1Y37A

Structure of fluoroacetate dehalogenase from burkholderia sp. fa1
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
294
structure length
294
Chain Sequence
MFEGFERRLVDVGDVTINCVVGGSGPALLLLHGFPQNLHMWARVAPLLANEYTVVCADLRGYGGSSKPVGAPDHANYSFRAMASDQRELMRTLGFERFHLVGHDRGGRTGHRMALDHPDSVLSLAVLDIIPTYVMFEEVDRFVARAYWHWYFLQQPAPYPEKVIGADPDTFYEGCLFGWGATGADGFDPEQLEEYRKQWRDPAAIHGSCCDYRAGGTIDFELDHGDLGRQVQCPALVFSGSAGLMHSLFEMQVVWAPRLANMRFASLPGGHFFVDRFPDDTARILREFLSDARS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Fluoroacetate Dehalogenase FA1
rcsb
source organism Burkholderia sp.
molecule tags Hydrolase
molecule keywords Fluoroacetate Dehalogenase
total genus 113
structure length 294
sequence length 294
chains with identical sequence B
ec nomenclature ec 3.8.1.3: Haloacetate dehalogenase.
pdb deposition date 2004-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1y37A00
1YAJA 4EZIA 2CUTA 2C58A 1XZJA 1AKNA 4DMKA 1BEEA 4EB0A 3G0BA 1TKRA 1XZEA 1QZ3A 1VXOA 3WK8A 2Z3ZA 3OURA 4AB1A 3WL6A 1GPKA 5A7GA 2RAUA 1CUCA 4DNFA 1FJ2A 1EDBA 3O4JA 2PSDA 3H2IA 2B20A 4PW0A 1DT5A 1YAHA 1CUBA 1LPNA 4W1SA 1FFAA 4QDXA 4L72A 5ALTA 4DNPA 2XUKA 3D0KA 4LKOA 2JEZA 1MPXA 3PUIA 1IUPA 3WKBA 3VJKA 4N8SA 1QIJA 1QIKA 5KBYA 2VJAA 3VISA 2X5XA 4Q05A 4AN1A 3FOBA 3FAKA 3E0XA 4BDSA 4G5XA 4HS9A 5EGNA 2GBGA 3DOHA 4MYDA 4X6YA 3HC7A 3H2HA 1ORVA 1GQSA 1QLWA 3WJ2A 1AQLA 2ZYRA 4CCYA 2E3JA 3V9AA 2ZJ7A 3WK6A 2XQGA 5JATA 4JEIA 5FV4A 5J3JA 3WWOA 1X2BA 2WJ6A 2B9VA 1ZIXA 3JYHA 3WKAA 2PL5A 4CG1A 2QVBA 1TAHA 4X6UA 1A88A 2AJLI 1W76A 1GQRA 1EX9A 5D3ZA 3C5WP 5K3CA 5AM3A 4DMCA 1DT3A 3D5EA 1AZWA 3PF8A 4LXHA 1IMJA 3OTQA 5AK3A 2FJ0A 4C87A 1AC5A 4MQLA 2W6CX 4IQ4A 2HRRA 5DTIA 3R41A 4WCVA 5C7YA 5LZ9A 1EVEA 3U0VA 1QFMA 5JIBA 1USWA 2HM7A 1JFRA 1EHYA 1H22A 2H7XA 3ICWA 4WFJA 5ALZA 4K6GA 2XMSA 2IX9A 2DCMA 1Q0ZA 2WIFA 4AQDA 1GPNA 4BP8A 1XRLA 3A2LA 4G9EA 4M0MA 1BROA 2WHQA 1CUVA 1TCCA 2OG1A 3DD5A 5ALYA 2BKLA 1PJAA 4XVCA 1DQZA 2WG2A 4KR0A 1BCSA 3HEAA 1E89A 2V98A 2VQ6A 4W1PA 2HIHA 2DHEA 3GA7A 2WSLA 3V1MA 3STXA 4F0JA 2OCIA 5CTAA 4BAZA 1QIGA 1A7UA 5ALJA 1QIMA 4BTVA 4MJ3A 3RKSA 2G5PA 4YPVA 1UXOA 1YS1X 1F8UA 2VSQA 4L9AA 5JAOA 1LBTA 5CURA 4IH4A 1ZD3A 4Q3LA 3I28A 3DQZA 2HRQA 3FNBA 2D0DA 4G1FA 2YASA 5D7BA 1R1DA 2JGIA 4OU5A 1MNAA 1OXMA 4DM7A 4KRYA 3G9UA 4HRXA 2QM0A 4X7BA 4E15A 5CH5A 1CLEA 5HKAA 4HXFB 1M33A 4GW3A 1BN6A 1BN7A 3R3XA 2FJPA 2IITA 2JGFA 5EHNA 5E4TA 4OU4A 2UZ0A 2WFZA 3UUFA 2XUQA 2AJBA 1FFDA 2QRUA 3VKFA 4J0HA 4MWTA 5AJHA 4UHCA 1VZ2A 4LIPD 4CIAA 5FRDA 1U65A 4B84A 3LS2A 3WIOA 1ZJ4A 4FOLA 4W63A 2YYSA 1ETHA 4G4GA 1XRMA 1CUZA 4H18A 1SCQA 5EHXA 1JU4A 1S8OA 5KREA 3ESAA 4E11A 1CQZA 1FFBA 2HA4A 3IVMA 2WIDA 4BCDA 3R3WA 3KSRA 3QMVA 1CUDA 3FYUB 5CW2A 4U2BA 2PSHA 2XDWA 4YASA 2Y1KA 1JJBA 2HA0A 5K3DA 3G7NA 2XLBA 1AURA 3O4GA 2PPLA 3T4UA 3QMMA 2GBIA 5AOAA 3L1JA 2PX6A 4N5IX 1GKKA 4HTAA 4RE6A 1GGVA 3A2MA 4FBMA 2V97A 1QIDA 2H7YA 2WUFA 4UFOA 1XROA 1VA4A 1K4YA 2ZYSA 5ALUA 4Y2SA 5E4YA 5JAUA 4H7IA 1F0NA 1MX9A 2O2GA 4X93A 4M0EA 2WM2A 5DLPA 1JJFA 3QH4A 1QIEA 2O2HA 3MUOA 1GXSA 4XIIA 3LP5A 1QGED 3CXUA 5HFAA 1XKTA 5LKAA 3AJAA 1VOTA 5CT5A 3C5VA 3R0VA 4OSEA 4S0XA 5HQ3A 4UHBA 4EY8A 4Y2RA 5E2IA 4WJLA 1QTRA 2OGZA 2DHDA 2GYVA 3Q0TA 5T4EA 5JZ9A 4K6KA 4X95A 1YB6A 2YH2A 1OCEA 4BE9A 1XLUA 4JYMA 4Y2VA 3G0IA 3IUMA 3C87A 4MYSA 5AI4A 1C7JA 4ZWNA 2CMFA 1QFSA 2I78A 2C7BA 4Q1VA 3VXKA 4QA9A 4UBKA 4AN0A 2PUJA 4HVTA 4QLAA 5EIEA 2Y2UA 1J07A 1UOQA 2GBFA 1UOOA 1CUXA 4BRSA 1KU0A 4IHAA 5AM4A 3VVMA 5A7HA 3IUJA 3HZOA 3IA2A 1ISPA 3IULA 3BJMA 1KEZA 4XWGA 5ALDA 2Q0XA 5D6OA 2QUBA 3I6MA 3WQHA 5AKHA 4TVKA 4FHZA 2B61A 4J0JA 3FVRA 1CFJA 1WPRA 3FYUA 2JIDA 3G0GA 1XLVA 1L7AA 2RIPA 1R9MA 1E3QA 3BJRA 3YASA 3ANTA 3UUEA 3OG9A 5A62A 1XZIA 4BZZA 4CCWA 1VE7A 3BIWA 1WHSA 2ORYA 2VEOA 3C6XA 4X92A 5BOVA 4K2AA 4HXGA 3IUQA 4ROTA 3IB3A 5LZ8A 2X76A 1XFDA 4IO0A 1BRTA 3OM8A 3QZUA 3WZMA 5C8ZA 2HADA 2JF0A 1QOZA 1YB7A 4TPKA 2FX5A 4QNNA 3G0CA 4AO6A 4GXNA 3WJ1A 1P0PA 2HA2A 2XMBA 3W9BA 5BWBA 4BATA 2HFKA 1SOMA 2WUEA 5CRIA 4ARAA 2XT0A 5EHZA 4FFVA 3CN9A 1P0IA 1JMYA 5HZGA 2FUKA 5YASA 1WB4A 5AI0A 3U1TA 5LZ7A 5IH7A 3ILSA 2CBGA 1UKAA 1MX1A 4KRXA 3AZPA 1LLFA 4WDQA 7YASA 5LKRA 3D4LA 1CUSA 1MNQA 4H35A 5JZBA 1MU0A 4C6HA 3WA7A 2PBLA 5K3EA 5DNUA 4QZVA 1QIIA 1UFOA 3WWPA 1EH5A 1JI3A 4UBNA 2VATA 5ALRA 4EY5A 4E14A 5LZ4A 3SK0A 3EF3A 1ZGCA 2WFLA 1ZI6A 4MEAA 4B80A 3S8YA 3WI7A 4PF1A 2CKMA 3C8HA 3PDCA 5ALIA 4U2CA 4CG3A 3RARA 4Y2QA 4BVLA 1E8MA 3FLEA 4YX9A 1LPOA 3KDAA 2HHAA 1CUAA 1LPPA 4H7FA 2XUFA 3FLAA 3FSGA 3ZLTA 2GZSA 5EIHA 3DOIA 5CT9A 1QE3A 1MTZA 3WWEA 4RNCA 2VJDA 2OPHA 5AK4A 3H1BA 1SFRA 1CUGA 1Y37A 5FOQA 4X6XA 4FLEA 2QR5A 2WU3A 1EINA 4KAJA 2HA7A 3BIXA 4K6HA 3WL8A 3EQ8A 1I6WA 1EVQA 3BF8A 2YXPX 3FCYA 4UFNA 5K5EA 5AKZA 4P9NA 5LLSA 5HK9A 3GROA 5AKJA 5AO9A 2QOEA 2RHTA 3WYNA 3L1HA 1H2XA 4CI9A 4LXIA 3T52A 6YASA 2VA9A 4ZV7A 4C4YA 2BGNA 3QVMA 2D5LA 3G9XA 3AIOA 4X94A 4KAFA 2Z5GA 3F8SA 4FFWA 3DYIA 4JH0A 4GHWA 1R9NA 3AZQA 4J0CA 2O7RA 1LNSA 3WKEA 4M0FA 4C88A 2BFNA 2WG1A 3HJUA 3D3NA 2V9ZA 1F0PA 4UHFA 4Y2JA 5K3FA 2WHRA 2XQFA 5AIBA 2ZYIA 1G42A 1XZHA 2I03A 1XLWA 1P0QA 