1Y37A

Structure of fluoroacetate dehalogenase from burkholderia sp. fa1
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
294
structure length
294
Chain Sequence
MFEGFERRLVDVGDVTINCVVGGSGPALLLLHGFPQNLHMWARVAPLLANEYTVVCADLRGYGGSSKPVGAPDHANYSFRAMASDQRELMRTLGFERFHLVGHDRGGRTGHRMALDHPDSVLSLAVLDIIPTYVMFEEVDRFVARAYWHWYFLQQPAPYPEKVIGADPDTFYEGCLFGWGATGADGFDPEQLEEYRKQWRDPAAIHGSCCDYRAGGTIDFELDHGDLGRQVQCPALVFSGSAGLMHSLFEMQVVWAPRLANMRFASLPGGHFFVDRFPDDTARILREFLSDARS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Fluoroacetate Dehalogenase FA1
rcsb
source organism Burkholderia sp.
molecule tags Hydrolase
molecule keywords Fluoroacetate Dehalogenase
total genus 113
structure length 294
sequence length 294
chains with identical sequence B
ec nomenclature ec 3.8.1.3: Haloacetate dehalogenase.
pdb deposition date 2004-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1y37A00
3ZLUA 3E1GA 1UXOA 2P8SA 3BIXA 3O4HA 4S0XA 2HA5A 2EDCA 2ZYIA 5JZBA 5HKBA 4H7HA 3LIPA 3L1IA 1HPLA 4BTVA 4U2CA 4IO0A 4KAJA 1CUEA 3DL7A 1TCBA 5CH8A 2B4KA 2ACEA 2RIPA 2WUFA 3DEAA 4DNQA 3QBJA 3OPMA 3C5WP 3OG9A 3FLEA 1K4YA 3BF7A 3KSRA 2QUAA 5CT6A 1XZKA 5HF8A 3AJAA 2X8BA 3C5VA 3IBTA 3OTQA 5FDFA 1THGA 5AKJA 5ALPA 3I2FA 4AN1A 2JGJA 4E15A 1LPNA 4DMHA 4I3FA 3QM1A 4OB7A 3VXKA 4PV7A 1R88A 4J03A 4X71A 1IUOA 5A7FA 2RGUA 1VZ3A 3WWOA 3G7NA 1E5TA 3M81A 1A88A 4RE5A 1TCCA 1ODCA 3G0DA 3DOHA 4XIIA 4X94A 3PI6A 4DNPA 1N8SA 1X2EA 4ETWA 5AKYA 4YX9A 4HAIA 3Q8WA 5E2IA 3SK0A 1SCIA 3D0KA 5HF6A 3H19A 3F98A 1QFSA 4BDTA 2YYSA 4OD0A 4EUSA 3C87A 2GZSA 5JIBA 1TQHA 2XUQA 3RKSA 3DYVA 2LIPA 4W1SA 4U2GA 4GXNA 5DYWA 4C89A 3R3ZA 4G8BA 2VF2A 3GUUA 4C4ZA 3OC0A 1IUNA 3RM3A 5AI9A 4MQLA 4HTAA 5EIAA 4BE9A 1QO9A 4GLBA 1AUOA 3ILSA 2WUEA 1GPNA 1XRQA 2ZVDA 3OOSA 1EHYA 4OPMA 4BE4A 3IUQA 4BRZA 5ALQA 1N5MA 3RK4A 1YB6A 1NU6A 4B6GA 5KWIA 2WHPB 3ESCA 5AI0A 1XQVA 4W63A 1A7UA 5YASA 5K5EA 1EH5A 1MN6A 1YB7A 1QIJA 2FJPA 1L7QA 3WK8A 4CCYA 3N0TA 1BROA 5C8ZA 1BS9A 4CIBA 1JFRA 1ZI9A 3ZI7A 5LKAA 4RGYA 1VXRA 1PFQA 3R3YA 5ALVA 2BUBA 2QOEA 2XMBA 2QXUA 3B12A 1UK6A 4Y7DA 3QH4A 2GBGA 5AP9A 3EF3A 1H22A 2BFNA 3E3AA 5JYCA 3WKEA 2HADA 4WY8A 4JYPA 4CFSA 3DLTA 3PDCA 4EBBA 4LXGA 4BBZA 2OQIA 3R3VA 3IURA 2XUOA 4B81A 1QJ4A 2OCKA 2ECFA 1FFCA 1BEZA 1VJ5A 4KACA 1XKLA 1SFRA 2WHQA 3G9XA 4CIAA 1HDEA 5LZ4A 2W6CX 1WM1A 4DTCA 4JNCA 4CCWA 3HLKA 3X3HA 5CT5A 3WQHA 4PSCA 1O6FA 2WIFA 1A8SA 2BAGA 4DYHA 4DSZA 3AIOA 2HL6A 1A8UA 5CH3A 1AMNA 2Z3WA 3V9AA 2DHEA 2XUFA 3QPCA 5ALJA 1DT3A 3C8DA 3WK7A 5JAOA 4AO6A 4J0JA 1XQXA 3WYNA 5CH5A 3V1NA 3QVMA 4QEKA 2YASA 3ZPXA 2G63A 1YCDA 5ESRA 3D3NA 3WMRA 4Q82A 5ALOA 5AI5A 2WQZA 2XMZA 4W9RA 4C4XA 1AQLA 2QT9A 2RHTA 5I8PA 1XZBA 2OGSA 3N2ZB 4Q3LA 3WZLA 1Q0ZA 4KE7A 4UHCA 2VT6A 2QS9A 2HM7A 1ZOIA 2PUJA 3IUJA 1T4MA 3IA2A 4X90A 1ZJ5A 1E8NA 4BC1A 1VE6A 1BN7A 3BDVA 1CUIA 4X6XA 4YASA 1F0NA 2OCLA 5IH7A 1AC5A 2OGTA 2HU8A 2XQIA 5CXXA 2C5FA 2O7VA 1CUJA 5AM3A 5HQ3A 4OB6A 2CBGA 3EBLA 3K6KA 2ZJ6A 4MYDA 3HABA 3A2LA 4G4IA 2PPLA 3W2TA 3WKAA 4W1PA 1FFDA 4K6GA 1W76A 2PUHA 2JGLA 4G9GA 2XMSA 4U2BA 4DSAA 4Y2SA 3HI4A 3H2HA 1UK7A 4L72A 2XMCA 4QNNA 3AZPA 3A6ZA 1XRNA 2GYWA 4PQEA 4FNMA 4J0KA 4P08A 2PM8A 1TK3A 2XQGA 1ZIYA 2ONCA 3P2MA 1BRTA 2DQYA 5CW2A 4ZRDA 1WHSA 4GI1A 4PF1A 5D3ZA 1YS1X 2WIJA 2FJ0A 1CUGA 3VJMA 3L1JA 4F60A 2VJDA 3FVTA 1EX9A 4L0CA 1XZDA 1CR6A 1R3DA 4K2AA 1BU8A 3M83A 4ARBA 2BUCA 4IH9A 3QYJA 