1UTB B;  4OVP A;  5L8D A;  4QFP A;  3K4U A;  5I57 A;  3CSG A;  4TLM B;  5H8H B;  1MS7 A;  1A8E A;  3N6T A;  3QIM A;  1G0H A;  2R6G E;  5TP9 B;  4OFJ A;  4MNC A;  1KA0 A;  2NUV A;  1B0H A;  4F29 A;  3O9P A;  3PV0 E;  4NWC A;  2QVV A;  2XX9 A;  1IMA A;  1JQF A;  4U4S A;  1FPD A;  1NL5 A;  3ILU B;  1LFH A;  2QJE A;  1FPI A;  3BKI B;  5EQ9 A;  3H6U A;  1MXZ A;  2DOJ A;  2O7U A;  3S2V A;  2REJ A;  3B6W A;  4NED A;  3MVY A;  3WAE A;  3OOA A;  4O3C A;  4DI4 B;  3KC1 A;  2VHA A;  2YLN A;  4DZ1 A;  4PCD A;  4ZEK A;  2E0S A;  3TQW A;  1WDN A;  1SI0 A;  3O29 A;  1B5I A;  4L17 A;  3RT6 B;  1D9Q A;  2VD3 A;  3PGF A;  2GHB A;  3OEM A;  1AIV A;  3L6G A;  3K0V A;  5CBR A;  2THI A;  5I2N B;  2XXV A;  4OES A;  4OTE A;  1H43 A;  4X1D A;  4YKP A;  1B32 A;  4PFY A;  4F3P A;  4BDR A;  4FEC A;  4ISU A;  3KEI A;  2HXR A;  4BLA A;  3T1B A;  4ZZE A;  5FBP A;  4OHN A;  1T0K A;  4KHZ E;  4N17 A;  2ZYO A;  4PGP A;  1D9Y A;  1AWB A;  3SEV A;  2V93 A;  3K1M A;  1PDA A;  5IM2 A;  1B51 A;  3HV1 A;  4UA8 A;  1FQB A;  3BBR A;  2F34 A;  1GTK A;  2VP1 A;  4ZED A;  4PP0 A;  1H3D A;  3FVO A;  3LSF B;  3TAJ A;  3TTL A;  3E78 A;  1B52 A;  4N8G A;  3TCG A;  4GQO A;  1N3X A;  4U23 A;  3OSR A;  1FRP A;  3FGS A;  1NKX A;  3R26 A;  4PAF A;  1EZO A;  2R8T A;  1FSA A;  4YZZ A;  4KCC A;  1JVX A;  1URD A; 
#chains in the Genus database with same CATH homology
 3TUS A;  3GLB A;  2NXO A;  4NF8 A;  3USD A;  1UTH B;  3KN8 A;  5HPQ A;  1MH3 A;  3V8X B;  2I0B A;  1ELJ A;  1N0T A;  4BDM A;  4YMA A;  2VD2 A;  2XXH A;  3C34 A;  4P0G A;  5AA1 A;  1LST A;  4M4G A;  4F3B A;  4XKP A;  5I2K A;  1Y9U A;  4R2B A;  2Y7W A;  5EYF A;  1ZU0 A;  2AL4 A;  1MXY A;  5ELV A;  3KG2 A;  4G68 C;  3H6W A;  3TEL A;  1B40 A;  4F31 B;  5CBS A;  5JEI A;  4HCW A;  3T9U A;  3FJM A;  4IO2 A;  3TEP A;  5DVI A;  1AH5 A;  2HZK A;  4WEP A;  3Q26 A;  1Y4C A;  4XKN A;  1ZTY A;  3C35 A;  2RKM A;  4GLI A;  1AMF A;  1P1W A;  5AA2 B;  3FZV A;  4ND9 A;  2XD3 A;  3K1N A;  4QF9 A;  5M2V A;  1B5H A;  1NFT A;  2ZYM A;  4LQ5 A;  4H5G A;  4GWO A;  3LUY A;  3E3K A;  1UTH A;  2I3W A;  2QPQ A;  2XXI A;  1XVY A;  2RC8 A;  3MVZ A;  4OYV A;  1IIW A;  4F19 A;  4GL8 A;  3U93 A;  1B3L A;  1TFD A;  2ZYK A;  1SYH A;  4ZE8 A;  