4KE8A 2JGJA 2VAXA 5EHQA 4K5QA 4WDRA 1XZKA 3BWXA 4UUQA 1H2WA 3EIOA 4NVRA 2BUAA 1JKMA 1W75A 1TK3A 4B0PA 1UWCA 5KWJA 4C4ZA 2X8BA 3KWFA 5AOCA 3I1IA 2XUOA 2WHPA 1DWPA 3HACA 3H17A 1VJ5A 4H7KA 3HI4A 1LPMA 3O95A 4HRYA 3O9MA 1HL7A 2DQYA 5LP1A 4E46A 4A23A 4YK7A 1FFEA 3JW8A 2XMGA 3VJLA 2VF2A 4X71A 5T4HA 3WK7A 2XMCA 4HAIA 5HFNA 1BS9A 1BCRA 5AI5A 3DNMA 3O0DA 5JAPA 2QZPA 3DDUA 4BC0A 3IBTA 3WWCA 3R3UA 1LZLA 2VT6A 3H0CA 4N5HX 5ALWA 3QM1A 3H2KA 4EHBA 5AKKA 4DSZA 4Q3OA 4JYPA 4MXDA 5ALKA 1B41A 3QPAA 5FXMA 2J3QA 3W06A 5JASA 1QIFA 2OQIA 4Z49A 2ZVDA 1L7RA 3F67A 1J1IA 3B3QA 4B83A 4KACA 3F98A 1CR6A 3HLKA 1UOPA 3KOOA 1AGYA 1F6WA 4EY4A 1ZJ5A 2V96A 1JJIA 3VVLA 4ARBA 1N5MA 4W9RA 5AKEA 1LPSA 2WTMA 3DS8A 2BJHA 2XB6A 4QE3A 3Q8WA 3HSSA 5DNWA 3DLTA 5H3HA 5HF9A 1QO9A 2VJBA 3BL8A 3DKKA 1THTA 2JBWA 2HU8A 5FUMA 5AKIA 3TEJA 3F96A 5AKXA 5JD4A 1CUHA 3NWOA 5AM0A 4KEAA 4DNQA 3ZPXA 3OC0A 5KWIA 3V1KA 2R11A 3O9VA 1MAAA 5JYCA 2NW6A 5FPPA 3C45A 4DSAA 1LGYA 2QS9A 4QDOA 4BCBA 2JGLA 4WY5A 2HA3A 2J3DA 5HF5A 5FDFA 4H0CA 4QWMA 1VZ3A 3CCBA 2AXEA 1IZ8A 3P2MA 2WG0A 1WPXA 3NOXA 4F5ZA 4I4CA 3UMJA 2WTNA 5I8PA 5HF6A 3WL5A 2C0PA 1MO2A 1MX5A 2G63A 1MAHA 5CXUA 1HBJA 4BC1A 1JMKC 3QPCA 5DTJA 1G4HA 1A8UA 3QPDA 2WILA 3H1AA 3GUUA 2OCKA 5JANA 4OUKX 1ZICA 4FNMA 5A2GA 1H23A 4ETWA 3AINA 4OB7A 3W2TA 5JALA 3LIIA 2K2QB 3V1NA 4UPDA 1CUJA 1ACJA 4DIUA 4BP9A 5ALXA 2QMQA 3WZLA 3FBWA 2LIPA 4UHHA 4F60A 2QJRA 3DL4A 5AKLA 4V2IA 2WUDA 2XMDA 4GLBA 5E4JA 3WL7A 5ALOA 4BAGA 4Q82A 4GI1A 3D2AA 3QITA 2EDCA 3C43A 3WLAA 4FLMA 3RM3A 3RLIA 5CT8A 2RI6A 4JNCA 5AM2A 3OPMA 4D9JA 4BVKA 1E8DA 1IVYA 4I19A 1MJ5A 4Y2PA 2ONCA 5T4BA 4HZGA 4L0CA 3M83A 5ALFA 3X3HA 4Y2XA 4DGQA 3I2JA 5AKYA 3DKRA 4EUSA 3C70A 4MQMA 3O4IA 5CT6A 4OB6A 5BV7A 5AH0A 4G4IA 3A6ZA 4JUIA 4C89A 3ESBA 4PO3X 3LCRA 2WFMA 1DINA 4EBBA 3EQ9A 2OQVA 5C8XA 2XQKA 2QTBA 1W52X 4N8EA 2XI4A 5K3AA 1E8NA 3ZI7A 4BB0A 4H77A 1R50A 4J03A 2QKYA 4DTCA 2RGUA 2ACKA 3D2CA 5LYYA 1W1IA 2BUCA 2WLSA 3SX4A 1CIJA 4X97A 3N2ZB 3PFCA 3KXPA 2AJCA 2AJ8A 1HDEA 5ALLA 2OAEA 3FCXA 4X85A 1AUOA 3NUZA 3TJMA 4AX4A 3M82A 4QDTA 3G9TA 1IUNA 4B85A 4AZ0A 2QXTA 3MVEA 1XRPA 3M3DA 4ZRDA 4AZ3A 5JD5A 1XRNA 4WFKA 1TIBA 4G4JA 1YA8A 3SWWA 1CV2A 3GZJA 3FYUC 1R88A 4GBGA 2O2IA 3PUHA 3R3ZA 1UZAA 2P8SA 1R3DA 1VKHA 1TRHA 5JZSA 1DX6A 1YS2X 3I2KA 4QEKA 5CH8A 2AJDA 1CUEA 4C01A 4FBLA 1XRQA 4X00A 1HLGA 1H2YA 3E4DA 2Z8XA 3K6KA 3C6BA 1XZGA 4P92A 4B6GA 2CZQA 4H7HA 1EB9A 5JARA 4HXEB 3DJYA 4P93A 2PVSA 4UBLA 4UHDA 4KE9A 2OGSA 2BAGA 1KU6A 1SCIA 3QBJA 4P08A 5CMLA 4Y9SA 3WKCA 1W4LA 2QXUA 4ZI5A 5DJ5A 4OYLA 4L3WA 3F97A 3GFFA 1T2NA 3L1IA 1QIHA 3AILA 5DYTA 5K3BA 2XQIA 1CUFA 5HK8A 3C6ZA 5FP0A 1ODSA 1TCAA 2PU7A 4O08A 4KAAA 5LZ2A 4RE5A 1AMNA 2CEKA 2C5FA 2EDAA 4A5SA 5IKXA 4RPCA 2OXEA 1WB6A 5AM5A 5ALVA 5DWDA 3O4HA 1H2ZA 4EY6A 4CCYB 1ODTC 1NU8A 1CQWA 2VJCA 4GWLA 5AKGA 1EB8A 2DR0A 5BWCA 3CN7A 2HFJA 1XQXA 2OCLA 2ES4A 3ZV7A 4G8CA 1PFQA 2PSEA 1L7QA 2XUJA 3H04A 4H7DA 4BAUA 3B5EA 1ZD4A 4Y2TA 3MGAA 4QDUA 1CPYA 4GDMA 4B82A 5C8VA 1WCYA 2CJPA 3AIMA 1AX9A 3HRHA 1B6GA 1EA5A 2OLEA 1UK9A 5SYNA 3B12A 5JD6A 1A8SA 2R8BA 1VXRA 4DMFA 4J0IA 4MWSA 3R3VA 4UBJA 4EA6A 3FVTA 3TGLA 5HCUA 4PQEA 2VT7A 1CUWA 4BTLA 1LPAB 3MUNA 2WFLB 1XZLA 4BE4A 4X90A 1FSSA 1XZCA 1ZOIA 5EIAA 1CUUA 2ACEA 1D07A 3HXKA 1PV1A 4I3FA 1DWOA 5CXXA 4FMPA 3DL7A 5AI9A 4B7ZA 1WOMA 2WIJA 1ZGBA 4IH1A 3R3YA 4Q34A 4AMYA 3DYVA 1N1MA 1IUOA 3I1YA 5AI8A 3VDXA 4KYVA 2ZJ6A 4H7EA 3WIBA 1HKHA 3BF7A 3STWA 3OOSA 2Z8ZA 3WA6A 4OD0A 1QONA 3EQ7A 4X91A 2QJWA 4DYHA 4AMZA 4INZA 2QT9A 4PSDA 2WKWA 4DLNA 2OAGA 4DNOA 5ALQA 1UK8A 4GEGA 5FKJA 3STUA 3PFBA 1Q83A 1LPBB 5AM1A 2CB9A 5FPQA 1YASA 4LXGA 3H19A 2ZSIA 3IDAA 3D2BA 1EK2A 3H2GA 3AUKA 3VJMA 2XUIA 1U8EA 1VA5A 2WIGA 2OGTA 4H7JA 5JAHA 4BZWA 4W1QA 2GYUA 3W05A 3E3AA 4BBZA 1E66A 2H9YA 3E1GA 1DU4A 4U2DA 2QUAA 1WB5A 1K8QA 3V48A 5T4FA 3ZLVA 3BE8A 3AZOA 1X70A 5IVHA 2HDWA 5CH3A 4UBMA 1XZMA 4J0DA 2O7VA 4B0OA 4LYDA 4XJVA 2XUHA 3W04A 2VAVA 2BUBA 2H1IA 1YR2A 4PSUA 4WFIA 1ZD5A 1GKLA 1FFCA 5C81A 4PSCA 1ZI9A 4LYEA 1GT6A 3PICA 2PKYX 3GELA 5ALSA 1W6RA 4TGLA 2HU5A 3CCCA 4GECA 2XMZA 4FKBA 5I9IA 1YCDA 4CFSA 1K6EA 3IURA 4IH9A 1OILA 2HU7A 3IUNA 2PSFA 3QMWA 2I3DA 4NMWA 5DYWA 4J0KA 4PNZA 4WY8A 1LBSA 4EY7A 5AI6A 2WJ4A 3SC2A 3W9UA 1XZFA 3K2IA 3QYJA 4G8BA 3FYTA 3STVA 4RGYA 5AK6A 1LZKA 5JADA 4C4XA 1RP1A 3I2HA 1C4XA 2BGRA 3KWJA 3M81A 4KE6A 2GZRA 3TRDA 5ALMA 4B9EA 2I3ZA 4J0GA 3AFIA 1JU3A 3F9CA 1Q0RA 4NS4A 1VE6A 3K9BA 1VLQA 3WMRA 3I6ZA 1ZI8A 1C7IA 3FLBA 2RHWA 3I2IA 1DWQA 3HABA 5ALPA 4QWWA 3WK4A 1E5TA 4A16A 3EBLA 3G02A 4ITVA 2JGEA 4Y2UA 1N5RA 1IZ7A 3NGMA 4QDZA 1Y7IA 2XUAA 3BDVA 5LIPA 5AHXA 3IIIA 3RK4A 2XUPA 2XUGA 4UFPA 2WIKA 5ESRA 5AIAA 4ZREA 1EDEA 2ECFA 1J2EA 3BXPA 4Q3KA 1QTIA 3WK5A 2PM8A 1RYYA 4UHEA 1DX4A 3AIKA 1HPLA 5ALGA 2XMRA 2H7CA 2IIVA 4FNGA 4AO7A 4AO8A 2G5TA 4Y2YA 2DHCA 3FWHA 2JEYA 5AICA 4CG2A 3WWDA 3ESCA 1EI9A 2XQJA 2W22A 2WUGA 5FLKA 1HQDA 4ZXFA 4F21A 1Y7HA 4UBIA 4ZV9A 5ALEA 4KJXA 3R40A 1QJ4A 2PSJA 1CUIA 1THGA 3V1LA 4MEBA 2ROQA 3PE6A 1ODCA 4PV7A 1NX9A 3D59A 3ICVA 5A71A 4KE7A 5DYYA 3WYDA 1BEZA 3ED1A 3DCNA 4NZZA 4U2FA 3C8DA 1J06A 1EK1A 5EI5A 4LHEA 4ZGBA 