1UKBA 2VT7A 5DJ5A 5AICA 2HU5A 4ZV9A 3WIOA 4M0MA 2AJDA 1R9NA 2OQVA 1EI9A 2HIHA 2B9VA 3CXUA 4I19A 1QTIA 4ZREA 1XZJA 5EHQA 5ALRA 2XLCA 1ISPA 4WDRA 1XZMA 1CRLA 1HL7A 5AK3A 3WIBA 1LPSA 3VISA 1VKHA 1R4ZA 4H35A 1CUYA 6YASA 4B9AA 3DJYA 3V1LA 3GZJA 1K8QA 1WB6A 1R50A 2WU3A 3WKCA 5JAUA 3RARA 1ORVA 2ZYRA 3DDUA 1H2ZA 1XQWA 3D2CA 1YASA 1EB8A 4X93A 4GBGA 2B20A 4EY7A 5ALSA 3FBWA 1GKKA 1MO2A 1Y7IA 1XRLA 2XUAA 3I6YA 1DU4A 1U2EA 1MTZA 3EQ8A 2VJCA 1EK2A 3AZOA 2H7YA 4QDOA 1ACJA 1JJFA 1F6WA 4C01A 1K6EA 1THTA 2JGKA 4AZ0A 2C4HA 2ACKA 5JZ9A 2JEZA 2EEPA 2AJCA 1UOQA 4N8EA 3ZWQA 4FLMA 1Q84A 5BOVA 5K3CA 1A8QA 1FFAA 5LP1A 1LGYA 3ICWA 1VA4A 2PSHA 1ZICA 5EHXA 1CLEA 4BVKA 4H0CA 1UFOA 3B5EA 4NVRA 1H23A 5ALGA 3STYA 4E11A 3H0CA 5FLKA 3IUMA 2XMRA 1LPPA 2ZSIA 2VTVA 1ZI8A 1AX9A 5JARA 1J07A 3AILA 4YPVA 3WK4A 4AB1A 3TGLA 5AOCA 5A2GA 5EFZA 3PF8A 1DT5A 3ESDA 5JD5A 1Y7HA 4E46A 3R41A 1U4NA 2WU4A 1EVEA 2WFLB 2V96A 4XX1A 4JYMA 5ALWA 2CUTA 4BC0A 2C0QA 5AJHA 2JGMA 2JBWA 1XZCA 1H2YA 1XFDA 1G4HA 3O9MA 4O08A 3WI7A 2XMDA 4F5ZA 2HA3A 4HXEB 4B85A 1YAJA 5DNVA 3TJMA 2WSLA 3H17A 1KEZA 1LZKA 1HQDA 3GBSA 1MNQA 4Y2RA 1IZ7A 4FKBA 1JT2A 4FBLA 2VJAA 2WTMA 3D2BA 1CUDA 3BF8A 3GELA 2XUGA 4J0GA 2WIGA 1EB9A 5FV4A 1J1IA 4FOLA 3OURA 3JW8A 1QOZA 1CPYA 1ETHA 5DYTA 4UFOA 2QJRA 2C5GA 1CUHA 2C0PA 4BVJA 3G8YA 4FFVA 3O4JA 4UBIA 5D7BA 5AM5A 4RPCA 2VATA 4GDMA 4HXFB 1LZLA 4KE8A 5DWDA 4Y2JA 1TAHA 2AJ8A 3KWFA 5T4BA 4A16A 1ODTC 1IUPA 1GKLA 1FJ2A 2QKYA 3WWDA 4P93A 2OCGA 2XUHA 4PW0A 2D5LA 4PSUA 1EK1A 5JD4A 5DNUA 1SOMA 4A23A 3PF9A 2XUIA 3BXPA 3VKFA 2QRUA 1MX9A 5ALTA 2WUGA 3G02A 1Y37A 1PV1A 3FVRA 3DNMA 1YA4A 4UPDA 1BCRA 1Q0RA 3BDIA 2Z3ZA 2PSEA 4CG3A 4J0DA 1OCEA 2PBLA 3FCXA 4H7FA 1IZ8A 4DM7A 2QTBA 4BYMA 5JZSA 1CUAA 2J3QA 1H2XA 1VZ2A 4G5XA 3ESBA 4KYVA 5F4ZA 4BAUA 4KR0A 2OAEA 1MX1A 5FUMA 2Y2VA 2HA0A 4MYSA 3PUIA 3EQ9A 3DCNA 4BCBA 1AURA 4FBMA 3FLBA 5D6OA 2ZSHA 1XZFA 4FLEA 4LYDA 5AKIA 3VDXA 1QIKA 3E4DA 4ZI5A 2BJHA 5FPQA 4EZIA 3I6ZA 3UUEA 4J3JA 4B80A 4ITVA 4ZXFA 5ALKA 4N5IX 2DQZA 4Q3OA 4EB0A 1XZLA 4CG2A 4G1FA 3WWPA 1DX6A 3O95A 3C43A 2XUPA 1GPLA 1QGED 2HA4A 2XDWA 2WFZA 4KE9A 3W05A 4ZV7A 3O4GA 5T4HA 1XRMA 3WL7A 3HSSA 5C81A 3V1MA 3CCBA 4XVCA 5IVDA 2H9YA 5AIBA 2HRQA 4OUKX 5HK9A 4W1QA 1SC9A 4CG1A 4LXIA 1UOPA 4B83A 2CEKA 3MVEA 3BE8A 4KAFA 2XQKA 5AK6A 5A6VA 4C6HA 2FUKA 5A7HA 2ZYSA 4DGQA 1XZGA 3G0CA 4UHDA 3A70A 3H2IA 3IULA 1VOTA 1RWQA 1HLGA 3IB3A 4UUQA 5LZ9A 3VJKA 4M0FA 2OGZA 4X92A 4C88A 5AOAA 2G4LA 4MJ3A 3I1IA 4AXBA 7YASA 5ALHA 1QIIA 4Y2VA 3FOBA 2PVSA 1J2EA 3ICVA 5HZGA 1CUFA 2HFKA 3W9BA 2QM0A 3E0XA 4JUIA 5IVHA 3MUOA 3F67A 4BCDA 5HF9A 1WOMA 2HA2A 1X70A 4D9JA 2DSNA 4G4JA 3SC2A 5HCUA 1MAHA 5ALYA 3LP5A 3IUNA 4OB8A 2HA6A 1K5PA 3H1BA 3VJLA 1WPRA 3H04A 1YA8A 1ZIXA 2X76A 5CT9A 1XQYA 1EDEA 3PE6A 1VXOA 2BUAA 1JMYA 4BCCA 3AIKA 2Z8XA 1JU3A 2XUKA 4H18A 1C7JA 2XI4A 4ZGBA 1EVQA 5LZ2A 4NMWA 4FLFA 5HFAA 3CCCA 5LZ8A 1SCQA 3VVMA 3AIMA 1VA5A 1ORWA 4ARAA 1AKNA 5E4YA 5K3DA 1GQRA 4K6KA 4QZVA 5AO9A 1R9MA 4IH4A 3WLAA 4EY5A 4X91A 2AJLI 4KAAA 4E14A 1DQZA 4OCZA 1Q83A 2BGNA 2RONA 1MT3A 4PO3X 5SYMA 1ZGCA 4Y2QA 5IKXA 4X97A 2R8BA 5ALEA 1MJ5A 1LPAB 1QE3A 2YH2A 1OILA 1ODSA 4EY4A 2ZJFA 4GWLA 4QE3A 5K3AA 2GBIA 1E8MA 3IDAA 1BEEA 4F0JA 4UHFA 4Q34A 5AOBA 4XJVA 2ZYHA 1ACLA 5K3FA 3KD2A 5BV7A 4K5QA 2VA9A 1E89A 3TRDA 3DYIA 3O0DA 3C6XA 1X2BA 1JU4A 4HRYA 5EGNA 3DKRA 2XB6A 5AKZA 4Y2PA 2WHPA 3HYSA 1EA5A 4AMYA 