2HEU A;  5AE4 A;  1KWH A;  4H0W A;  2NWJ A;  3VVE A;  1OLC A;  4U1Z A;  1JNF A;  1DSN A;  4H1X A;  3TTK A;  3DLN A;  3HCQ A;  4OMB A;  1MDQ A;  1H45 A;  1NNT A;  2FNC A;  5AA4 A;  2DXR A;  3EHS A;  5CMK A;  3T9X B;  2H5Y A;  1QKB A;  1PB8 A;  1NNK A;  1PC3 A;  4DXC A;  3HST A;  2O69 A;  1M5C A;  2OLB A;  4LVQ A;  3SEX A;  2F7C A;  2ONR A;  3UA8 A;  4OFO A;  1IZ1 A;  2H99 A;  4NF4 B;  1QUI A;  3TCF A;  3W9W A;  1FTM A;  3ZKL A;  1LB8 A;  2IEE A;  4PFW A;  1SD3 A;  1Y1Z A;  4MFI A;  3V83 A;  3TFL A;  1OVT A;  4G2Z A;  2A5T B;  4RY1 A;  3DEL B;  4LON B;  3ZKK A;  1JET A;  2Z8F A;  3MVX A;  4BDL A;  5B7D A;  2Z23 A;  1Y4T A;  2F35 A;  4I8C A;  3IB1 A;  4I1D A;  3OEN A;  3FVN A;  2GH9 A;  4R73 A;  1B3E A;  1H44 A;  2OJT A;  1B5J A;  1VFE A;  3UK4 A;  3FXR A;  1GVC A;  1MQJ A;  2HXW A;  3OEL A;  1MDP 1;  3K6X A;  3QSL A;  3PUZ E;  3GBA A;  4JB7 A;  1B3H A;  3AXF A;  1EZP A;  1QUJ A;  1F9B A;  2HAU A;  1AOV A;  4ESW A;  2PYY A;  3S9E A;  3C32 A;  3K6U A;  3HO7 A;  3PPP A;  4RXL A;  3T9V A;  2F6P A;  5I56 B;  3TCH A;  3PPN A;  5TP9 A;  1ANF A;  1PB9 A;  3KSX A;  4G77 A;  1SDX A;  1VR5 A;  4PFU A;  1CE2 A;  2PT2 A;  4JSD A;  2A5T A;  3K00 A;  4KCD A;  2GFE A;  1UIU A;  2P2A A;  4KQP A;  1XVX A;  4FE8 A;  2QMX A;  3H03 A;  3E4R A;  5F7V A;  3OEK A;  2Q2C A;  2V25 A;  5DTB A;  3LSX A;  3U72 A;  4AQ4 A;  3IJO B;  3KOS A;  1GGG A;  5I58 B;  3LR1 A;  1M5E A;  1Y3P A;  1IUD A;  1POY 1;  4G8N A;  5DVJ A;  3C36 A;  5FHO A;  4F1U A;  2O84 X;  3M3K A;  2Z8D A;  3L6H A;  2AYS A;  4G8H A;  1HSJ A;  1P1O A;  1DPE A;  4ZS9 A;  3B7D A;  4FED A;  2CZL A;  2XXR A;  2Y7I A;  3FAS A;  3S9L C;  1MH4 A;  1MY2 A;  1RYX A;  1Q1K A;  4P11 A;  2CMO A;  4XKR A;  3OO9 A;  3TTR A;  4YIC A;  2ONK E;  4F2O A;  1NH7 A;  2PBW A;  2QS1 A;  3K6V A;  4P0I A;  1MQG A;  1SQY A;  1ZMG A;  4FEB A;  4EF1 A;  3EHU A;  4N6P A;  1US5 A;  3MUQ A;  4C0R A;  3G3H A;  5H8F A;  4TQU Q;  2X7P A;  4GRK A;  4H67 A;  1JVY A;  1B9J A;  2DXY A;  2DWH A;  2DP8 A;  4O3A A;  1II5 A;  3OO6 A;  3IB0 A;  3EQ1 A;  4KYS A;  4YAH X;  1M5D A;  1O63 A;  1NMU A;  3O97 A;  1Z7M E;  4WKM A;  2ZXT A;  5K2X A;  3I5O A;  2XXU A;  4GD5 A;  3O6I A;  1MM6 A;  3JYR A;  2DS9 A;  3S9N C;  1N3W A;  3T66 