1WM1A 4G8DA 4X3CA 1GZ7A 2DFPA 1CVLA 4J3JA 2WQZA 5LZ5A 1U4NA 1YA4A 1U2EA 1ZD2P 1T4MA 4B81A 3H18A 2Y6UA 1BU8A 1XQYA 3KD2A 1TQHA 3G0DA 2C4HA 1SC9A 1QO7A 2WHPB 3FSGD 1EXWA 4FWBA 3DEAA 2OCGA 5AK5A 5F4ZA 2ZYHA 3HYSA 4BYMA 5HF8A 1UK6A 2ZSHA 2Y2VA 3ANSA 2C5GA 1DQYA 5A7FA 3JWEA 5SYMA 1DTEA 4N8DA 4W1RA 1ACLA 3LLCA 1MN6A 3LIPA 3D7RA 1XZDA 2J4CA 2VTVA 1G66A 5CBKA 4U2EA 4FDMA 3PF9A 5CT4A 4CIBA 2JGMA 3BDIA 3I2GA 1K63A 5K3FB 2EEPA 4BVJA 1MT3A 1UT6A 2XUDA 1BE0A 1G5FA 5AOBA 3I2FA 4OCZA 1XZAA 5ALHA 2ZJFA 3G9ZA 1RWQA 3I6YA 1K5PA 1X2EA 1Z68A 1CUYA 3WK9A 5HKBA 1CEXA 4DMHA 1O6FA 2JGKA 5AP9A 3ZLUA 4OYYA 1WHTA 4QLOA 5EFZA 2XLCA 3C6YA 1GPLA 1XQWA 4Y7DA 5ISMA 1CRLA 1JT2A 2HA5A 3H2JA 2PU5A 4BRZA 2HA6A 2GBCA 1XRRA 1ORWA 2GYWA 2XMQA 4FLFA 5ALNA 3PI6A 5DNVA 5I7UA 1YSCA 2WJ3A 2XE4A 3WKDA 1XKLA 5IVKA 3GBSA 3A2NA 1Q84A 2Y6VA 1SCKA 4OPMA 1XZBA 1UK7A 4BDTA 2C0QA 5IVDA 1ZIYA 1XQVA 2Z3WA 3N0TA 4XX1A 4U2GA 4AXBA 2B4KA 3STTA 1TCBA 1UKCA 1N8SA 2J4FA 1R4ZA 4OB8A 4J7AA 5D3KA 5IVIA 4FTWA 1UKBA 3ESDA 3ZWQA 2PUHA 2HL6A 4G9GA 4B9AA 1P0MA 2WU4A 5HQ3B 3STYA 3S2ZA 4UBOA 2BCEA 1O6GA 5A6VA 2RONA 2DQZA 3A70A 2DSNA 1EDDA 3G8YA 2G4LA 1NU6A 4BCCA 1A8QA
chains in the Genus database with same CATH superfamily
4ZVRA 1W8DA 3VFDA 5CYPA 1M10A 2OCPA 1JYEA 2CUTA 1FVFA 3MMPA 4CFZA 3EJWA 3H11A 1D2RA 4FOSA 3VKWA 4PLGA 1OJ7A 2W9XA 4M98A 4DMKA 1BEEA 3I58A 2G1KA 2SKEA 4TVSA 3C7TA 3FCEA 4UZFA 4EB0A 3WLSA 3MZ0A 3KQTA 1CWUA 1L3BA 1XZEA 2P2CA 4D3ZA 3UPUA 7ABPA 2C03A 6AT1A 2ZTVA 4M37A 4B43A 3FNQA 3DOEA 4DBLE 4KWTA 2TMYA 2ZM6B 1DFGA 3AWDA 3D8SA 4PGMA 1JPUA 3OLYA 1Y82A 3UUWA 3DQPA 1F2TA 2BP7B 4OMCA 3DCYA 1PZFA 5E9JA 1M0EA 5A7GA 2YHBA 1ODIA 4S2EA 1RJDA 2WD7A 1EDBA 1K0UA 1H6BA 1HTWA 3TWOA 5CJPA 4PX5A 3OE7A 5EAIA 3PUZA 3H97A 4I5FA 2B20A 3B13B 2CWDA 3G49A 1DAFA 3RVPA 4B6QA 4TTAA 1OI7A 1PDVA 4K6MA 1SHTX 5G53C 1DT5A 4TWBA 1GLGA 1YAHA 2CYBA 4BO3A 8GPBA 3PGXA 3GLRA 3MWYW 4NC9A 1DKQA 1GPBA 1QX3A 4LJ7A 4CLRA 4RA9B 1LPNA 4BO2A 2IWHA 2MHCA 3OESA 1AH2A 4KUGA 2WZDA 4TTQA 3H1PA 3ZW7A 4UOEA 2EYQA 1AKUA 5AXBA 3ZR4B 4EEZA 3M5WA 2IYYA 3KHTA 3GLTA 1FW8A 4QYMA 4HYYA 4ECEA 1NXOA 2Q1UA 2XUKA 2EZTA 4O2BB 1I7SB 4HN2A 1FTGA 4LKOA 2JLCA 3VHXA 1E2HA 4BB5A 4QOHA 2AHOA 3WJAA 2IHVA 2V8OA 1IUPA 5B7GA 3TLCA 3E2IA 1JQ5A 2X6TA 4N8SA 1XCBA 3LXRA 1D0IA 4ZO4A 1NRXA 1JVSA 3IPRA 1UOEA 1UJNA 3LL7A 1HC7A 4R4JA 1R8JA 1Y9AA 1RBMA 2BFFB 3VPXA 3VISA 3IQFA 4F5DA 2GVDC 2X5XA 3TRKA 2HLPA 2O4CA 4MQUA 1YFZA 4ZQHA 3U48A 1SIUA 3FAKA 3DBLA 4G5XA 4OSPA 2QP9X 2GBGA 3DOHA 2PLAA 5CD9A 4NZMA 5LR6A 1X8LA 1PQUA 2Y0DA 4E5PA 1ORVA 3OAAD 1L7NA 2NM0A 4FFMA 5TQ2B 1JLSA 1V37A 2W58A 1UAYA 2IYSA 3DB2A 4QUDA 3OCZA 2W90A 1C8KA 2B5OA 2FHSA 1CF4A 1GHTA 1SXPA 4Z9XA 3KTAB 1KO8A 1PHRA 1L5NA 1O97D 2OXTA 1SIBE 1GSIA 3BZWA 2A7QA 4OYRA 4IIUA 2XQGA 4RK5A 2XKAA 4ZCMA 5JATA 4X45A 1Q44A 4JEIA 2ZXFA 5E3JA 3QLTA 3R8XA 4HNAB 2IHNA 1RVDA 3MIIA 2CLIB 7MHTA 3H1EA 1M2JA 2OCBA 1MO3A 1TU3A 4CXMA 2ZKLA 2IEAA 1NT2A 1YQUA 4IWNA 3T06B 5J5CA 2CD7A 5L7TA 4FQ7A 3MPUA 2BCGY 4N7BA 3IUBA 3LDGA 3WKAA 4CG1A 4H08A 3AVUA 4ZOLF 1D4ZA 2ZJ2A 3VX3A 2HJ9A 4LV6A 4EGCB 5BQXA 1GZDA 4MRRA 5KNBA 2Z57A 1I3OA 5JMOA 1T4BA 1F9EA 4L8WB 3DUFA 5DF1A 3NTQA 3BTSA 4PYIA 1V5IA 3C5WP 3H0KA 4ZVKA 1WQ3A 4A36A 3H2ZA 4Q4CA 1XJWA 1NP3A 1DT3A 2PXAA 5AM3A 1CCWA 4UMVA 1G4UR 1M1YA 5TF0A 3FGZA 1DJLA 1T8TA 4W82A 4LXHA 1JNXX 3ZBQA 2I4IA 4RLQA 2H85A 1RXCA 1T6XA 3DE5X 3NBKA 1T2DA 5BV0A 3OHSX 1MXFA 4M9ZA 4DV1B 2IBMA 2XW6A 5CVVA 5HUQA 4FHGA 4CIWA 4GMKA 1H4QA 3PRYA 1ACMA 1W34A 2V5AA 4FCCA 2ZE5A 3P1JA 4QAJA 5DTIA 1IIBA 4EMBA 4B2PA 3SQDA 1H8EA 3KYIB 1SZDA 4ZYYA 3OX1A 2J3KA 4WCVA 3CJRA 3ABOB 3U0VA 3H2SA 4EJ6A 1XR3A 5HKKA 2E85A 5IT4A 4DA0A 1N77A 2HM7A 2IC5A 4MCAA 5FNVB 2H7XA 2BFFA 2JIQA 4OX9B 1FJHA 1UWVA 4FCTA 2VP4A 1IB6A 1PIWA 4UM8B 4WFJA 4XUEA 3KZCA 2FWPA 2XMSA 1Z0UA 3OPYA 2WKPA 2VH1A 2DFVA 3PFHA 4PLPA 4O4LB 2YDYA 2O8NA 2RB4A 4AQDA 3L0BA 2P7HA 4GMXA 4TYWA 4O2BF 5B5SA 1JJVA 2B4AA 4EF6A 1BROA 1H42A 5BSEA 1BDHA 4L4SA 3J7TA 4R51A 1A27A 3FUWA 3B1WA 1TCCA 4IIJA 2ADMA 2BKLA 5MGNA 3VDNB 3HBMA 1HEIA 1FPQA 2FW1A 1ONOA 1WETA 3NGXA 3CEHA 3FLMA 1R0XA 2B98A 1PW5A 3I04M 3D54D 2CNBA 2PQMA 1E89A 1FMFA 3WBKA 3GCXA 4YHBA 4NPCA 4DV7B 2V98A 3QRWA 3UYKA 4AJJA 4IUYA 4Z4CA 2VQ6A 1I30A 2Q99A 1BHQ1 1NASA 5KINB 2Q2VA 4DR6B 2C54A 2RIRA 4K81B 5GONF 4C6TB 3KFXA 5A3SA 1T6BY 1FYDA 5HWSA 4YJHA 1Z26A 2BBWA 1RCTE 1QYCA 2VHCA 1BOFA 3B1VA 4M8NE 3UCFA 4AZ0B 1ECPA 1F12A 4HDMB 1E7SA 3K15A 4MV0A 4RETA 2SBTA 4XGKA 1F2TB 1JFLA 2BP7A 3CT6A 2CFIA 4QSHA 2C3YA 3MK31 5IT0A 3WHPA 5K8CA 1X7DA 5CTAA 2AQIA 4FUTA 5FEMA 1UXKA 3AP3A 1QIGA 1A7UA 1N5OX 2YJGA 5ALJA 1AF7A 1QIMA 2QW1A 1ESEA 3ZG6A 4MJ3A 5A9TA 4R2JA 1SPBS 2P5SA 3P9RA 2OLKA 4WOPA 1YS1X 3FUUA 2ZI5A 1EFRA 2P35A 4PZDA 2FLWA 4OGFA 3OTWA 3B36A 1ZOOA 2VSQA 2W93A 3MXTA 4NABA 1JKXA 4QYSA 2H1FA 3F7OA 5IK2A 2R9VA 4UHJA 1YS7A 5A9SA 2I7CA 3UHJA 2QN6A 1W4CA 3A4TA 1WMFA 4M7OA 5KOYA 1T10A 3JPWA 2PE5A 2PYDA 1YOVB 3I28A 4K1XA 4MS1B 1UBLS 2Z6VA 1DHTA 1KAMA 5ITZA 2XYPA 1TEHA 1W9HA 3DBVO 1AA6A 1J0EA 3FNBA 2D0DA 2NUAA 2A9QA 3EC2A 4G1FA 2YASA 4HH3C 3RV4A 5LL6P 4I50F 1N8KA 1R1DA 2QEQA 2ERXA 3CUYA 4OQNA 1OW3B 