2OG1A 4AN0A 3WL6A 3QPDA 1YSCA 1K63A 1QIGA 3GROA 2WG0A 4KJXA 5CT8A 1GQSA 4AQDA 5JAHA 1W4LA 4EA6A 1LPMA 3S8YA 5LLSA 2Y2UA 2HRRA 1QTRA 5FPPA 1GGVA 4ROTA 1AGYA 4N8DA 5A7GA 4B84A 3OM8A 3WJ2A 1B41A 2DCMA 5HKAA 4OSEA 3T52A 3DL4A 1LBTA 1S8OA 4BRSA 4BDSA 4J0IA 1JJIA 1WHTA 1XRPA 2I03A 2WG2A 5H3HA 3FSGA 2WFMA 1ZGBA 5AIAA 2GYUA 2VAXA 2PU5A 3UUFA 2QVBA 4B7ZA 4X95A 2VSQA 5T4FA 2I3ZA 4J0CA 2H7CA 1UKAA 1JMKC 3LS2A 4LYEA 5ALDA 1JKMA 3K9BA 4G8CA 3BWXA 3C6BA 1P0QA 4GECA 5JASA 4LIPD 2XT0A 3BJMA 3FAKA 1VLQA 1USWA 4H7EA 2VQ6A 1KU0A 3HJUA 1FFEA 5AK4A 1CUUA 2O2IA 4MEBA 3PFCA 1W52X 2IX9A 1QIEA 4H7DA 1U65A 1KU6A 5JAPA 1G42A 5LZ5A 4Y9SA 4QLAA 4L3WA 2Q0XA 4BB0A 4P9NA 4KRXA 2K2QB 5DLPA 5ALMA 1HKHA 1YR2A 4TVKA 3PFBA 4U2EA 3BIWA 2HFJA 2GBCA 5I7UA 2D0DA 4WFKA 1E3QA 1UK9A 3G9ZA 5LYYA 1BCSA 2PSFA 3V1KA 2WUDA 3I1YA 3FYTA 2I3DA 2XE4A 4NS4A 1DQYA 2CZQA 4KRYA 2BCEA 3I6MA 3ZLTA 3MUNA 4OYLA 5HFNA 1WCYA 1CUSA 1NX9A 4Q3KA 5FXMA 5T4EA 1XZIA 2QZPA 3K2IA 3SWWA 4FNGA 1ZD2P 5K3EA 5IVIA 5CRIA 3F8SA 4BVLA 4LHEA 4WCVA 4EY6A 1RP1A 1GZ7A 3I2IA 5DNWA 1QFMA 4AO8A 3C45A 4BZZA 4WFIA 3AINA 5K3FB 1UKCA 3C6ZA 1CQZA 4Q05A 2ORYA 2PX6A 3WK5A 5AKGA 3GFFA 5AI6A 5JD6A 3NUZA 3HZOA 1CEXA 4M0EA 4FFWA 3STUA 5FOQA 1DX4A 2WHRA 2HA7A 3R3WA 5EI5A 4MEAA 1W6RA 1CUBA 3FSGD 5CMLA 3KOOA 5FKJA 3QMVA 4HXGA 1TIBA 2OAGA 1UT6A 1YAHA 4H7KA 3B3QA 2UZ0A 1TKRA 1LNSA 1XZAA 2O7RA 2NW6A 4WDQA 3UMJA 3PICA 1M33A 4X85A 2G5PA 4UHBA 1H2WA 1PJAA 4GHWA 4GEGA 1QIFA 4DIUA 1CQWA 3FWHA 2V97A 2O2HA 1CV2A 1D07A 1ZD5A 2J4FA 4RE6A 4G4GA 4EY8A 4OYYA 4UBKA 1IVYA 1P0IA 1RYYA 3W9UA 2CKMA 2WM2A 2V9ZA 4UFPA 1UZAA 1L7AA 3D2AA 2B61A 3JYHA 1MX5A 5FRDA 4FWBA 4UBJA 3M82A 2JIDA 2X5XA 3H2KA 4C87A 1WB4A 3ED1A 3G9TA 3G9UA 4FHZA 1QLWA 2HDWA 1MAAA 4OU5A 2PKYX 1FSSA 4N5HX 5HF5A 4W1RA 4AMZA 3M3DA 4B82A 1ZD4A 4UHHA 4QA9A 2QXTA 3HC7A 5AHXA 3HEAA 2ZJ7A 1R1DA 4Z49A 4L9AA 2Y6UA 2CJPA 3WA7A 1W1IA 3DS8A 2OLEA 5ALZA 4DNOA 1QZ3A 2OXEA 4DMFA 1CUCA 3WWEA 2JGEA 3V48A 5CT4A 3FYUA 3ZLVA 1XRRA 1L7RA 2DHDA 4BAZA 4MXDA 2XUDA 4CCYB 2QUBA 1VE7A 3EQ7A 1OXMA 4J7AA 3FLAA 5JALA 4IH1A 4X6UA 1WPXA 2QR5A 3DKKA 4UBMA 4A5SA 1DINA 2QMQA 3U1TA 3U0VA 4UBNA 5AH0A 3NGMA 2GZRA 5JATA 1ZI6A 4QDTA 1TRHA 2BKLA 3H2JA 3KDAA 2Y6VA 3HRHA 2RI6A 1MU0A 2CMFA 3JWEA 5C7YA 4LXHA 4HS9A 2RHWA 1JI3A 1W75A 1CUVA 2GBFA 5AK5A 1QIMA 3A2NA 4UFNA 5KBYA 1DWQA 2WG1A 3WJ1A 3BJRA 3ESAA 4BZWA 4B9EA 4KE6A 3R40A 1QO7A 3ANTA 1CUXA 4LKOA 4QLOA 3AFIA 4X6YA 2H1IA 4X3CA 2WTNA 1CUWA 1EINA 3BL8A 4QWWA 1P0MA 5FP0A 2VAVA 3KWJA 5E4TA 4H7IA 4TGLA 5EIEA 1QONA 1N1MA 1MPXA 2OCIA 3O9VA 5CBKA 2XMGA 2WLSA 2XUJA 2XLBA 2HHAA 1CFJA 1BE0A 1QIHA 2WILA 3HXKA 4JH0A 5AM1A 3R0VA 3WL8A 5DYYA 4H77A 2WIKA 4QWMA 5EIHA 1F8UA 4HRXA 5AKLA 2E3JA 3FYUC 3WA6A 3GA7A 3C8HA 2C7BA 3D5EA 2WJ3A 2WKWA 3QPAA 3FYUB 1U8EA 3WWCA 2WFLA 3I2JA 5EHZA 1G5FA 2VEOA 3WZMA 3LCRA 4G9EA 1WB5A 1XZHA 3F96A 3NOXA 3WK9A 1CUZA 3WKBA 2WJ6A 4Y2TA 2ROQA 3QMWA 5ALFA 5LZ7A 4Y2YA 4H7JA 3G0IA 4V2IA 3VVLA 1C7IA 5D3KA 3R3UA 1P0PA 4PNZA 2AXEA 3STVA 3WL5A 1AZWA 5AM4A 4AZ3A 4ZWNA 3I2KA 3QMMA 3S2ZA 3I2HA 4QDZA 1XKTA 3FNBA 1JJBA 1LBSA 3CN9A 4KEAA 2WJ4A 4INZA 1QIDA 1IMJA 2W22A 4FTWA 1C4XA 4BATA 1T2NA 2PL5A 4MQMA 3STTA 4G8DA 3I2GA 1F0PA 3AZQA 3W04A 3F97A 4AO7A 4FMPA 1CIJA 3T4UA 4N8SA 1TCAA 4X00A 5AM2A 4RNCA 5LIPA 1B6GA 2PU7A 4BP9A 1HBJA 1GXSA 1FFBA 2DFPA 3HACA 3PUHA 4MWTA 1UK8A 1UWCA 3WYDA 4B0PA 1O6GA 2HU7A 2J3DA 5A71A 3YASA 4U2FA 