A;  2D3I A;  3QUJ A;  2DWJ A;  3SEY A;  1FQA A;  2ONS A;  3CFZ A;  3CVG A;  3O66 A;  1IIT A;  4X48 A;  3THI A;  2R9J A;  3MVW A;  1DTZ A;  4Q30 B;  3MZ1 A;  4F1V A;  4YU0 A;  4DLD A;  3BFU A;  5I57 B;  2ALU A;  1LAH E;  3VDF A;  2H98 A;  1MG1 A;  1OIB A;  2RCB A;  3CFX A;  5H8Q A;  1HSE A;  3LSW A;  3IL1 B;  2UVG A;  3QK6 A;  2F7B A;  3RNN A;  2HFB A;  3OSQ A;  1QUL A;  4H6D A;  1N7X A;  2ESN A;  4LP2 B;  1FQF A;  1XC1 A;  2OWS A;  2O7I A;  3PD8 A;  3D4C A;  4RJZ A;  4EQ9 A;  5I58 A;  1BTJ A;  3A09 A;  2I58 A;  5JK4 A;  4R9F A;  3G3J A;  3CG3 A;  3FJ7 A;  4R6H A;  3HN0 A;  2IA4 A;  3E13 X;  3FXQ A;  4ZDM A;  3RTF B;  4YMB A;  1M5B A;  2P1S A;  2F7A A;  1Y3Q A;  5TPA B;  4FOR A;  4JSO A;  4Q0C A;  2Q8J A;  3CIJ A;  1MQD A;  4I62 A;  4YB6 A;  3ILT B;  3MQ9 A;  5DEX B;  3IOW A;  1P1U A;  2Y7K A;  1NNF A;  3UN6 A;  3SEW A;  3U94 A;  2PVU A;  3N6U A;  3KJT A;  5HBC A;  1A54 A;  1LCF A;  3A3C A;  3MP6 A;  1I6B A;  1FCK A;  1N7W A;  4IO7 A;  5ISU A;  1B6H A;  1BIY A;  2A5S A;  3D4G A;  3PUW E;  2NVU B;  3VLV A;  1O64 A;  4Z0I A;  2D5W A;  4IGT A;  4OEV A;  1CB6 A;  5AA3 A;  1XHY A;  4PQJ A;  3PU5 A;  2QS4 A;  3I3V A;  1DOT A;  1N04 A;  2XXP A;  4OEU A;  1B4H A;  1TXF A;  4YKK A;  3IOU A;  3DP6 A;  1ATG A;  2OK2 A;  3QUF A;  4R75 A;  4RNS A;  2X26 A;  4U1O A;  5L9M A;  2RF1 A;  2O1L A;  1OMP A;  3IOT A;  1LBB A;  1UQW A;  3EN3 A;  3OO8 A;  1IXC A;  4DXU A;  4F39 A;  5BUU A;  2QS3 A;  4ONY A;  4HS7 A;  4IO4 A;  1JW5 A;  3TQL A;  3G3G A;  2ANJ A;  3UOR A;  1MY4 A;  1ZBM A;  3GZG A;  2V3Q A;  3HHF A;  3TYH A;  3VLU A;  4PET A;  3IOV A;  4LAT A;  3UIF A;  2ZNT A;  2DQV A;  1FQD A;  2I0C A;  3R7X A;  2Q89 A;  3F11 A;  5KDT A;  3FVG A;  2O68 A;  3CI8 A;  1SVX B;  4QFL A;  4RPN A;  5A5X B;  3SET A;  4R6Y A;  1POT A;  4R6K A;  4ZEI A;  4G68 B;  2I48 A;  1D4N A;  3EPE A;  4IY6 A;  1PBP A;  4YKI A;  5CMM A;  4O3B A;  3KZG A;  5CMC A;  4EQB A;  5I56 A;  3A3U A;  4M1V A;  4IO3 A;  4KFQ A;  4OVJ A;  2XXQ A;  4ZEF A;  3S4U A;  2Z22 A;  3CFL A;  2UVI A;  2PT1 A;  2DWI A;  1A7L A;  1HSL A;  3FV2 A;  3H7M A;  3IR1 A;  4IO6 A;  2HQ0 A;  3QXM A;  4RPO A;  4LZ7 A;  2FA7 A;  1B3G A;  3VLW A;  3M8U A;  1UIV A;  3PUV E;  4QHQ A;  4QFK A;  1FW0 