1DADA 3QUSA 3GOHA 4YMIA 1KZ6A 2BF7A 2QM8A 2VJLA 4XAQA 1HNNA 1OXMA 3KJIA 3T8YA 5F51A 5IMBA 4HRXA 2PXCA 4YP7A 4CRWB 5HILA 1JSXA 5FR2A 4KQIA 3CX4A 1XGKA 1GCUA 3UJCA 2C4NA 4HXFB 1MMFB 1DJMA 2J0UB 4ID3A 4RA6A 2Q8NA 3OZTA 4WZAB 3PT9A 2JAHA 5F2OA 1TQDA 4EVQA 2GPNA 1G3QA 4Z4HA 5EE5B 4FGKA 5E4TA 3KOWA 1HR0B 2QRKA 4MIKA 2HQOA 4KQEA 5AVXA 2ZXEA 4IOJA 4ECAA 1SH7A 4B6EA 2OV2A 1P75A 4MPRA 3UK1A 2HEIA 5A05A 4D9MA 1Y4SA 4NR0A 1UF9A 4KQKA 2QRUA 1QH0A 5FADA 2FG6C 4MCIA 3RE1A 5E7MA 3JD4A 5TT1A 5I7WA 1EWVA 1T5SA 1XC7A 2IS1A 1VZ2A 2O50A 3GUCA 2VAPA 1TXGA 3CTMA 2GAFA 2P6UA 3ETNA 3I01A 4FN5A 2FWJA 1ZZEA 2W2MA 4TTIA 2J9RA 2AI1A 5F35A 4B84A 1HYBA 4IKEA 3Q9NA 1TAUA 2WWRA 5BSWA 3WIOA 1SD1A 4RXTA 4DLBA 2E21A 4W63A 2IU4A 2YYSA 4BV8A 4C0AC 5TGDA 3VNAA 4G5OA 4CLOB 3TECE 3WISA 3VMFA 1Z8HA 2O20A 3LA8A 3RC1A 5JCPA 1PFGA 1XRMA 3S27A 4FYYA 4PIMA 5LUBA 3P5BA 5KWVA 1GPWB 1K8YB 1S01A 2XDAA 3FOZA 3OSZA 4K03A 5EHXA 1O95A 1JU4A 2QZ4A 4MV3A 5EESA 1PNOA 2LGJA 3K0FB 3NHZA 2B0JA 4WLEA 4E11A 2QN8A 1EUCA 3ZU5A 3MEQA 5B1HA 2PRYA 2LRHA 2PBFA 3JPYA 4UUBA 1VLVA 1T4DA 2R1TB 3IRUA 3OECA 1FDWA 1YB5A 1Y9ZA 4FJ2A 3OI7A 3T7RA 4ZDWA 2A0UA 3FDFA 3O8DA 5CW2A 4N6OA 2PSHA 4MA0A 2B5VA 3BTUA 3L79A 1PRYA 2PKQP 5ICFA 1X7XA 1G16A 3OQIA 1T15A 1C81A 3NBUA 4U0KA 3V8NA 2VL7A 4F85A 4P7KA 2TRSB 3A9WA 2XVAA 3HCRA 3IBGA 3KJGA 1BA3A 1T1GA 3HR7A 5DBHX 4PLZA 3ZC3A 4XXHA 4EVSA 1AURA 1YE3A 2LKCA 4PAWA 1VL0A 1ZMOA 3E15A 3PQ8A 5DN6D 1MAVA 2XJ4A 4UNSA 2O23A 4LPKA 3IV7A 4UDNA 4RIHA 2AQ8A 2DPLA 3PD7A 3QMMA 2IXTA 2A9VA 1IWBB 2PX6A 5THKA 4ZEVA 1SBQA 1EUQA 4GNKA 2IKSA 1JSRA 2NACA 2PWZA 3GJ8A 2A30A 3IMEA 1IC6A 3C4JA 2K6GA 3GRRA 5ANRB 2VBGA 3DTVD 2WUFA 3AR5A 3ECCA 4MS4B 2NUTA 1JXQA 1XROA 4ATNA 2FFAA 4DLWA 2AUNA 4GGMX 2D1FA 4LJAA 1C1DA 4JZYA 3INNA 3BXEA 4Y2SA 1JDTA 1LLDA 1L8LA 4FEYA 5E4YA 3RFFA 1SXHA 5E1BA 4O4JA 4J1TC 5DYIA 4CZ2A 5I4CA 1VSUA 4CKWB 1TPZA 2Z2ZA 1DIGA 1F8YA 1MX9A 2Q5JA 4IF4A 5LDGA 4BJHB 3SD7A 3G23A 4PU0A 1JJFA 1VBKA 3LP8A 4YJGA 3ILHA 2D3TA 2AZXA 2O2HA 4XQEA 3ZW8A 1I4DD 2B1RA 3EGDA 3TOXA 3BRWA 5K6TA 4TLEA 3OOEA 3AL2A 2C3MA 3CXUA 3TBKA 2ISQA 4OLFA 4B3XA 1Q7CA 2ZCVA 4J6EA 3C5VA 2OWEA 4OSEA 5CT5A 1P44A 2DPYA 3E23A 4S1OA 2EBUA 1C9MA 1MG5A 3FOWA 3T5PA 3LVFO 4UQPA 1UFVA 3RIXA 5DULA 3T1HB 2QAJA 3I6QA 1ZXLA 3ONDA 3HEMA 4D1YA 3DVAB 3KB8A 3ZTTA 3NHUA 5AW6A 4XZ3A 3KQMA 3FOFC 3G79A 3OX3A 4Y6SA 3UYLA 1D4OA 1N6PA 5AHRA 1CIPA 1C41A 4RPIA 4K6KA 3HVRA 4X1OA 1A5BB 2ZBQA 5JS8A 2YINC 3GLIE 4H1TA 3I9MA 5IJZA 3W9YA 1HL3A 1RADA 2J6HA 2GESA 4IIEA 3RUFA 1SUCA 4DCOA 3NMUF 2PZLA 3I4FA 4PZYA 221PA 4JYMA 5EHIA 4E88A 1ZVJA 2HJHA 4YJGB 5DXFA 1R4AA 2ORIA 1G1AA 1B3RA 2J31A 1XMQB 2PANA 2CMGA 2WF6A 1P3Y1 1V5WA 2VRBA 1NPTO 2WWHA 3A4LA 3F5SA 4K9QA 4OHCA 4CKWA 2NSYA 4MYSA 5CJ2A 3C1OA 5AI4A 4LZOA 3T5CA 1EZ1A 3ZVKA 1GRVA 1E2FA 2GRUA 4Q7EA 1I1QB 4RM3A 2CMFA 3N2EA 1VIYA 3ROXA 1NZDA 4FGJA 4KO2S 3QPUA 1C1DB 5DW3A 3ZCPA 2C7BA 4JBHA 1DC3A 4ZPXA 3LI2A 2TMKA 3SHOA 4ZEWA 3TZBA 1CR0A 1WIWA 4K3UA 5IJ9A 1ZVKA 3HFRA 4HGRA 4BWFB 1NP7A 5JSKA 4AN0A 1H6DA 3PQ3A 3LQ2A 4OGGA 5E9AA 1SU4A 4IDHA 3P2JA 4BNDA 4CIVA 1NC1A 1UOOA 3EA5A 5T5QA 3HL0A 1RD4A 3ETCA 1RRVA 2X6QA 3MJTA 3PCXA 4G0NA 2IPMA 2EKPA 4MSUA 4PO9A 5DI3B 4QHSA 3M7IA 4IUCS 3AF6A 1DV1A 4LJLA 5JJLA 3EW7A 5A0FA 2J32A 1EVJA 5G0WA 3QELA 2FN8A 5F23A 3GV0A 1OIWA 3S70A 1QHHB 1TM1E 5D6OA 3I6MA 1Z18A 4EGSA 1MTOA 1RR6A 4P2GA 3RSQA 3ZDDA 3IO5A 3WNZA 2B61A 3RRZA 4WUVA 1DS6A 2EJBA 2GERA 1RRGA 1I7DA 3NI2A 1ZCFA 4NENA 3U7JA 3P20A 1UAGA 5BR8B 4PLYA 1HE5A 2VPZA 4AF7A 1R0ZA 2QUHA 5K6AA 2UZ1A 5B7PA 2XB9A 3KOZA 1CU1A 2DKOA 3JYQA 1XRSB 2O6HA 3FMIA 4MWCA 3AKYA 3ISJA 4IDOA 4MR9B 4W8GA 1EUCB 2RK6A 2WQ6A 4Z53A 3OFJA 4LDQA 3G13A 4H1WA 2GCPA 1RYEA 1PNQA 3OG9A 4UJ5A 3QNWA 1S2MA 2H2WA 2YV4A 4FDLA 4UASA 3O2SB 4AF8A 2XE8A 4WX2B 4MDEA 1ECJA 1RI4A 2LWIA 2Q2QA 2ZJBA 2B8WA 4AJPA 3PJEA 2XTJA 4D3DA 3T99A 2VI5A 4U7WA 2ODAA 4ZYUA 3OCCA 4L4UA 1SURA 4UAJA 1N3IA 2DFNA 3GUYA 2X5OA 3K09C 3NKVA 3GPDG 4MROA 3N2GA 5KHAA 1BG6A 1S2GA 1U8YA 3E58A 4K2AA 4ARZA 5LQUA 1IYZA 1KP2A 4QU5A 4V0LA 2MSKA 3HK2A 3BH6A 4WUTA 3AHCA 1D4AA 1YV9A 2I8CA 3Q9LA 4C2TA 3CT4A 1OFVA 1KI8A 4G5YA 4FD2A 1MR3F 5D84A 1KZHA 4ZI3A 2WM9B 3H8WA 4FYIA 3CINA 3WLLA 3A6PC 5C52B 2OC9A 5EE1A 4Q16A 4KLNA 3S55A 1MB0A 1E2UA 1JX6A 3OA0A 3SDZA 5A4KA 5BSHA 3PQFA 5C8ZA 1PVDA 3IQIX 4YFYA 1YB7A 3AM3A 4QQRA 3O92A 4TN5A 4WBXC 4Y6QA 2AG8A 3T7IA 5BRAA 2FX5A 1YBAA 2HT1A 1IXZA 4GX2A 4NBVA 1QF7A 2PTHA 2X8AA 4LDZA 2L42A 4QNNA 4O2BA 3V8RA 4ENSA 5HZKA 3U7HB 1NVTA 4DUGA 3M33A 3AR9A 1YB4A 5F1YA 3BD6A 4L50A 3EQ2A 3FKJA 3FXAA 4YLYA 2O1WA 3UH0A 3QW2A 4D9BA 1KJ8A 2OXIA 1GWNA 2DWQA 3V1TC 4BATA 1P45A 1SOMA 2E1PA 2HFKA 2O7QA 4HB4A 2D1TA 4MTLA 4J1SA 4PFKA 4D8XA 1Y3CE 3PD0A 4BFSA 2YV1A 4ZQBA 2EV9A 2XYQA 4FDVA 2VP5A 3EGWA 4R0VA 2NU9B 1Y8RA 3WGIA 3ZQUA 1W36C 3W78A 1NBAA 2AKAB 3ABIA 1TZMA 5KNLA 3GPLA 4DQDA 2FGJA 4EUEA 1FSGA 2DJIA 2OQRA 4JP8A 1P0IA 4OXIA 3FPSA 4FKZA 1JMYA 1TF7A 5LJIA 3QU2A 5HZGA 2XYRA 4LXXA 3T6KA 2FUKA 3THYA 1E2DA 4CMGA 3ENKA 2G0TA 3OIWA 3EVEA 1FY2A 1HE4A 4KQFA 4GQIA 1FDRA 3ILSA 4P84A 1MVNA 1NJFA 1UKAA 1SC6A 1MX1A 3IQZA 3KX2A 1OX4A 1QQTA 3OZGA 3PCTA 4RXMA 