1BN6A 2GYVA 2J4CA 2QJWA 4WFJA 4BP8A 3Q0TA 4Y2XA 1DWPA 3L1HA 1CVLA 3A2MA 3DQZA 1EXWA 1J06A 4CI9A 2R11A 5CURA 2WIDA 5ALNA 1XLUA 5A62A 5HQ3B 1ZD3A 3C6YA 1DWOA 5AI4A 4F21A 5E4JA 4I4CA 1XLVA 3SX4A 1GT6A 5C8VA 3QZUA 4UBLA 2O2GA 5K3BA 3D4LA 4XWGA 4Y2UA 4TPKA 3H18A 3NWOA 2IITA 1E66A 4QDUA 5AKKA 4DMKA 4PSDA 1UOOA 4YK7A 2XQFA 4DLNA 5CXUA 2DHCA 3G0BA 2RAUA 4X7BA 5JADA 4U2DA 1GPKA 5HK8A 5EHNA 3FCYA 2XQJA 1XROA 2BGRA 1I6WA 5AKEA 4UBOA 1LPOA 3IIIA 5AM0A 2XMQA 5KWJA 5DTIA 4AX4A 3KXPA 2V98A 4C4YA 5SYNA 4BAGA 3W06A 3G0GA 5ALXA 5LKRA 5ALUA 4OU4A 3D7RA 3STXA 2JF0A 2Z5GA 3I28A 5JANA 1E8DA 4JEIA 3MGAA 2DR0A 3DD5A 2H7XA 3LIIA 5DTJA 2YXPX 2G5TA 1LLFA 5J3JA 2PSJA 3STWA 5IVKA 2JGFA 1DTEA 3R3XA 2Y1KA 4HVTA 5BWCA 5ISMA 5CTAA 1NU8A 1YS2X 4GW3A 1LPBB 2Z8ZA 1G66A 3DOIA 2ES4A 3AUKA 3ZV7A 5BWBA 3WKDA 3QITA 2PSDA 4WJLA 3WK6A 3H2GA 4EHBA 3EIOA 4P92A 3H1AA 4K6HA 2AJBA 4NZZA 4Q1VA 3TEJA 2C58A 2EDAA 1Z68A 3CN7A 3ANSA 3D59A 5C8XA 1XZEA 4B0OA 5KREA 1EDDA 1EDBA 4WY5A 3RLIA 2IIVA 3LLCA 5AKXA 5ALLA 1MNAA 2VJBA 3IVMA 5I9IA 3F9CA 2JGIA 1ZJ4A 2JEYA 4FDMA 4IHAA 5AI8A 2I78A 3C70A 1SCKA 4HZGA 5ALIA 2OPHA 4IQ4A 4MWSA 4J0HA 5AKHA 4QDXA 4BTLA 4DNFA 2FX5A 1N5RA 4UHEA 1XLWA 2CB9A 3O4IA 4DMCA
chains in the Genus database with same CATH superfamily
3T3EA 4UVEA 5JJ5A 4LTDA 3E1GA 5TPZA 2WSYB 2FZKA 1SRQA 2ZRJA 3O4HA 4S0XA 1S5PA 1YDEA 3O4VA 1OQAA 1UODA 3KTDA 1SUBA 3A0RB 4UJ3A 2ZYIA 4DAOA 8LDHA 1PQUA 5GADl 3QXSA 4QX6A 2ZBRA 5I6DA 3INYA 4RTRA 1G5IA 1HPLA 2A0XA 1OV6A 2O0LA 4LMBA 4UMVA 2XB9A 4C03A 3EY9A 3WRWA 2D7DA 1RTTA 1CUEA 4KAJA 4PRKA 1TCBA 4NY1A 1FVFA 1XVTA 1YVRA 3CRQA 3P9KA 2RIPA 2I3GA 3LT2A 2YZNA 5AW9A 3SIRA 5EJAA 4MGEA 4R1OA 5REQB 4E51A 5LOVB 3FNIA 1N0IA 1QH1A 4TYYA 1SM4A 2IEBA 5BMOA 3KIPA 3C5WP 1NR5A 3H9GA 4YBZA 3GLUA 5L53A 1K4YA 1B2RA 2AXPA 4MQEA 1GG9A 1IOVA 3H6GA 2ENWA 5FBQB 3S2EA 1YE3A 1ZU5A 3QWIA 3E48A 3IBTA 4JGBA 3RJ9A 2C5EA 2F7SA 4CM4A 1N5LA 4RVSA 3K6RA 4IJWA 5DO9A 4DR7B 3COSA 1EFRD 4TV8B 1THGA 2H07A 5EKUA 3KJHA 5E0OA 4O8ZA 2WAMA 5F5NA 1ZC3A 1ZLYA 4FFPA 2D2EA 4KQEA 4AWXA 1P60A 2RK3A 4KQIA 3SG0A 2NU7B 4DAEA 3QU9A 5BQXA 3NBZC 3KDSE 2BGMA 3DP9A 4I3FA 3IQWA 4YBRA 1UMBB 2BONA 4HWKA 4N1AA 2ZBFA 3TW8B 1EWVA 1R88A 3IR6A 4O5OA 4X71A 1W88A 3GPDG 4C0LA 2D0PB 2WWYA 1IUOA 2WTXA 1V47A 1MR3F 4BX3A 3WWOA 1D7OA 4P5DA 1TTQB 5H7XA 1BJRE 4CIYA 1NXVA 1ZCAA 3TG8A 5J2TA 2CK3D 3C3EA 1TMOA 4EHJA 4EFDA 2QE7D 1E5TA 4U00A 5CDSA 2BEUA 3JV7A 5LA6F 1Z06A 2R3SA 4L4RA 3FHLA 4RYDA 4TMXA 4LE0A 1NMZA 4U63A 3RIYA 5ICSA 2O05A 3QBDA 1OT5A 4WNAB 5KQGA 4PX9A 4X62B 4Q1CA 3R8CA 3OOYA 5CPBA 1AXRA 3Q6MA 4GI7A 4Q66C 5HDBB 1TD1A 4D0RA 1E1MA 4XIIA 1MOZA 4R1MA 3GCZA 3PI6A 3QU5A 1G7SA 3M2PA 1ZEJA 1C30A 3CZ5A 2EOAA 1B2LA 2EQAA 4HKTA 5E95A 3UAXA 5JQGF 1TAGA 4KLRA 2VLIA 4HAIA 3W3AA 4OKSA 3AR9A 4D0LB 3G2KA 1QHYA 3UY4A 4HNVA 1XUOA 3FUWA 1E2HA 2PDAA 2GETA 3GXOA 1GQFA 2WSIA 1TQ4A 4QIHA 5B3JC 2HRBA 1EK6A 4PVDA 1X3LA 4WXPA 1KWKA 2CWWA 3F98A 4WCFC 5TS3A 4BFWA 4RL4A 3U19A 3ERCA 1PT8A 4IV5A 1SG9A 1E69A 5AJXA 4EUSA 1T1IA 4FD2A 5A4IS 1HRDA 1NJ6A 3U7JA 2NO1A 1HV8A 1TF2A 2GZSA 3G88A 1V4VA 1Y8RB 3LBIA 5FFMA 1QK3A 3RKSA 4BNKA 3ADCA 1E2BA 3MSXA 2I9KA 3T9BA 4YXFA 1L1QA 1CE8B 2VNAA 4U2GA 4E5KA 2XSZD 4L7QA 5IYZB 2LUOA 1J5XA 1H5NA 3CRZA 1N9GA 2HNBA 1H2RS 1IN8A 4MMYB 2CKDA 1HE1C 4G0ZA 1DWUA 1ODLA 3OQPA 3E82A 4RZIA 3UGKA 4HEA1 3IUSA 4MQLA 4LFBB 5KNBH 5THKA 1ID8A 3MYYA 2VN8A 4OHCA 2PKXA 