A;  5I84 A;  1S9T A;  3UGW A;  4GFR A;  4X9T A;  4EQ7 A;  5H8N A;  4BDO A;  4C1T A;  3VVF A;  5TU0 A;  1TFA A;  4OET A;  3TKD A;  5IAI A;  4GOT A;  4WED A;  4POW A;  5L9O A;  3SDF A;  4GF8 A;  4N07 A;  3SKP A;  1MY0 A;  1MPC A;  3TDJ A;  2AL5 A;  3N26 A;  1D3K A;  1YTV A;  3KOT A;  1MRP A;  5DT6 A;  3H6V A;  4NTL A;  1LB9 A;  3PMX A;  2XXX A;  3O28 A;  3Q27 A;  4MH5 A;  4OWD A;  3VVD A;  1ZIU A;  5DVF A;  1MXV A;  4H5F A;  1URS A;  4FAT A;  1EZ9 A;  4QRZ A;  1OQH A;  1SYI A;  1QVS A;  2H4I A;  3K02 A;  2V3T A;  1R9Q A;  4U4X A;  3Q28 A;  2XX7 A;  5CM6 A;  1DTG A;  3RY3 A;  5IKB A;  2ZMB A;  1UTB A;  2ABH A;  2UXA A;  2R71 A;  2V84 A;  2YPN A;  4IGR A;  4EXK A;  3RLF E;  3KN3 A;  4DXB A;  3DM0 A;  3FAT A;  4EDP A;  2HZL A;  3CR9 A;  3I6V A;  3ODB A;  3MAM A;  4I9D A;  2H25 A;  3TOD A;  4H8I A;  5KDT B;  1P99 A;  3G3I A;  4KI0 E;  3RGY A;  1EH3 A;  1USY H;  1YCJ A;  3SER A;  3FD3 A;  4H8J A;  1AL3 A;  3KJ7 A;  3MP8 A;  5DEX A;  2I4B A;  4IO5 A;  2KLF A;  1VE4 A;  3ZS6 A;  3CG1 A;  4BDQ A;  2G93 A;  4RK9 A;  2YJP A;  2X7Q A;  5FHM A;  3W9V A;  5H8H A;  2RC7 A;  4C1U A;  1YPN A;  1VFD A;  5CMB A;  2P0S A;  4MBP A;  3V89 B;  3VXC A;  4OER A;  2W7Y A;  1PEB A;  3U1O A;  3CRB A;  3FUZ A;  3MPK A;  4TLL B;  1Y1M A;  4PFT A;  3IO4 A;  1FTJ A;  1MM7 A;  2F8D A;  4XXU A;  3K6W A;  5AA2 A;  2V3U A;  1BKA A;  2O6A A;  3IK6 B;  3O6H A;  4KR5 A;  1O7T A;  5JTY B;  5ICT A;  2QSX A;  1MY3 A;  3H4Z A;  5DYH A;  4FJP A;  1URG A;  1US4 A;  5FTH A;  4G4P A;  3IO6 A;  4ELR A;  4PE5 B;  1P1Q A;  1D9V A;  1FQE A;  1MXX A;  2Z8E A;  4G8M A;  3TZA A;  3WAF A;  1Q35 A;  1LCT A;  2F97 A;  1OQG A;  1I6Q A;  3FIR A;  4JDF A;  4LA9 A;  3QAX A;  5TPA A;  1MQI A;  1R9L A;  2XX8 A;  1L5T A;  2RIN A;  3B6Q A;  3TPA A;  4DE8 A;  1XOC A;  3ZSF A;  3OXN A;  3MZ9 A;  5HM4 B;  2DVZ A;  1LFI A;  3G3F A;  3IAZ A;  5I59 A;  2F6G A;  4U21 A;  4LUB A;  2OBG A;  2UVJ A;  1SBP A;  2XXW A;  3BFT A;  3RPW A;  1UTB B;  3JZJ A;  4G68 A;  3T22 A;  5L9S A;  4FIM A;  2B3B A;  3K1P A;  1B2H A;  4R2F A;  1R1N A;  1M5F A;  2ZNU A;  4UAC A;  5L8D A;  4QFP A;  4F3S A;  3S9M C;  4NE4 A;  2VGQ A;  3Q25 A;  4WXJ A;  3K4U A;  3SEU A;  1H76 A;  3IX1 A;  1LFG A;  3H06 B;  3CSG A;  