4TTVA 1LLFA 4G85A 4TWAA 1PDOA 5J1TB 1KOFA 1NGSA 2FQ1A 2BTQA 1CUSA 4H35A 4A0HA 2NTYC 3DE2X 1QZXA 2AF3C 4J7XA 1TFUA 3REOA 5JZBA 1GTJ1 1MC5A 3RASA 1RP7A 2FSUA 3HJTA 3P9KA 3G5MA 4GLFA 4N5LA 4BNGA 5K3EA 2RI0A 5DNUA 5I7AA 2ZYGA 2BE9A 1NBHA 3ZUPA 1RZRD 3LUBA 3WDSA 1UBSB 1UFOA 3IAHA 3LHKA 3MBIA 4UVHA 4BQPA 3UFXB 2MINA 2K7FA 3DL0A 3R9XA 1FMCA 1QTQA 1E0DA 2QENA 3MB5A 2CXXA 4EY5A 3EN0A 1X3LA 1D2GA 1UKEA 2CLDX 3EF3A 3NH9A 1Q0QA 2WYWA 4QPPA 1THMA 1XZ8A 3BJZA 2YC2C 1PF7E 4MEAA 2GZ3A 4MV7A 3ZWOA 4ZHQB 4K8OA 3I8XA 4PF1A 2HDHA 1Y8RB 2CKMA 1S3GA 3H9CA 1Z83A 2VPYA 4KZPA 4L2IB 4XX0B 5SICE 3ETLA 1OROA 1S7GA 4EJ0A 3GT0A 1SC4A 2DUMA 4LXYA 3V4FA 1U7WA 1P80A 3D1JA 5KIAA 2Y92A 4B3CA 3IXQA 4Y2QA 1E4VA 1XCMA 4BVLA 3IEPA 3L05A 3OJLA 2DULA 1G0OA 1G291 2NT3A 2QGZA 4QUBA 3LVRE 2HXYA 5AXCA 3ETEA 5HMLA 1D6JA 4G5GA 4NE7A 2Q7OE 1K7EB 2GVZC 4KYUA 2FMHA 3FPEA 4XIYA 4FGZA 5C8YB 4NNOA 1PBNA 4R8VA 4UZSA 4GZ6A 4J4HA 4ARUA 1AKVA 3EVFA 2XUFA 3UMCA 1FX0B 4O63O 2GZSA 4B46A 3IAM1 4G2NA 3IP1A 3WTBA 4WCFB 4R3NA 1UZUA 4HYQA 2LDBA 1HORA 5DEOA 4BGVA 1XPOA 2AR0A 1K92A 3RB8A 3IP3A 2C96A 1H3EA 2HCFA 4MVCA 4FE4A 1ZWKA 1GYRA 1YHNA 1T6ZA 4OGKA 1TJPB 4WE3A 4FLEA 3HHEA 5EPOA 1OH8A 1MH9A 5A3JA 2O14A 4N5NA 4OF4A 3M4XA 1EINA 4G23A 4W8OA 4JBYA 3SC3A 3AR8A 4QTZA 5ESWA 3Q1LA 2A9OA 4QG3A 5IC4A 2HEGA 3BF8A 4DMUB 2QVZX 2D0IA 3FYCA 4LMAA 1VLLA 4DCNA 1YKFA 1PEAA 1WS6A 2D7JA 4BL5A 2OECA 2DBZA 1RZRA 1XOIA 3EEYA 3HYRA 1JIUA 3P96A 4YNBA 2DU8A 1M1YB 3L49A 2N1BA 4JLNA 1T24A 5KYVA 3B60A 4PPNA 4EYKA 4RKFA 2OP1A 4BNMA 4CLHA 3DUFB 1DQSA 4CF4A 1PW7A 2EAUA 2GO1A 1ECBA 1G5HA 1HT2E 7REQA 1XTRA 1KZGB 3H5AA 3K4PA 1P7YA 4L9WA 1DKRA 1CNMA 5C8YA 3GN2A 3HY6A 3VOAA 1K1EA 5ULLA 2Q0QA 5HBRA 5JJCA 1ZGHA 1W88B 4C4YA 1GPH1 3AU9A 3AEUB 6Q21A 1EX1A 4LXTA 2BGNA 1LUAA 2JC3A 4II7A 3DFKA 1JVNA 1RC1A 2PWAA 3B3GA 4LK2A 2O8CB 4ALIA 3JASB 5JSQA 1M2OB 1V1MB 1WP9A 2OFWA 4QC2A 2NXJA 1FFXA 1CJTC 3SS7X 2XVZA 1KEKA 1IXSB 4HLUA 4FFWA 3OD1A 1XP8A 3ELBA 3SS8A 1W48A 3C8ZA 2ONJA 3H3XA 3JU3A 2W4QA 3A9SA 1TD1A 1Z2AA 1JEJA 2C9CA 1DCKA 2I2DA 3PR1A 4K86A 3UXEA 4WMLA 3OP4A 4C88A 2WG1A 3ONVA 1DAEA 3D3NA 4B71A 2F1IA 4OHYA 1C0LA 3LWDA 1Z3CA 2RKOA 1SHZA 2ZJ4A 3CZ9A 3BWVA 3HKDB 4M8IA 4F4HA 5TQ2A 3TQQA 4CIXA 5KAPA 4BXOB 3KAPA 4OLHA 1TEXA 3PXCX 2XQFA 2WWFA 5KTRA 1IEWA 4ZZ3A 5AIBA 1UFKA 3AY0A 1TO1E 3INTA 3EHDA 3SE7A 3X43A 1XNQB 3O7MA 1Z6GA 4NH4A 1WQ1R 4UXJA 4XTRA 2I03A 3T94A 2J48A 1J2TA 4HAWA 3RS8A 2FXIA 3SI7A 1HDZA 1NDHA 1QOQB 1U5BA 2V58A 4MVJM 2VAXA 3C5CA 4B6PA 3LYLA 4K5QA 2BM0A 2JIRA 1ZN8A 1BWRA 4CUZA 3M6MD 1WSAA 1KR5A 1N2BA 3I45A 3NVDA 3TDMA 3EIUA 3B1KA 4CIDA 4NVRA 1Y1TA 1OGIA 5HFJA 4U6SA 2E6KA 4ZQEA 3RR2A 3GGCA 3SLRA 5K6RA 1CNEA 1W75A 1YZNA 2PD4A 3CW9A 1SZCA 3JV7A 1TK3A 3E5MA 4ED9A 5ICGA 2BGJA 4G0MA 1ZNYA 5HE8A 3THYB 2E18A 2R8RA 3D6VA 1MAUA 1ZJZA 2VAMA 3K5IA 2J08A 3C5HA 4TMYA 1RQ2A 3CB2A 3KWFA 4M0KA 4XDYA 1S2LA 5BQ5A 1CHDA 3I1IA 3Q7SA 2XUOA 1UJBA 2PX3A 2WHPA 3CZCA 5DBEX 3VVCA 4E30A 4EMTA 5IFKA 1MEJA 5D1HA 1JHAA 5FBQB 5J5AA 4E1VA 2Q4DA 2VZLA 1VRVA 3CLRD 3DBIA 1VCMA 1JU9A 3H17A 1KZ4A 4II2A 5DMXA 3MIZA 1VJ5A 3FMVA 2BC9A 3ICOA 5J2TF 2X86A 4ZICA 1X7WB 4UC0A 3WYEA 4V38A 2JFGA 4HRVA 1LPMA 2C20A 1RPTA 3FTDA 3O9MA 3O95A 4WERA 2MSDB 3G2KA 3VR3A 3GCWA 3HKBA 3VOTA 5LP1A 3ZLJA 2WT8A 1BOOA 5F5XA 1P8AA 2VTBA 3EF1A 5BXQC 3T3OA 1ISHA 4AKSA 2W6ZA 4YK7A 4O4JB 5CNIA 3LY7A 4NAVA 2Q3CA 1N7IA 1FMJA 4H2DA 2OBLA 4QVGA 4V3CA 3AK4A 1Q17A 4YFVA 5CX1A 5FTJA 1E0SA 1E2IA 1EWKA 1U7UA 2AXPA 2VF2A 2WVHA 3CRRA 3KZKA 1NXXA 4Q9DA 1LDGA 2ZIVB 3OFND 4MIEA 1NLMA 1V4BA 2EL7A 2NUTB 4RADA 4ZANA 5T4HA 3UHOA 3N5CA 3QYFA 2UYGA 4P7FA 3AERB 3CG4A 1W49A 4XFKA 4YDSA 2Z83A 1DVRA 4YLEA 5AI5A 2YIVX 3SR4A 1L4LA 3O0DA 5I9NA 2RH4A 4IM7A 4CV3A 3Q88A 1YF3A 2QZPA 1N2GA 1T3TA 1TZCA 3DDUA 3JVVA 4WVFA 3EXFA 3IBTA 2H1LA 5KNDA 4QG7A 1D6SA 3K9LA 3R3UA 3SIRA 3H0CA 3U3XA 1A8HA 2ZRFA 1SVLA 3H11B 1AHHA 1PT6A 1D4FA 3TQSA 2VP6A 3FUCA 3ZTYA 4DC0A 1EVIA 3EFOA 5K0SA 4DSZA 1GO2A 1XPJA 4OP3A 3N2KB 4Q3OA 2NZXA 4N5MA 3V2IA 1WUYA 3OKCA 4JYPA 5KTNA 2C2GA 1E3EA 1TEZA 2ZI7A 4M1WA 2IHKA 4QLBA 1IEVA 3V2HA 5I5GA 2PGXA 5TMDA 1L4KA 2GDZA 3BBLA 5FXMA 3OQMA 2J3QA 1X1AA 3P0EA 2F67A 2R5WA 1FRNA 1P7VA 2G1JA 1NFFA 4XH9B 5JTTA 3AYXB 3BA6A 5JASA 2NXWA 1IY8A 1GRRA 5HBGA 2REBA 3AWIA 1E5XA 2R6JA 3CLKA 3F67A 1PO7A 1OHHD 1OVMA 2DPMA 2WE7A 2WPNA 1E61A 2WSSA 3TTYA 2V5UA 2XEXA 1CVIA 3S40A 1CR6A 4FYKA 3VPFA 3PHBE 3IUYA 4B8WA 3CRNA 1YJXA 4HDSB 4X8LA 4R05A 3TGWA 1ZOPA 4WKPA 3GGJA 3TQFA 3KL2A 1SK8A 4WK6A 1KEEB 2WDPA 1JYFA 1E1LA 3UHAA 3W2EA 4DLPA 2OFOA 3JTMA 3M1AA 2V96A 1PJ4A 1JJIA 2AEFA 4KN5A 1P29A 5AW9A 4HWGA 5J4VA 1KWKA 4ONEA 1Y33E 2R5NA 2HPAA 3N0VA 2R4QA 2F43B 5AKEA 2WTMA 4PONA 4BYGA 3EXG2 2IU3A 1YONA 2BJHA 2CVOA 3JSAA 4K46A 1XX6A 4QE3A 5CPFA 3WOHA 5JNSA 4HLQB 4HPWA 2AVNA 1ZDMA 3AB8A 1P2FA 1DELA 4J16C 4P32A 5DNWA 4ZVQA 1IXYA 3UJ7A 3S68A 1U0EA 4KXFB 1ZR2A 1KMIY 2CXTA 4JSRA 4DAOA 3A0UA 2CD9A 2IF0A 3Q87B 3BXOA 4B48A 1JEQB 3FF1A 4K40A 4CLDA 3A6FA 1KJZA 3KJEA 1EM8B 2WUWE 2FPWA 1P6XA 4F3NA 4HPXB 4EJ2A 4JLWA 4BJ1A 3DFMA 1SAYA 3UJDA 1VIMA 3I04A 3Q2IA 3TEJA 1OU4A 2EGHA 3IR7A 3PGVA 4EFMA 1OLSB 1WBJB 2IOQA 