4ZDIA 3HNOA 4GD3Q 4WCFA 1MJFA 2XZPA 1MTOA 1WIWA 1R15A 1XQ1A 1XEXA 1ZLXA 2RGNC 4BP3A 3IAXA 3PZBA 3ZCQA 1HR0B 1R10A 1PBNA 4A36A 1R0WA 2VT3A 2ZCVA 5B3JA 4PS0A 1ZONA 4Q5IA 4KXNA 4LOHA 4RFVA 5G3ZA 5T67A 5TE9A 3TMAA 2H2HA 3KOMA 2KYRA 3TNYA 3ZY3A 4JJKA 4ON9A 3B6IA 4JXJA 5FBHA 1EHYA 5K0GA 1ORTA 3GQBB 4AP6A 4KLNA 4WACA 3IUQA 5EQJB 1MKYA 2O5RA 3E0QA 3F7MA 3SHQA 4R7GA 4GUDA 5HIKA 1V39A 3DUFB 3JZMA 4U3JA 1NW9B 4TTPA 3AF5A 3GJ5A 3JPYA 3Q5EA 1ZVJA 3TJZA 2GN9A 1U9JA 4OM8A 3P5SA 1U7PA 1HZZC 3QKUA 4OXIA 4EPWA 5KQLA 3RK4A 4HGRA 2O7SA 1NU6A 2YOHA 6CHYA 2CJWB 1FB5A 3T5PA 2WHPB 5D00A 2LTAA 1T13A 5HYVA 1WP4A 4OV6B 3BTOA 4Q3CA 4MUYA 2HY7A 3M4JA 3NXSA 4CV1A 3N75A 3RS8A 4M88A 1WUTA 3ICPA 2CHFA 3HM9A 1ZP6A 2H1VA 2Z83A 3M2TA 2JCXA 3GUHA 3WK8A 5I7OA 1XDWA 4RFSB 2JHCA 4WX2B 1GVNB 1QMPA 1V0JA 2FI1A 2W42A 1XMXA 2HSJA 3S3TA 3U48A 2VJNA 1JFRA 1OC4A 1ZI9A 2PRSA 3E2PA 1COWD 2YRXA 3QYFA 3R5XA 4FYMA 4JLAA 4Z2YA 3R7AA 3RABA 1HE2A 5KO2A 1LSJA 2DUMA 3JYQA 1NVEA 1WO8A 1NAIA 1P2DA 3IQEA 4GIBA 4ND3A 4R01A 2Y1GA 2HK6A 4JLNA 5LQAA 2R1TA 4DWJA 1PEDA 1MQAA 2FRDA 3V8VA 1V1RA 3NLLA 3ZIAA 2VNJA 4ZCPA 3R3YA 5IT9A 1XZNA 2YWDA 5CVUA 1IY8A 4HGQA 1Y3AA 1KOLA 2IYQA 2YIMA 5ALVA 1ZBDA 2FE1A 4R9NA 1XPJA 1GTZA 2OB2A 4TV8A 4RSRA 1XZQA 1DRUA 2OKCA 3GG2A 3MTGA 4E1BA 2I2BA 1SOAA 2WHYA 5EWLA 1UK6A 1WRBA 1IFXA 4GI5A 2ZRFA 3UAOA 2FSUA 5FAKA 3ZN2A 4TZTA 1TQ2A 1H1LA 4K87A 1VBNA 3LT5A 3IC5A 1J1ZA 1IQPA 1F5SA 2WT9A 2D3WA 2JFOA 5IS2A 1SXHA 3DLTA 4IO1A 3S2FA 4EBBA 2ZS7A 3CSSA 2V6JA 5J2TB 2WAOA 1HMPA 2QW8A 3GGOA 4PLHA 1W2GA 2RMKA 1QF9A 3FOAA 1EGHA 4X6LA 3ZK9A 2JLRA 1T1RA 3ADPA 4LE2A 1SVIA 1PAUA 4Q9JA 3F6EX 3HUFA 1JBEA 1QJ4A 4PAMA 3VYVA 2WTEA 2HK9A 4QKQA 5CB4A 1WMBA 3AP2A 1HFWA 3IA7A 4QBFA 3KXIA 4KACA 4L4ZA 4LJLA 4URXR 1SFRA 1PZXA 3K0KA 1JFTA 2QLJA 1UDBA 2GCGA 3G23A 3L8FA 4CIAA 1ZOLA 4LWPA 1NVKA 1UJ2A 4UTPA 3PX7A 5B7GA 3AYZB 1QWOA 2XUZA 1X7YB 5AVRA 1FTGA 3K9LA 4RWZA 2C4UA 4XGNA 4A6PA 5L7TA 1PFWA 3CH6A 4ZU3A 2J7PD 1YHZA 1OROA 3L8YA 4MP3A 5J2UF 1E2DA 3G2JA 3OT4A 2B34A 3FMFA 1HDCA 2W6MA 5DHAA 4DLBA 3F7NA 5B3AA 1MJGM 3AFOA 2G0AA 2OO3A 1SU6A 5F78A 4B6FA 5K03A 4KFCA 3C6MA 4OMUA 2P9TA 3DZKA 2CCKA 2J46A 2WIFA 5AJZA 1QH9A 4LV8B 4UU0A 3ZWNA 2EGGA 1JDBB 1Q12A 1H8HD 2ZSBA 3AIOA 4DM4A 3JVVA 1BOFA 5CH3A 4D9KA 3V9AA 2NTVA 3MEQA 1J33A 1P8JA 1HE3A 2IFTA 2ZDGA 3EGCA 4UM7A 1L5QA 2VJYA 3PE3A 5ALJA 3VPFA 5A4JA 1KO7A 3B9QA 1YQXA 4BLUA 3R8FA 3A0UA 1PVVA 4J0JA 1JWLA 1T6NA 1RJWA 1U8ZA 3HA2A 1E98A 1ZA2A 3EGDA 3L3BA 2DKOA 4H3VA 1LDBA 2YWRA 4JUCA 4RTMA 4QEKA 1OPXA 3TTUA 3K5IA 2XRFA 3KJIA 4BIMA 3W6UA 3PQ7A 1D2MA 1CNEA 1XT6A 1N5JA 2VDUE 3FNEA 4JA0A 1KK2A 5ECWA 3SDZA 4RVDA 3P9CA 5EP3A 2QM7A 3QPVA 1CB7A 3UJBA 5KNCD 2J9FA 1ZH4A 1Z0AA 3BAFA 1VPLA 2CSUA 3FRIA 1NWHA 4KQCA 3MHPA 4Q82A 1KDVA 3W1WA 3L9WA 4UD6A 4WN9B 3PHHA 4IVPA 3FNHA 4IQGA 1T3ZA 3PIDA 3WLEA 5ESDA 4W9RA 1NRIA 1AQLA 2KSQA 2CMDA 3BORA 1FLAA 2W2QA 3C98A 3GO4A 4M1MA 1CB0A 1SWWA 3EJWA 2W6OA 5I8PA 1Z6AA 4CF6A 1XZBA 2OGSA 5MHTA 1OMOA 2H8GA 2ZAGA 2JI7A 2BELA 4N01A 4X7RA 5JMWA 4P4SA 4RJLA 3IOCA 3NHMA 3O94A 1PLLA 4EHHA 3AKEA 1Q0ZA 2X4GA 2QJTA 4LXQA 3ZXSA 1CR4A 3UPTA 1ZOIA 4G3XA 2NYVA 4QFBA 3T5CA 5I7RA 4IOKA 5EG5A 1WTAA 1FXWF 2G06A 3EWIA 5B3LA 5EJ4A 1JIKA 3CRRA 3LSTA 2B21A 3QI7A 4Q4AA 5AWFC 3WLMA 1HG1A 5AW7A 1RQPA 1W9MA 1JV2B 2W37A 4WBXC 1ZZEA 1L7DA 1FS5A 2HQSA 1CULC 2CUNA 3W9YA 3G8DA 2G9QA 4L15A 1AD2A 1VIDA 2P0EA 5JBNA 2IQIA 