2UYF A;  4ZE9 A;  3C33 A;  4OEN A;  5I57 A;  3OMB A;  4F2Q A;  4AB5 A;  1FQC A;  4TLM B;  5H8H B;  5I59 B;  3U8Q A;  1QW0 A;  1MS7 A;  1XT8 A;  3MC2 A;  5I2N A;  4QSE A;  1A8E A;  4RYA A;  2G29 A;  1B05 A;  1I6A A;  3W15 C;  4POX A;  4JWX A;  1J1N A;  3N6T A;  1TT1 A;  3O2A A;  3QIM A;  3LC8 A;  4EUO A;  3HHG A;  1B46 A;  1S50 A;  2QS2 A;  2R6G E;  2Y7P A;  4K3F A;  4NF6 B;  5TP9 B;  1ZJL A;  1QUK A;  3MP1 A;  3U92 A;  3GXA A;  3K2D A;  4OFJ A;  4XTC Q;  3RTW B;  3UP9 A;  1GV8 A;  4DCX A;  4YB5 A;  5AA2 D;  4DCY A;  2GRV A;  1QKA A;  1B0H A;  2NUV A;  3B6T A;  3PPR A;  4OXV A;  2LAO A;  5H8S A;  3O9P A;  4F29 A;  3M3F A;  1NNP A;  3PV0 E;  3MJN A;  3C31 A;  3N94 A;  4NWC A;  3OO7 A;  3RQT A;  1S7Y A;  2XX9 A;  4GXA A;  1JQF A;  3MBP A;  4U4S A;  5KZT A;  2XHD A;  3ECR A;  4RA1 A;  3M3L A;  4QSC A;  5EHM A;  4Q5T A;  2M8C A;  1NL5 A;  1B58 A;  1B7U A;  3KN7 A;  3IOR A;  3V5A A;  1MXU A;  3PPO A;  2Y84 A;  4ZEC A;  2XXT A;  4DDD A;  3ILU B;  1LFH A;  2DVC A;  5F1Q A;  2O1M A;  3CSB A;  2RC9 A;  2QJE A;  4F18 A;  5KCJ B;  3BKI B;  3KGC A;  3H6U A;  2D21 A;  1ZLQ A;  4DIG A;  5EHS A;  1MXZ A;  2DOJ A;  4LQ2 A;  1JW4 A;  2O7U A;  1B7H A;  2I6E A;  2REJ A;  4R72 A;  3Q29 A;  4XIG Q;  2DE3 A;  3H6T A;  5I2K B;  3S2V A;  3TTM A;  1WOD A;  3PMW A;  4R9G A;  3B6W A;  3IB2 A;  4NED A;  2PX1 A;  3MVY A;  4HTG A;  5CRY A;  4LZ5 A;  3WAE A;  3OOA A;  4O3C A;  3RT8 A;  1Y3N A;  4YKJ A;  4TOZ A;  3T93 B;  2PMS A;  3VFJ A;  2VHA A;  1SW5 A;  3DP4 A;  3FV1 A;  4NF5 A;  4XKQ A;  1IEJ A;  4KYD A;  2YLN A;  3PD9 A;  1OVB A;  2F36 A;  2F5X A;  2XD2 A;  3TMG A;  1LGB C;  2UVH A;  2WKY A;  4GVO A;  1SW4 A;  4IB2 A;  4JBZ A;  3ONM A;  5LOM A;  4DZ1 A;  1P1N A;  5ICQ A;  4ZEK A;  5CC2 A;  2E0S A;  3TQW A;  1PBQ A;  3GBB A;  1WDN A;  4NWD A;  4E0W A;  4ECF A;  1B0L A;  1SI0 A;  3O29 A;  1B5I A;  1VSO A;  3MWB A;  1RYO A;  4L17 A;  4HW8 A;  2H9B A;  1Z7N E;  3HPI A;  3PUX E;  3RT6 B;  3T96 B;  4ZEB A;  1MQH A;  1LAX A;  1MY1 A;  2VD3 A;  5K2Y A;  4ESX A;  4MLV A;  3PGF A;  2GHB A;  1YAE A;  2OWT A;  2ZNS A;  5H8N B;  3OEM A;  1RKM A;  2I4C A;  4ELP A;  3VXB A;  4AB6 A;  1PB7 A;  1SW1 A;  1MPD A;  2B65 A;  2Y7R A;  5A5X A;  1AIV A;  3L6G A;  1JW1 