3M6IA 2Q07A 3QE0A 1UC9A 1G5IA 2VSNA 4JELA 4ML3A 3DBOB 2EX4A 4ZT6A 2JIMA 1BKYA 1YRAA 4RY9A 4B7UA 4Q18A 1OLOA 2RFLA 1U2DA 3BCHA 3EASA 4FYXA 3AY6A 3C45A 2I2FA 1NWHA 1NOKA 1LGYA 2HBYA 1M8FA 1C8BA 2RH8A 4PICA 4DDHA 3UJ6A 5K8VA 3CPHA 1JXAA 1KF0A 1NQ5A 2X7JA 3ENVA 1V9CA 1DBQA 2DWOA 2I4TA 2JGLA 4ND8A 4WY5A 2JK0A 2UUAB 1X80B 2HA3A 3L7YA 4R9NA 2I34A 1TLLA 2WA2A 2GJSA 4LK3A 1QYVA 1ORRA 1XELA 2QJTA 3NHAA 1U0FA 1HDOA 3VHLB 4NXNB 5FDFA 1NUSA 1QK3A 4H0CA 4QWMA 3ESYA 5NLLA 1U8CB 5KC9A 4LX0A 5EQFA 3NXSA 3VHRA 2J0SA 1OXSC 1VZ3A 4CM5A 2AC7A 2AXEA 4FONA 1JHUA 3P2MA 1KMNA 3U19A 2OWDA 4KXYA 3TPFA 1KXZA 1HTTA 2WG0A 1B8UA 3EGDB 5LQRA 1M73E 1WPXA 1V16B 3F4LA 4F5ZA 1EM6A 3EZXA 4NECA 2DUWA 1OFUX 3EB9A 3OMWA 3K6SA 1B43A 1VG9B 3T9FA 3WL5A 3A36A 1MO2A 4LX8A 5IBRA 3GW8A 1MX5A 3OEYA 5MGBA 1XJCA 2NLOA 3ESRA 1NVGA 4X3OA 5CXUA 1HBJA 1S9DA 3KJQA 2WTUA 4BC1A 3H9UA 3A25A 4TWIA 3SU8A 1LDBA 2JKVA 1R74A 5JSHA 3CO0S 5LXTA 1GPYA 2HDNB 4LXQA 1ONBA 1WABA 3NYRA 3K5PA 2QYTA 1T29A 3EIHA 4YRPA 1AT1A 1LW6E 4ZCTA 4Q47A 2H06A 1HNZB 2OC4A 4BKOA 3ANNA 4C2UA 4C7XA 1LY1A 3K9HA 4LSGA 3WGLA 5H82A 2IBSA 2VZ9A 2X3FA 4FEEA 4NI5A 5D87A 4M9XA 4YA6A 1O87A 1V16A 5JANA 2XWBF 2G8LA 1IN4A 4HK4A 3U1BA 1PLLA 1ZICA 2FPIA 2Q45A 1VFPA 2WWIA 2YXDA 5H1YA 5JISA 2QYHA 3MRTA 1E9VA 4DRZA 1WBDA 3R24A 1UBTS 4UATA 3UMRA 4OB7A 3VV2A 1ARZA 2XOXA 2BEKA 1U0JA 4MP3A 6GPBA 3O4FA 3TJRA 4AF6A 1G64A 5L3QA 1KI6A 1HE2A 3NPMA 4NPHA 1SG0A 4PS1A 2K2QB 2QV7A 3UVEA 2B92A 3SYMA 2FPRA 2CT8A 3LBHA 5JJKA 2JW5A 4KIJA 5JCXA 4FPXA 4MAFA 4P8RA 4DAEA 3FBWA 4NOLA 4F60A 1LLQA 2R1TA 1JA1A 3H1FA 4PBRA 1FU7A 3MQ4A 2W6PA 4IMPA 5AKLA 5B6PA 2WUDA 2J46A 2P3SA 3A3KA 2XMDA 2MYNA 3KOXA 3PC4A 1TGYA 3KLOA 3EPLA 2MR6A 4MHTA 1Z73A 5H80A 2QVLA 2WWGA 5JC1A 1P39A 3QITA 4Z99A 2FMUA 3NT4A 2QN9A 2CLEB 2OORA 3G3EA 5T7BA 1G3IA 2RI6A 2H00A 3GLGE 2VKQA 1Q2UA 4OHWA 2HSDA 3ICEA 3PLAE 2ODNA 1OXUA 4PG7A 3IKJA 1N6NA 3U1VA 3T3MB 2V3WA 3O03A 5DGXA 2XKKA 4I19A 1MJ5A 1X0XA 2FPPB 3LT5A 4IJKA 4AUNA 2ONCA 2EVWX 3M3HA 1C3OA 4JP3A 1U9YA 2GRJA 4RX1A 5T4BA 2I6SA 4FE7A 1P2DA 4TLDA 1Q3HA 3LF1A 3WYAA 2WVJA 1UDXA 4OA5A 1H2HA 3ZCRA 4DGQA 1VE3A 1FSFA 5JCJD 3I2JA 2YWHA 3IT1A 4G67A 3DKRA 3MRXA 2HF2A 2BD0A 2WWWA 1SIWA 4P3PA 3U9LA 3HXOA 4V24A 4YO7A 4ZDKA 3CVXA 3G2QA 2IIBA 3HU3A 2Z5LA 5A5GA 1XF1A 2D5AA 5HQJA 1RHKA 3EDMA 5KQMA 5TGZA 2JB9A 4OB6A 1L5GB 4LPSA 3RUDA 3FTQA 4M9CA 3I61A 1GPDG 3A6ZA 4XGQA 4X63A 5F2EA 1AM4D 1NHWA 3KHUA 1OC2A 2BMFA 2ECKA 4ZYVA 3ECAA 1GNSA 3UK6A 3GNTA 3F8WA 4HDSA 3DQQA 4HNTA 3COSA 3MCUA 3RAJA 1RWPA 3RV3A 4EBBA 3DCIA 2OQVA 1ZM2A 4F96A 2Z3VA 3HUTA 4I9UA 4QYIB 1WR8A 1R6DA 3N6RA 4LF6B 2VPXA 5EE0A 1XDUA 1GNRA 2MMCA 3ZI0A 2ZBUA 1O5OA 4KKXB 4N8EA 1PR5A 1PK7A 1WW2A 1M2HA 3BMNB 4LTNA 2GF2A 4EW2A 2C2BA 4KCGA 2BFBB 5K3AA 3SIWA 1E8NA 3A6JA 5K1ZA 4CHTA 2HD4A 4DVJA 1PGPA 4HGPA 4RHFA 1ISJA 1FYEA 2QRJA 5FI5A 4ND1A 2OZPA 2REQB 2Y1WA 2NPFA 1R4MB 1X8KA 3PL5A 3R4VA 4UMDA 2AFRA 1JG6A 1WXHA 5LYYA 1QRSA 3BMCB 2WLSA 4BV3A 5KO2A 4IZ6A 4RUKA 1BHO1 2XADA 2ZJ3A 3C2QA 1TLFA 4GKBA 5EMLA 3N2ZB 2AJCA 3H42B 2AJ8A 2CNDA 2H1SA 3E0QA 5CCBA 1K68A 3EY9A 1GU0A 2JHPA 2ZRMA 1G7SA 3NHBA 4KK3A 2CUNA 3MD9A 5FA5A 2W6JD 4JXXA 3OQHA 4B87A 5FUYA 3FCXA 4Q1CA 2W2QA 2H7VA 4EMUA 4X85A 1AKYA 3SC6A 1VB5A 4MUNA 4ZOCA 3R0JA 2BTQB 2MMGA 3GVHA 4ZOEA 4DJDC 2V6BA 2AE2A 2AOTB 1ZC4A 3SDBA 5C18A 2VSFA 4AX4A 4XUDA 4Z1MD 4PPYA 5F77A 3EODA 3IALA 4BWGA 2Z98A 3I83A 4ILEA 1E1NA 1NRJB 2I6GA 4J76A 5JPIA 4F92B 1IUNA 4Y6OA 1VRCA 4B85A 2QXTA 4F3YA 2GT1A 1DEAA 3F6YA 3K71B 1C80A 2NV6A 2CK3D 4TTRA 3TNJA 4WXYB 3UTCA 4C21A 3MWLA 2B37A 4AZ3A 4ZRDA 1U0SY 1M8KA 2FZLA 2C4VA 1PR4A 3VOSA 3CKMA 2HJVA 3X0DA 1XRNA 1GY8A 4CQNA 4LF4B 2NU9A 2V6GA 1Z5ZA 1W29A 2CFRA 3OZUA 4LRUA 1N6LA 1TM7E 3SWWA 2GBLC 2ZJ1A 5I7VA 1M3SA 3FYUC 2RGDA 2IW1A 4GBGA 2O2IA 3MC1A 4I08A 5GIPE 4XQ9A 3PUHA 1C9EA 3GXBA 3N2YA 4FI3F 3FKSD 1M7GA 2WKRA 1LRLA 3R3ZA 2I6TA 4QREA 3O4VA 4XSGA 1JR6A 2P8SA 2ZOSA 3CS3A 4XD7A 2HZ7A 3EPKA 4N3GA 1DBSA 4BNIA 3EOBI 1DOZA 1GPUA 1VKHA 5JO0A 4AZ3B 1Y8AA 2O3JA 5K0FA 4XLLA 5BMVF 2YY5A 1SEPA 5BVGA 5IABA 2H17A 1C9NA 1YS2X 1RVV1 2ZUBA 4MYHA 4EIWA 1NMEA 1KY4A 4JK3A 5CBKA 5HJ7A 3ZJYA 4X7RA 3TD9A 1VBFA 2RGNA 2C7PA 3HJBA 5TS3A 4C01A 4D2IA 4NYIR 4FINA 1XRQA 1JWLA 4X00A 4XA8A 4HMOA 4ZT4A 2BGTA 1V41E 1UQUA 4FR5A 5DN9A 1HLGA 5CM2Z 3LLMA 1Q2XA 1U5BB 2IYPA 1KVQA 2R2AA 3C6BA 4NYMR 1MORA 1K86A 3U7EB 1NMSA 4A2WA 4CPDA 2IY7A 3K5WA 3RIGA 2CZQA 3HSYA 3NT5A 4H7HA 1W5SA 1D2EA 3RTEA 4N0DA 3L82B 1RRFA 3BRWD 9LDBA 5EE3A 1XXHB 2ZR9A 4WBSA 5F1OA 1IZ9A 2BKVA 2W37A 3O31A 3WIEA 1CSEE 4PCLA 1X1SA 1VGRA 1Z16A 3IBFA 1EVKA 3JQPA 4DQKA 10MHA 1PR2A 1QHYA 3QBJA 1T6YA 3R8FA 5MFZA 3U40A 1UBKS 5DGIA 1QHNA 2EJWA 3SF8A 3SKVA 3W2GA 2XZOA 2H6EA 2YFKA 2WP8J 3OZCA 5DJ5A 1O3YA 4XRRA 5DHUA 1GSAA 1EXNA 3SZOA 1ZUD1 1BWSA 4QYIA 3C0KA 1O0CA 2C29D 4G25A 2WM3A 4YALA 3NM4A 4EQ6B 5DYTA 1QHHA 3A1TA 2EGUA 2IYRA 2XQIA 5CA0B 1W88A 1CEYA 1AY0A 3AEXA 1TAQA 2OESA 4RJJA 2ZITA 2ZGVA 1B1CA 2C84A 2J9YB 1TCAA 3DAHA 2FCRA 4URHA 4ZO9A 1ZN9A 3ZE2B 1A8PA 4FVTA 3EG9B 3ANLA 4BQFA 3I5MA 2RHLA 4RE5A 2FW9A 4F8EA 3QE9Y 4IGKA 1JT9A 2C5FA 2MWMA 2EDAA 2ZBGA 3OE5A 1MB4A 3SAJA 3ADBA 