1BN7A 4YAWA 3BDVA 1CUIA 4YASA 1F0NA 2OCLA 3OPQA 1GGFA 3TOXA 3ZWXA 4DV2B 2XNDD 1S3IA 1H9BA 3D8TA 2IXGA 3ZGLA 3ZDQA 1EP3B 2OGTA 3EIFA 4XCXA 5IAAA 1ULAA 2HU8A 3O3CA 4DDWA 4CV3A 3U49A 1U28C 2XF8A 3DVAB 4IFIA 4MHSA 4MI3A 4PLGA 2P3LA 2CBGA 4OB6A 2XQVA 4TKZA 1MH9A 3SHWA 3IHKA 2ZCJA 5GOZA 3HABA 2PCLA 1WXIA 3R3SA 3W2TA 3DDCA 3WKAA 2VYND 5C51B 4JT2A 3SKVA 3PNSA 4K6GA 2HCJB 3BKWA 3UAVA 1COZA 1U0RA 3OFKA 4HVLA 2I99A 1RFLA 4W7HA 1X7GA 4DCCA 4MS4B 4YDRA 2XMSA 2O2ZA 4DSAA 2XKJE 2IS2A 2HWXA 1A9ZA 4ZAYA 5MN5A 3FSRA 4QJ5A 1VMEA 2Q41A 3GRAA 1A4IA 5FBWB 3LTNC 4YWHA 3WRVA 5KKAA 2GYWA 1WDWB 2YZGA 2OP1A 3K4QA 5DNEA 2PWYA 2R1ZA 2X8AA 3KV3O 3P4XA 1BG6A 2IOQA 3LVQE 3T4EA 1LK7A 4W82A 1NQAO 1W34A 2P79A 4EM6A 2CVPA 2QQ0A 2DPLA 1EEHA 2ONCA 2B7BA 1LRKA 1YL7A 2XIQA 1R6VA 4TSFA 5C4IA 3JZIA 5K0NA 1BXKA 2AL7A 1LLQA 1WHSA 3IBGA 1HFKA 5JTTA 2JLVA 2P9ZA 3OJOA 3I05A 3LVBA 1UUFA 2G77B 2W90A 2QR3A 3IB6A 4XVUA 3S81A 2VNHA 5D3ZA 5T5QA 2O0MA 4Z7OB 4DR1B 2O19A 1FP1D 4C7MA 4CKWA 1PVDA 1SOUA 2TMKA 3GLHB 3JAKB 1QH1B 1U0SY 3TIXB 3SYKA 1QGUB 5LUAA 2A9JA 2NVOA 1T25A 2XCOA 5JG7A 2VJPA 3VJMA 4X7PA 3ETEA 5B6IA 4ZAVA 1ZA1A 3DV0B 2XPCA 3L1JA 1GFWA 3AVOA 2VJDA 4P4SB 3RS2A 5CUQA 3E9CA 2ZATA 5JY1A 3WMEA 3AETA 1H8EA 4JBNA 5J47A 4BNFA 1VHLA 3ASZA 3U81A 5LP6F 4K2AA 4DR3B 4DQLA 1VHJA 2JIPA 2XCRB 5AJUA 1TK2A 2OORC 5EJGA 3B20A 3BCUA 4O3FA 2WYIA 2WYWA 3I52A 3WRXC 5F3WB 1LJ8A 3BS4A 2E87A 5FTKA 3UPUA 4IH9A 1JQAA 5K0TA 5ILOA 5TXGA 3TW6A 4K1LA 4TWBA 3AJEA 3Q98A 3GWZA 1DDOA 4J16C 1OX4A 2OC9A 4GE0A 4Y6GB 5FL3A 3RGGA 3FXAA 1AZSC 2Z30A 2J7PA 3Q12A 1KERA 2GFHA 3G5LA 5C1DA 1G3UA 3AQ4A 4LXTA 2OZKA 4M0MA 4QXRA 5LA6A 3NZEA 1O8BA 1NL3A 2O4CA 2XW6A 3CXUA 1C4WA 1QTIA 2WDZA 4ZREA 3U3XA 4KR3A 3A3NA 3R20A 3DOFA 1XZJA 1L3CA 1XEAA 2OSBA 3PTZA 1TVCA 1IXKA 5ALRA 2IU0A 4WDRA 1YR6A 3JQGB 1CRLA 3AK4A 1HL7A 2ZYAA 4UEOA 3HRKA 3V7YA 2P78A 3VISA 5AVJA 4FSHA 5L3RA 1MVLA 2AW5A 3C5EA 1GR1A 3NTUA 4TVBA 1P1FA 4BNGA 4EOGA 2FR8C 1R4ZA 5IABA 4RY8A 4QDJA 3ETHA 1CUYA 1L4FA 4KI7A 1RJDA 4CHTA 1B7GO 3VTKA 4GGPA 4ZAWA 6YASA 2UZ1B 4MKRA 4C7OB 3DJYA 1MF7A 3NS7A 3P32A 4DG5A 2VJMB 2ZSAA 4URHA 1LW7A 1K8QA 1G7CA 3FLMA 4PPGA 2WP0A 4WUVA 3JQBA 3RARA 4DJJA 3MC1A 1C9NA 1H2ZA 1U0HC 3M1YA 4KQKA 1BGXT 3L93A 5DOVA 1PJ8A 1QP0A 4NBLA 1T0BA 2MR6A 5L40A 5JQGB 221PA 1EB8A 2Z8YA 3SHOA 3SIXA 1OGJA 1ACMA 3ICCA 4HO1X 5I9TA 2B20A 1U2QA 2AA3A 3FBWA 4LBZA 1MO2A 5ALSA 1GCIA 4EY7A 1AQIA 2KHZA 4IGIA 4X0EA 1L5LA 4EECA 1INLA 2XUAA 1ABEA 3S8MA 1D1PA 3KR0A 4MUBA 3MSCA 3S5JA 4OXXA 4J0FA 2B5OA 5DGDA 4J1SA 3L7LA 1MTZA 1L7MA 1A7KA 4RVFA 1GNQA 5HP4A 2J4DA 4HSGA 1US8B 4HVCA 3GA5A 3J80A 3CRNA 4FK8A 4FMCB 2PG3A 2Y92A 3ND7A 3A06A 1TGVA 2BMDA 4YI5A 3AZOA 2X6TA 5KX5A 1J9GA 3E3LA 4KXVA 1ACJA 4DGQA 1YMVA 2J5QA 4TMFA 3T8YA 3KQYA 1THTA 5CNMA 4P4LA 5C4GB 3N1UA 5DT9A 1EMDA 2WWVD 1KIMA 2C4HA 3O4RA 1WD5A 3VUEA 3H1GA 2A9FA 3QFRA 4XLTA 1WLSA 4TL9A 3GGPA 3BH0A 3WJAA 1YR8A 3LZDA 3ZKWA 3C41J 5JZ9A 1WMFA 5KC8A 4IIJA 2P27A 1N1EA 3LRTA 1GGKA 3OE7A 4LNUB 2EL7A 2AJCA 2C59A 2HUNA 1UOQA 1RYDA 1NN3A 4JT4A 3M6IA 3RFXA 1B0UA 4C21A 5BOVA 1LBQA 3W0LB 3CJQA 3I53A 2EKBA 1MORA 2FHSA 5LP1A 3ISVA 1LGYA 1PS8A 2IHVA 3L92A 4OUDB 3KS9A 5C1BA 1VA4A 3W2HA 1KZ6A 4TV9A 1PR0A 1IN6A 1HDXA 5B2FA 1FQOA 2HBYA 2YDXA 1F1JA 3S8EA 1SXIA 4ZYVA 2P90A 3B5EA 3BMOB 4Y9UA 2YY5A 1ZHFA 1H23A 2FUCA 1OV4A 2R8RA 3EDCA 3F6CA 1S1CA 3JVIA 4XM1A 4U2KA 3OTWA 4MWOA 2BHSA 1U6KA 2YR0A 