A;  3K0V A;  5CBR A;  4KPT A;  3PPQ A;  3G3K A;  1A8F A;  1A99 A;  4E0X A;  4F1Y A;  1B1H A;  2OZZ A;  5ITO A;  4Q8R A;  2THI A;  4R74 A;  5CI5 A;  5FHN A;  2XXV A;  5I2N B;  4N13 A;  4OES A;  5BWJ A;  4OTE A;  2E1S A;  2GHA A;  4NF4 A;  1H43 A;  1LAG E;  2BJJ X;  2HCA A;  3DP8 A;  4X1D A;  4YKP A;  1FTK A;  2NOO A;  3FJG A;  1B32 A;  4NF6 A;  4NMY A;  4QFO A;  2QMW A;  4JWY A;  1A40 A;  2DSF A;  1FTO A;  2OCU A;  5B70 A;  3C9H A;  1IXI A;  3FXU A;  4IY5 A;  4PFY A;  4GL0 A;  5ITP A;  1I69 A;  2UYE A;  4F3P A;  1IQ7 A;  1LLS A;  4F22 A;  2Q2A A;  3E9X A;  4FEC A;  4ISU A;  4MLQ A;  3KEI A;  4NF5 B;  4BDR A;  3KBR A;  4BLA A;  2Q88 A;  4U22 A;  3FVK A;  2DWA A;  1ZKB A;  4ZZE A;  3MPL A;  1QJM A;  1SI1 A;  4ZZA A;  3T9H B;  3EF7 A;  4H65 A;  1B4Z A;  2B3F A;  2O51 A;  4OHN A;  2ZYN A;  1T0K A;  4KHZ E;  3IJX B;  4YB7 A;  1N76 A;  4GIZ A;  3RN8 A;  2ZYO A;  2Q9T A;  1D9Y A;  3LSL A;  4KYE A;  4BDN A;  3EHT A;  3H3G A;  3SEV A;  4MF3 A;  3PMV A;  3PUY E;  4RK2 A;  1N84 A;  1IXG A;  2V93 A;  1GR2 A;  1PDA A;  3K1M A;  3KSJ A;  3RUM A;  1EU8 A;  1DMB A;  3C4M A;  1B51 A;  1LAF E;  3HV1 A;  3N5L A;  4UA8 A;  1A55 A;  3VV5 A;  4JXI A;  1DPP A;  1FQB A;  2FYI A;  2RCA A;  3BBR A;  4F3G A;  1Y20 A;  4OZ9 A;  2F34 A;  4GXS B;  4FAJ A;  4Z7E A;  1GTK A;  5KCJ A;  2VP1 A;  3MZB A;  2DE2 A;  2I3V A;  4ZED A;  2AIX A;  3G7W A;  4PP0 A;  1LBC A;  4LZ8 A;  1H3D A;  4X1B A;  2F78 A;  3FVO A;  1JEV A;  3LSF B;  4QSD A;  1USY E;  3TAJ A;  2DYX A;  4EF2 A;  3QYT A;  1WVJ A;  1B3F A;  1SW2 A;  4KD5 A;  1R6Z A;  3OD7 A;  1B1X A;  2QRY A;  3MW0 A;  3TTN A;  4NF8 B;  3TTL A;  4ELO A;  1OLA A;  5J1D A;  4U2R A;  4THI A;  5H8F B;  1B52 A;  1BP5 A;  3TCG A;  1BLF A;  2HAV A;  1NH8 A;  2VOZ A;  1TWY A;  3KFM A;  1IXH A;  4OQO A;  3SES A;  4HCY A;  3VE1 B;  4OFL A;  3R6U A;  4GQO A;  1XS5 A;  1N3X A;  1B7Z A;  5AA4 B;  5FTI A;  5JTY A;  2XXY A;  1JEU A;  4QFN A;  4U23 A;  5H8Q B;  3OSR A;  2I49 A;  4JWO A;  3FGS A;  2DE4 A;  1MXW A;  1NKX A;  2QL3 A;  3P7I A;  3K01 A;  3O6G A;  3JV9 A;  3R26 A;  2REG A;  4EXL A;  1EZO A;  4ELQ A;  1FTL A;  4YZZ A;  1MPB A;  4KCC A;  1JVX A;  1URD A;  3LBS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...