4A5SA 4YCLA 2YS7A 3TI9A 5IKXA 5IZCC 3CVUA 1DCMA 2R8OA 2VDPB 1ZN2A 3HBAA 4RTNA 4RVUA 1GPMA 2GN0A 4GRDA 3A04A 4LHZA 4XCQA 2ACVA 1PFKA 4EG4A 2BHSA 4C4RA 2I7XA 1T0HB 3UEOA 5BNIA 1CQWA 3JQAB 5AKGA 2ZSDA 5FHQA 4ZCRA 1XDWA 5FJJA 4MARA 5EVJA 4AKHA 3WV5A 4MI1A 4RCVA 1JHXA 1MXHA 2J7PA 2WF9A 3CN7A 3HYTA 3OIUA 3QFHA 4QUHA 5FWAA 4EW6A 2RGRA 4DJAA 1S2OA 2P4QA 5F2NA 4BNKA 4R9SA 4A5OA 3SBOA 1UP4A 4RGQA 2PSEA 3GK3A 5DHQA 1GQ2A 1PDWA 2YOHA 3LKVA 3ZGZA 1RYFA 1QYXA 2HWKA 1POWA 2XUJA 3QBTA 4J29A 4XIJA 3K0SA 4C4TA 4KIFA 5FF9A 3MJHA 4RK6A 3ZW9A 4CTOA 2X42A 3A32A 2FPKA 3C85A 3MGAA 2I1QA 5EZ6B 3GLKA 3ROKA 3MNFA 3BIFA 1CPYA 2WZBA 1R5OA 4GDMA 1XMSA 5JCOC 3BMOB 1NDQA 2CXRA 3LRXA 5CNMA 4B82A 1CY2A 1IG0A 2PHZA 2WAOA 3PPWA 1WCYA 4IS2A 4NAUA 4YPFA 1H0KA 4I1UA 4NEHB 2FZWA 2ZI4A 4MGEA 4RCYA 3TOZA 3P7MA 2EKZA 1EA5A 4OEHA 4ZMSA 1UC4B 3H6KA 3IEIA 3GA5A 3OOWA 1ZNZA 2OLEA 3PIDA 1LTKA 2R6DA 3B12A 3LX4A 5EWMA 1A8SA 5JNRA 3MTDA 1NJ8A 3ZQKA 1TVKB 4J1TA 4TQAA 2VUIB 4I4TB 5DBIA 1QC5A 1RWOA 4FMBB 1EFDN 2JZNA 3QG1A 3R3VA 1XNGA 4E5UA 4UBJA 4XRGA 4EA6A 1MIOA 5KJ1A 4XPIB 3EZ6A 2ZAYA 2J59A 3M6XA 4L2IA 1JB9A 4XX0A 3IJ5A 4C2BA 2UYCA 4NU0A 4BFTA 3LY5A 2VUHB 5DP2A 3K92A 2BZ1A 5FCDA 3AM4A 3HP1A 1P6UA 3KZNA 3H8VA 2C9BA 3MUNA 4HC4A 3O2JA 1V71A 2WFLB 1GYQA 4OXQA 5CX4A 4BE4A 4PAOA 1PZXA 3LCCA 2QTGA 1FSSA 1BXGB 3FFAA 4TS9A 1REQB 2VZEA 4I3HA 4O33A 2PZFA 2Y0PA 1ZOIA 1Y3BE 3P9IA 1HNWB 5JQWA 1O5TA 2P79A 4WK2B 5LCXA 2QTZA 4M36A 1TMOA 1FU4A 1WVGA 3IO3A 1PV1A 4GYYA 5H7XA 1UPFA 4JR1A 4YRCA 1DWOA 1PQPA 4YJ3B 2ZRDA 1GTL1 3K6SB 4ARCA 2NQ8A 5CXXA 1VHLA 3I9V6 3CUSA 3J81A 2AC4A 2HIGA 3ROPA 1ABFA 4MKXA 2CBXA 5EXPA 4ZQGA 4Q39A 1GT91 2WJZB 3SQXA 1ZGBA 4DXHA 4BNLA 4UCQA 4PTYA 2QD5A 4EB8A 1AUQA 4O3FA 2P40A 3HJNA 1N1MA 1WDTA 2ZVPX 1RPJA 5KU7A 3K1JA 3OQIB 4LMPA 1MO6A 1NBOA 4KW7A 3NTVA 5AUNB 2JHFA 4G0PA 5GZ6A 1RT9A 1N7JA 4OP2A 4WGGA 1Z6XA 2ZIFA 2OYRA 4H1VA 4DCMA 3MTAA 4X0EA 4OJYA 4KR2A 2P62A 4N18A 2I67A 4OD0A 3V6LA 1EVYA 3EQ7A 2OHFA 4LDRA 5FUBA 2C7OA 2O57A 3RFXA 3SQWA 4PX9A 5EHGA 4QQFA 2PIDA 1U3WA 3PS9A 2C4UA 1GEGA 3SYLA 1VSVA 3TM5A 4KMOA 4INZA 3KQYA 5EYPB 2WKWA 3V2UA 2CXQA 4ND3A 4JXJA 2YIJA 4ESHA 2O05A 4YCMA 1QU2A 4ERNA 1W0JA 4IIHA 5ALQA 5KPJA 1CERA 1AVTA 2A78A 2BGIA 1E3IA 2H92A 3HRIA 4L4XA 4GEGA 1N9GB 2Q3FA 4L85A 2IV7A 5FKJA 1EWRA 2C9OA 3HB1A 3W8RA 3WRXA 1LV8A 2Q1YA 3NHJA 2WJAA 4WOKA 4B45A 1GQYA 1C0EA 1N92A 1Q16A 3MELA 2Q2WA 3OH8A 3RSFA 4D8VA 4HDRB 5LQAA 1BD4A 1F6BA 3RH0A 2GRAA 2CB9A 1TT7A 3HGMA 1CDZA 4NY1A 3FDZB 3FPFA 1U99A 1KQPA 1I3KA 4JROA 5EL0A 3U39A 1Q7BA 2NU7A 2OUIA 4LE2A 1U2GA 2B4YA 5TT0A 1QB8A 2HKIA 3VPCA 4CLEA 4F9EA 5JS1A 2VK8A 3WGJA 4LOLA 3H0EA 4D0GA 3E27A 4QQ8A 3FY4A 4MIOA 3S5JA 2X7HA 2Y0EA 3EAQA 1G0NA 2BMEA 2FE1A 4MJ7A 3GZNB 1U4SA 2D7CA 1UH5A 2VZ8A 1CS4C 2QX9A 3H2GA 4TYYA 2WPDD 1TW3A 1NQXA 3EVGA 3MWEB 4GXQA 4NBNA 4AJHA 4RD4A 1OAAA 4XM0A 5CYFA 4PXYA 1JLMA 1VA5A 3GFTA 2PYIA 1KO7A 1K9VF 1T3HA 3L3BA 3V7FA 3IC5A 4EQZA 5JT1A 1N25A 1KEEA 1M6VA 1PNTA 4HAYA 1EHIA 5BMOA 1X94A 4UDOA 3U5TA 4BFVA 1ENZA 2P65A 3U7QA 3JQFA 4WBNB 3DVQX 3LYAA 5B4VA 4N48A 3SZ3A 1T9HA 4DC9A 1Z82A 3E1GA 4LYAA 4QGGA 3KJHA 4YRBA 4Z7OB 4LZAA 3O8QB 2UZ1B 5LBIA 1Z4IA 1ONNA 2B8JA 2Q6LA 3HTXA 2G4CA 3HZZA 1AO0A 1ZFNA 4R3WA 3WLEA 5H68A 2IIPA 4F6RB 5MN4A 3BD9A 3GLIB 1GADO 2YVKA 5ARBA 5FLXA 2OORC 4DT1B 2GMWA 2YXEA 3PFKA 4KQ2A 2V7GA 2J3HA 3PKIA 4L73A 4LYJA 4OJMX 4YJFA 4BQIA 5I4IA 4P36A 3BXXA 2PA0A 1YOVA 4EJMA 5A3RA 5FX2A 2ODQA 2VOEA 2D74A 1L8AA 2ATEA 3QELB 2X0IA 4A0GA 4CL0A 3PDJA 2GCOA 1G6OA 1NSYA 2JBHA 4RMGA 3S8MA 4XJVA 4DMMA 1UIMA 2WSBA 2ZIAA 3ELUA 5DI3A 5JMWA 4RTKA 2VAVA 4YMTA 4EFDA 2ZI6A 3WAGA 1NF8A 1OWLA 1WTAA 2AR7A 2QY6A 4BKRA 3MWDA 5FB3A 1E0JA 4G0WA 2FDRA 2BUBA 1R6AA 2H1IA 2XRMA 2BH9A 3PUXA 3TPZA 2O2ZA 2G76A 2V5VA 1ZD5A 2AN5A 3HG7A 5I9TA 2OBYA 1C9YA 4PHHA 5B53A 1AHNA 1I5OA 1Q1GA 1UJ5A 2FK7A 3AERA 4HF7A 3KQHA 4DV3B 5HX7A 1BVRA 3KYDB 2I4MA 4EJSB 2Y1GA 5KX5F 4RHUA 3TNYA 1ZI9A 1P77A 2F9FA 1XTPA 1PTJA 3ED5A 3UANA 3HO1A 1AJEA 3LZDA 5L6LB 1GT6A 3IIKA 2XZPA 3IAXA 4Y1FA 3D5TA 1I2AA 1OBCA 1XTUA 2OHVA 3HCFA 4XTCS 1Z2EA 2XMZA 4FKBA 4J1QA 4TZKA 1BMTA 5F5NA 3KDPA 3ULKA 4NAHA 3FZYA 4GX5A 4O59O 4FFOA 1JI0A 4M9UA 1YCDA 3AETB 3RS2A 1OVGA 2AQKA 3M6UA 4CFSA 4A27A 3BFKA 3RAEC 3EFHA 2X0FA 2Y1DA 3MTQA 4IUDS 1JAHA 2ZRPA 3MCZA 2P6OA 2W48A 3PEFA 4PG5A 2PH3A 4H3SA 4NJMB 4F5EA 4F4IA 2PSFA 3DYBA 5E9QA 1UC5B 4DR7B 3F46A 1NQOA 4NMWA 4R1PA 3ZDQA 5DYWA 2YZGA 4NYJQ 4PNZA 2NZWA 3B82A 5A5DA 3VPSA 4YUVA 3DV2A 5JPDA 1XCJA 4LBYA 2OAQ1 1GILA 4AG5A 2B0CA 1P2VA 3DVAA 2PNFA 2QLTA 1G9TA 3DNFA 4W5HA 1Y9EA 2YWFA 3STVA 1NPYA 2QVCA 1DV2A 5JADA 1H69A 3LDUA 1TQ4A 2X4GA 4YEDA 1PZGA 1C29B 3AFHA 2E1RA 4L95C 4D4HA 4C7OB 3I2HA 5EZQA 1RYDA 4U9UA 5KZMB 4HO1X 4TMXA 2BEVB 2NU6B 2QR3A 3C6MA 3Q2KA 4DLZA 4IIBA 1EWYA 5D85A 1GQFA 2JANA 3DVLA 1TOAA 3M81A 2QR2A 4KE6A 2QROA 3TRDA 2CCGA 3D6MA 5CXQA 1H8HD 4YRZA 5ALMA 4PANA 4J0GA 1FFWA 3AFIA 1SCJA 2ZQZA 1BKSB 4FNAA 4JBIA 1NR7A 1A9OA 3KIPA 3FMOB 1NXWA 2HMSA 4NATA 4C7JA 3V4ZA 3O8LA 5EMHA 2NV2B 2IQIA 2V6JA 5ES3A 1ZPDA 4RENA 3D4NA 3KP1A 5BN1A 5K0EA 5LVAA 2LTAA 4P3YA 3B1JA 1KKMA 1YQQA 1JJ7A 2POQX 2YNMC 