5F64A 5HZHA 1CCWA 3LYLA 1NLFA 3LT4A 3QLVC 1WV1A 2GFIA 3SI7A 3BGSA 4HMQA 4Y67A 1CQXA 1FTQA 2VBIA 3PQ5A 4G07A 4NFYA 4O4IA 4PIVA 2Y0DA 3RH0A 1BGWA 5BV0A 2BGWA 1W4RA 3KJEA 3JQQA 4QGAA 4CUKA 3CLRC 1GIAA 2QX9A 2Q7OE 5DXAA 3JAWB 4URYR 5IAOA 2WTUA 2WABA 1NKVA 1OBOA 2XF2A 3EBOA 2HWUA 3LPNA 3T7CA 4G0UA 2VG8A 1D7AA 3F1KA 1C9DB 4LX0A 4XGQA 2F3QA 4MINA 1DJMA 3GH3A 3ESDA 1UZLA 1R5NA 2Q6VA 5JD5A 3FX2A 3HKDA 2GPSA 3CURA 1GYPA 2X4LA 3DAOA 4MDEA 4PO1A 4UUQA 4G5QA 2ZUWA 4MQ6A 1Y7HA 1Y9AA 3U09A 4AKEA 4JKOA 4DCVA 4EB3A 4NYIQ 1TAQA 1U4NA 2WU4A 2O06A 3QY9A 1CHNA 1SHZA 3ZWDA 3H8VA 3RKRA 2CLLB 4N4AA 3T5GA 1ZYUA 1KSGA 2NUTB 3MCUA 4RQUA 5CW1A 4B09A 3QEAZ 4EUFA 1G4UR 1TM5E 3BB3A 2QL9A 5AOVA 4JYMA 2EYUA 4N0MA 3S40A 1QCCA 2CUTA 4PTLA 3EJ6A 3NW9A 2W4MA 3QEOA 1EVIA 2FPSA 1XTSA 2QD1A 4KFUA 3OP1A 3PNMA 4QUBA 2KX7A 4CQLB 5BV8A 3D8UA 4RK6A 3ROGA 4HQFA 4DLSA 1UJ4A 1X38A 2B8JA 4IG4A 2UUBB 3VA7A 1DXHA 1QKJA 4QGBA 4R6WA 4ZVMA 3ZY6A 3O9MA 1QOPB 4P38A 2I9PA 3AW8A 4GPTA 2PS3A 3WI7A 2HK8A 3QWHA 3RJTA 2ZIVB 1D1SA 5E8JA 1I2CA 2BFBB 4IIEA 3LLVA 3L9XA 4N39A 4IDEA 1BJTA 2AFIB 3S4YA 3UC9A 4OIMA 3U3RA 4MV6A 1GN8A 2IYSA 5DNVA 4N3GA 4RA6A 5AW8A 4MHOA 2RJ3A 2X7HA 1KEZA 3LGAA 2DTEA 3U17A 2C82A 1ABBA 2C31A 3TOCA 4M60A 4NAHA 3ZEIA 1BOOA 1MNQA 1P4SA 4RKQA 3X1WA 4BO4A 2QUKA 4I1UA 4FQ7A 3INTA 3A6GA 4IOLA 4M87A 5JHHB 2VJAA 3G3EA 1NTRA 5BSUA 1P4HA 5JQWA 3HXMA 3ZVNA 2QRNA 5HE9A 3L8GA 3KQUA 4ZJPA 4W9NA 1RRFA 4HPXB 3RFFA 3V8MA 4ZDWA 2WIGA 2O8VA 3OPNA 1MMFB 3PLRA 1FNDA 1D09A 1FUYB 1ODIA 2XV1A 3P97A 2VP6A 3DW1X 1NQWA 4FOLA 4HYEA 5JDCC 1UPCA 3QU2A 1RBZA 1QVAA 1CJMA 1AS0A 1QOZA 2GUGA 3SM9A 5ICMA 1UXIA 3HSYA 1EUQA 4EWLA 3FNFA 4YRCA 5IUKC 1FSPA 3X1ZA 1JIQA 2WZDA 4DMRA 3WHIA 4HI0E 2REOA 4L0QA 3H65A 5L9AA 4KREA 4QOIA 3SX0A 1XA0A 3HWWA 1V1JA 3QK7A 2C5GA 2VNKA 4XDZA 1USVA 2BFEB 3AI7A 3VSCA 3K32A 4FB4A 3VNVA 3K9FC 2C0PA 2ZBPA 3G8YA 3IUPA 2JKYA 5FOWA 4AD8A 3CG0A 3MXOA 4KO4S 3O4JA 4K88A 4DW8A 1GYRA 5AM5A 5IBQA 4QRDA 1N2SA 3ZDZB 5C8DA 2VATA 5KIAA 1UAGA 2BTQB 4OYHA 2AIRA 1Y5LA 3T3PB 4CDRA 2HWKA 5B1DA 5K45A 3B7WA 3CT6A 1D4AA 1TAHA 1CRQA 1U8AA 3GCXA 3RREA 1KXJA 3BXEA 1NPYA 3A9RA 1F3OA 3T4PA 3IEXA 3NJRA 2J9ZB 4OXYA 4Q1FA 1ODTC 3UXYA 5IRCD 4NAVA 4AQYB 2NZWA 9MHTA 1U81A 3EXFA 1V16A 3FJ1A 4ND1A 1U8UA 1VC2A 4PG7A 1TD9A 3WNDA 3WWDA 3B3FA 3X1YA 2PUDA 2XUHA 2HOQA 4PW0A 1UQRA 2QSUA 1XCMA 3UZUA 5CB6A 3QA3E 4PSUA 2XOEA 1EK1A 3WL4A 1EM8A 1B8OA 2NAPA 1UKYA 5ADHA 3DC2A 3ZQ4A 2C5LA 2D13A 2J3KA 3THYA 1LNZA 1XRJA 4RQTA 1P9LA 3ZIDA 1D2AA 4DMLA 2EU8A 1K3TA 1U2GA 5DNUA 3ENNA 4TMWA 1GILA 3N8GA 4ZT4A 1C7QA 1EU1A 3HP4A 2W6NA 3QIVA 5KI6A 3PF9A 2X23A 1F2TA 2BEWA 2O8CA 2OXTA 1DTSA 2D2IA 1F14A 3Q85A 3MS2A 1TQ8A 2QTTA 5ENDA 3HYTA 4BFUA 3DT6A 4WZBA 1GL6A 3VZRA 4YPFA 4BMDA 5ALTA 3THOA 3QELA 2G9VA 2HMAA 5TSDA 3T5MA 4DIMA 3U1BA 1Z39A 3QNMA 1FIUA 1RACA 2RAVA 4LC9A 3DNMA 2N0SA 4LGVA 1WNTA 5BVHA 3HJBA 2NLOA 4QO7A 4WN3A 5KQMA 3UQYS 2HJWA 5DGTA 5HRCA 1CWUA 2HB6A 1Q0RA 3KQLA 1QM5A 3CWQA 4BJ3A 4RPKA 4YCBA 5DM60 4FR5A 2P3SA 2F8MA 2DJIA 4LVOA 1HNXB 4CG3A 1YRQA 4FE3A 1P2GA 1ZQ9A 4J0DA 4HLUA 1XTZA 1EKXA 2PBLA 1O9HA 1QQAA 1RM4A 1WSBA 4M1SA 1QYWA 1M2GA 1I0ZA 5EMJA 1QU3A 2G72A 1QHHB 4TXHA 2QTBA 4YHBA 3TL6A 1CUAA 1JFFA 1VPEA 2DBQA 4ZYZA 1BXGB 3R77A 1G17A 3D6UA 1W4AA 3V2UA 1RC8A 2XDQB 3GU3A 4ZU1X 2ZVJA 4HQ0A 2GS9A 2YICA 1T0UA 1E6EA 1XHLA 4Z5XA 2PX5A 4TWRA 1P4GA 3VYTB 1YZUA 1UXGA 2RB4A 4PQGA 