1CJCA 1IL0A 2YVLA 3AIIA 3NJ8A 1ZUNA 3JALB 1KO1A 3FLBA 2R8XA 5KNDH 1O0SA 1QAQA 4I36A 2RHWA 4DA4A 2P9JA 1PU2A 2GTHA 4XWWA 2CCJA 3Q7EA 3CNHA 1YACA 2QRQA 4HTFB 1P1KA 4KQCA 3R7WA 2CGEA 4NULA 3OE4A 4PYJA 1MV8A 5FHRA 3DFIA 4OG2A 4YMGA 3K0HA 4KXVA 1NAIA 3RBAA 1U0TA 3NONA 3HV2A 4XD2A 1JG4A 2DLNA 4OHKA 4NXMB 4XJTA 1X1BA 1N5RA 2FAXA 2O2EA 1U8AA 3HNPA 1X3SA 1ZH8A 4YP6A 1AQJA 4Q5IA 2ZZNA 3ZBTA 1Y7IA 2FQXA 5LIPA 1CTQA 2YFHA 3IIIA 1MQSA 4FJ1A 3PTLA 5K0CA 2Z4RA 1GA1A 1X7XB 4BJ6A 3L92A 1Q77A 2WD9A 3OJXA 4UFPA 1U1DA 2WIKA 5BN4B 4D5GA 3KR9A 4GG1A 1GL7A 5AIAA 3GPIA 3MLEA 1P1HA 4ZREA 3UGJA 2ECFA 1BJKA 4JKIA 3LGAA 3IUSA 4FZRA 1LK7A 1P9WA 3T5AA 1OH5A 4PN7A 1I24A 2QQEA 3KR0A 5ELMA 4R71A 5JQGB 3K8YA 3QKSB 1A72A 1X9HA 5K9ZA 2E37A 2PKEA 3PC7A 2W2VA 2VP2A 1EX6A 4QUKA 3EXHC 3IMCA 2B2XA 1Z07A 1CE8A 4C6RA 4NE2A 3OX4A 4MIYA 1PYGA 3B38A 2CMDA 3QTBA 4Z3DA 2C8KA 1BKDR 1QG6A 4HNGA 4YJ3F 1I80A 4Z4FA 2WBLC 1CJSA 4PGHA 1JWAB 4WPGA 3MILA 3VPAA 3FTEA 3DA8A 2FW0A 3AESA 1EZZA 4LMBA 5JOQA 2XMRA 5CBPB 3IAUA 4CBVA 1GYPA 4P54A 4ZJUA 4FNGA 4EPVA 4KGDA 1HY3A 2O52A 6ABPA 2FMXA 2OM6A 3TSWA 3TTSA 1NVWQ 4QPJC 4BB6A 1EE2A 3ZDRA 2HGZA 3DHNA 3R7NA 1SVUA 2XXBA 3UAXA 4J2OA 3ZE1B 5A4IS 1KORA 3X1DA 5L40A 2WU8A 1UMBA 3ZHCA 5JV5A 4C0HA 1DIHA 1KAOA 2LD4A 2WHEA 1XB2A 5JFTA 3ENWA 2DHCA 3FWHA 5FPKA 5JDIC 1KTVA 1BS2A 1FX0A 5AICA 5KOJB 1VJGA 1J0CA 2ZIEA 3ZHQA 1K4KA 1V1RA 1L7VC 2V1XA 4TT3A 4D97A 3HLYA 4C5AA 3PHLA 4RABA 4WZAA 5FAKA 3IAS6 3VSDA 2BHNA 3IQDB 4EZBA 5FLKA 1XU7A 1XI2A 2C95A 3KQQA 3F6PA 4QBGB 4F21A 1JDJA 2ONKA 4MUGA 5AVZA 3VI3B 2ERCA 1F0YA 1G8PA 3X1ZA 1FE8A 1T4CB 1RE1A 2FOXA 2PZEA 2YYZA 5I01A 4OATA 1JSLA 1QCDA 5FUVA 5TQJA 1GGJA 3AEKB 5CM8B 3NJRA 4ER6A 2C7RA 3Q3EA 3DMTA 4Z0HO 1Z2DA 1T9KA 2LCQA 5K45A 1P18A 1GRQA 3P9ZA 3PHGA 1BHSA 2NUAB 3V1LA 3GD7A 3RYIA 5KWSA 2EKDA 1NW3A 1UBJS 4MEBA 1FSPA 4DREA 2ROQA 2WD7B 1NW5A 2J5KA 4YRRA 4JGBA 3W5BA 2FZ4A 2QZ9A 3LUAA 4UTXA 1DUIA 5T3YA 3R9IA 3WC4A 2XT6A 3RRBA 2CY0A 5DNEA 5A71A 3FUVA 4CKBA 1BEZA 1YIOA 2D3WA 3ED1A 2Q7XA 4MMXB 4NG5A 3L4BC 3P26A 1W94A 1OXTA 2C9MA 4GYJA 1EK1A 2HCBA 3NDIA 1XXLA 3MS7A 4IKOA 1A1VA 3K32A 4G8DA 3RDPA 3RRNA 4EDHA 3QOXA 1ZMTA 3FB1A 5CBPA 1OKKA 1Z22A 4C4PA 4PLWA 1EEXB 1QFZA 2UUOA 1L7DA 3O38A 3JZMA 3EZLA 3QUBA 5SY9A 2EU8A 2WQZA 3KNZA 3LWBA 2WVAA 3TOSA 2XYGA 1LQ2A 2R7KA 3GG2A 4JI5B 1XNRB 2P2YA 1VG1A 5JYBA 1SQSA 1GG2A 3W2HA 4LGCA 4FCVA 3BSSA 4JP1A 1G6HA 3QXCA 4MQEB 2YRWA 4R1LA 5EJMA 4XARA 1VM6A 4HNHA 5AK0A 2JIPA 1U7DA 3KD2A 4Z9AA 3ZE0B 4IEEA 3JARB 3G0DA 1I1OA 3MLAA 3OFNA 4CM6A 4GMDA 4RIEA 1GZVA 4C6TA 1O58A 1ZW6A 3M70A 4QODA 5MHTA 3AVXA 4YC7A 4R1NA 3R9WA 3E7PA 1ZK1A 3HUFA 5B58T 1A9PA 1GAEO 5CB4A 3AVVA 4A03A 1ECCA 4HNQA 2VQFB 3T3NA 1QO7A 3GQBA 2PT5A 5KKCA 4KN9S 4KLRA 2AQHA 4KRGA 4EFLA 5DM4A 1I0ZA 4PWYA 2BSQA 1NW7A 1CQJA 1X1DA 2CJXA 2XB4A 1UM9A 1VCIA 1YL6A 3I3SR 1I3LA 1R6VA 4MGYR 5FI0B 2OCGA 1YK1A 4XGRA 4LC0A 2ZYHA 1NI3A 3HYSA 4LNUB 4NNPA 2CLHB 5F4ZA 3LW8A 1PFWA 5THQA 4JUFA 4I81A 1VIAA 3DE0X 5A2QA 3I62A 4KDCA 2ZSHA 2H1HA 4FU0A 2OVFA 4D81A 1NG1A 4Z0PA 2W0MA 1E64A 3N58A 2EP5A 3ANSA 3U4HA 2FFRA 1EEHA 2C5GA 3V5NA 1AHPA 1VC2A 1VP3A 1ZX1A 3DT6A 2O3QA 3Q0EA 4H3HB 5EUMA 3W5IA 3FOEC 2VP3A 1J33A 4IDNA 2WAAA 3JWJA 2PFKA 3A4NA 2ZREA 3DOJA 4KQJA 1L5HB 1P17A 2XR1A 3FNGA 3LPCA 3M5DA 3P8ZA 4WOCA 5CU7A 3ZE7A 3JWGA 2G7MC 1SCDA 4B76A 4EPTA 4JC8A 1MN6A 3OIYA 3RHZA 4B31A 2PUBA 1B23P 2OK7A 1RHJA 4RKYA 4C22A 2OXRA 3KLBA 1XLTA 3ETGA 3K31A 5TX7A 4CR6A 4ENTA 3GUZA 1XPUA 1XMXA 1NIJA 3NHMA 1LQUA 4QKQA 4WN9B 2ZPAA 3K4HA 4U2EA 2XUZA 4CM8B 2B9EA 3CRVA 1HYGA 1MABB 3PF9A 3QU9A 3O1LA 5TPWB 1GNQA 1R8XA 3GLHB 3Q3GE 2C2WA 4MQFA 3KETA 1RXVA 3I2GA 1KEUA 1K63A 3NWBA 4KX5A 3F4BA 1UT6A 1Z06A 2YMMA 1MBZA 2P1RA 1G5FA 4RS3A 4BUJA 3LY8A 4EY3A 1GITA 2G71A 4OCZA 2RJNA 2D54A 4PPQA 2VNKA 3HCBA 4Q48A 4AP6A 4UM9B 3RVNA 2ZJFA 4FCWA 5AJWA 1CJVC 3OCUA 4JUDX 5BW8A 1DC4A 2MSWA 4DM7A 1RWQA 1XMOB 3G7UA 3T7EA 4BUCA 4PO8A 4X24A 4DADA 3CF4A 3NYQA 1CQIB 5HG0A 3GMTA 4NENB 2W6ID 1NJ1A 1CEXA 4K1LA 4AJLA 4EO4A 1OFIA 2P7IA 1URPA 1EK6A 3EZ7A 3TLJA 5FIUA 4OLAA 4OOFA 3KKPA 4IJMA 3ZLUA 4BLRA 4OYYA 2GWHA 3OQPA 2YY6A 3PVZA 1YUBA 4RTQA 1ND6A 3C6YA 4ALNA 4MMZB 1KYWA 2YV3A 3WHKA 5BV8A 1JALA 3SSMA 1UBGA 4YROA 1T5HX 5AVQA 4FZVA 4O4IA 4ALLA 1CRLA 2A0KA 1T9CA 2NNWB 4GBJA 4PRKA 2FEXA 2CNOA 1VCOA 3QP9A 2HLNA 4DLUA 1HYHA 3L7AA 1LK5A 3DEHA 3IQGX 2IE0A 3KKOA 2BFCB 1SOUA 4IX1A 4N49A 1ORWA 4PFJA 3MWKA 1LF0A 4HSEA 4HNRA 2CHEA 2HQSA 4L8LA 4FLFA 3LTEA 1XFAA 3UO8B 2EQBA 2RK3A 3CZQA 3UNXA 2IEIA 2RE8A 2EP7A 1XD2B 5E3IA 4N76A 2JFWA 3GBSA 2Q5IA 5JYDA 4DILA 4LRTB 3ZOZA 2Y6VA 5KKAA 3A8TA 2FZGA 3NHKA 4B4OA 5CM9C 4D57A 3RVSA 1UK7A 5M34A 2O3SA 1ZCJA 3GDWA 1KTIA 5LD2C 1ADFA 2AEEA 3I8OA 5IVDA 3WGUA 1NTOA 1SJ9A 1XDDA 1U2GC 1MZPA 1OYOA 1W59A 2H5EA 4OXXA 4RVHA 1P31A 1ZWLA 2A0YA 1JLLA 4I6EA 5KYXB 2GM9A 3OY7A 2B1QA 2Q4EA 2V65A 3AVQA 4LDAA 1GZSA 2IYOA 1JR3D 4N5DA 4XX1A 1PT8A 4ZVMA 3N8KA 3STTA 4G1VA 4KPYA 1UKCA 1US8B 3DP7A 2WB2A 2I29A 1U2PA 3IOCA 1P7WA 1Z12A 2FE4A 2ZDGA 2VDRB 3TSOA 2Q3EA 4BX3A 5A4FS 4OB8A 4HB2A 4KI0A 3PQEA 3CPSA 4JQSA 1JNYA 1K88A 3M1IA 5D3KA 5FOSA 3TD2A 3L0OA 2C94A 1I01A