4D8TA 1RFGE 4RPHA 1XTKA 3EVEA 2O2XA 1FU7A 4CODB 2BFPA 1DUVG 1O96B 1OLSB 4O4HA 2B82A 2AI2A 3I9KA 2QTHA 3RYFA 1MP0A 2PGOA 4I55A 3SJCA 3SE7A 1P72A 1FNSA 1GTJ1 1AURA 1BYIA 1L7PA 2NTNA 4FBMA 1BVHA 2GD1O 3RHSA 3ZE2B 2VPIA 3EVAA 1XTTA 3CLUD 3CH4B 5CNIA 5DLDA 2EX0A 2B1IA 1RDFA 2Q45A 2QRQA 2ZRDA 2IBTA 1M0WA 1EFAA 3T35A 3LQ2A 4YIHA 2FR0A 2OBFA 4GMFA 4PC2A 4ZP1A 3UXEA 2ZBUA 3OZGA 4F97A 4LYDA 5BSHA 1V16B 1XMPA 3QHPA 2LGJA 2YDYA 3PJEA 1CEQA 3V4LA 1IBKB 3ZD6A 2GBLC 3MD9A 4YMUA 4DHWA 3D8SA 4ZI5A 1L5MA 1YUNA 2BJHA 4EZIA 1PL7A 3ZWWA 3I6ZA 4H60A 4MUHA 5F73A 1KYIA 5EKXA 4EG0A 1JEAA 2JH3A 3S2UA 3LKVA 4ZXFA 4Q19A 1ZNXA 4QYWA 3ZBPA 1FMLA 1PL6A 1E9FA 3OECA 4XFJA 2FWJA 1P3JA 2B83A 4XJXA 4C06A 4N5IX 4J2HA 4BLVA 2YWFA 5D3MA 2PSSA 1NBHA 1X7WB 4R83A 3SSMA 5F52A 2IH4A 3AUXA 5CG1A 2Z1MA 3NYIA 4QGSA 1XZLA 3MUFA 5HCIA 3IBSA 4CG2A 4BY9E 4Y18A 3CUTA 2ZYDA 3NXKA 1I6KA 4G1FA 3IDFA 2C95A 3R9WA 3GZTB 1NI3A 2I29A 3FKJA 3FVQA 3O95A 2GEDA 4I9NA 4XQCA 2P1RA 3IBYA 2JBAA 4KFTA 4BO5A 1A9YA 4QARA 1AKEA 1AOXA 1C1DA 1RJGA 2FN9A 2O1SA 3BTSA 1EJ6A 3JQRA 3ZI0A 4Z7JA 2PH3A 3DF7A 4PZYA 4GZ6A 2OAP1 1O6ZA 2AKYA 5G40A 2PKCA 3KT0A 4KE9A 3PD0A 2ZRIA 4ZV7A 2VSOA 5LXTF 2YXBA 3R7LA 1GU1A 3K8YA 5E1BA 3OCUA 1W5TA 3PQDA 3WL7A 2V7QA 2D2XA 4CT5A 5C81A 3PYXA 4KPGA 3VR2A 1LTQA 2JAQA 3ASVA 4UTOA 4BPRA 5AW0A 2FB9A 3ESYA 3N07A 1T1JA 1T9BA 2F55A 1MOSA 4QVIA 4GU5A 4IUDS 3PVCA 1II8B 1NNI1 2GGSA 4E0BA 2ONZA 1OFVA 1TUIA 3DVRX 1OJLA 4OUKX 4X20B 4C14A 4ZT6A 4W1QA 3UG7A 1FYFA 1NF8A 1SC9A 3OX2A 1JDVA 3PQ8A 2ZJ2A 4NBVA 3CX7A 2Q5HA 1TJPB 3CH5A 3G59A 1QVVA 4UOEA 1CZRA 2FSPA 2XIJA 1PS0A 5IKOA 1CJBA 3EIEA 1AGPA 5BWMA 5K20A 2AOVA 1MRNA 2ODNA 4LBVA 4BQPA 4AULA 5AK6A 1V48A 2YUTA 1G291 1NVWQ 1UDWA 1UDXA 4I6EA 1AZLA 1PZHA 1W6UA 3L7OA 3MJDA 3QEMB 3ANXA 5CVDA 5JBIA 5JU6A 3TR0A 5EVCA 1C1HA 4MUFA 3TTTA 1VKJA 2AFHA 1WDKA 3GX1A 2JH9A 3ILVA 2BR3A 3M0EA 4K3UA 2GCEA 3DV2A 3DL0A 2EBUA 1NVGA 1U02A 4REOA 4DA0A 3K6SA 3BGWA 1IM8A 1PJQA 2HO4A 3QV2A 4HEQA 1WDTA 1HLGA 1BFDA 1NMXA 2JB9A 2YX1A 3B1FA 1RJFA 1C14A 1SUAA 1UBFA 2I80A 4K9RA 2Q6IA 3B8HA 4M0FA 4YTEA 3VJKA 1YK0A 5E7JA 2Q2NA 3DE6X 3LL4A 3OJXA 4JQSA 4MJXA 1XEXB 5CITA 2FPRA 3K0HA 1DUSA 5AOAA 4NQZA 3KP1A 4LF5B 1HYEA 3WP0A 3ZNOA 3TQIA 2VYQA 1GLVA 5JVDA 4JC8A 1M7BA 2P2GA 2I3AA 4Y2VA 2NADA 2QORA 1DOHA 3BULA 4GOND 3H2BA 5I4BA 5I45A 1ZW6A 4F3CA 4Z3OA 1XNQB 3PNQA 3Q3GE 4Q02A 1S6YA 2B4YA 5CXQA 1CUFA 2HFKA 3RRJA 4O4JF 2FQYA 3CO5A 2XVAA 1RHJA 2F62A 4DZZA 4RULA 1DJQA 1DUIA 1VMKA 2ZAYA 1Y8RA 3A7DA 4BCDA 5JYDA 1FU8A 1NP3A 2O2DA 3LWDA 3MWLA 1E6MA 1VHWA 4IF6A 5CJ2A 4WBNB 5KYGA 1XX6A 1X70A 2HA2A 4KZKA 2VEDA 3R8XA 1GUDA 4G4JA 4M46A 1I4EB 3VAZA 5JS8A 2Z58A 4J0QA 3K30A 4EQ6B 2XX3A 1PEAA 1O97D 1D5WA 2ZRMA 1VG9B 2HLDD 3QXJA 4WWHA 1HDZA 1MHPA 1MAHA 1DRKA 2PKRA 3KKLA 5ALYA 3PRYA 5A04A 3AVUA 3EWSA 1QVZA 1SPXA 3IUNA 3RTDA 2J09A 1XNJA 5EPEA 3BAZA 4AP5A 3L4KA 4GOOD 4C7VA 3H1BA 3AOGA 3NGLA 4GP6A 2YZ7A 3F49S 4DXHA 1Z74A 3LG2A 2O1XA 3RASA 4IV8A 4DT1A 3KVRA 1NWCA 1U2PA 4D43A 5JTUA 1W4BA 4HNGA 3FYHA 3U3JA 2FMIA 3CZ9A 2WF8A 4PWZA 2BI4A 1I80A 3C7CB 3GAMA 3OQJA 3ZHZA 1T9GS 5DGCA 4NZYA 4I08A 2OA0A 2WJGA 3LX8A 3VHRA 4EFNA 4BCCA 5JZSA 4BQOA 4FYIA 4HB0A 1D3AA 1G20B 3Q3VA 3L41A 3ZZNA 4GYJA 4BU0A 3AONB 1HNNA 1A9RA 1KJWA 4X1YB 1OWLA 2Q3JA 5KTSA 2O6HA 2J07A 2WSSA 2XI4A 5C1PA 3TQTA 2I2WA 1NAHA 4AKGA 3OX4A 3DBRA 5LZ2A 3NETA 3CCCA 4GWGA 3AL2A 3HN7A 3DEFA 1NASA 3HB4X 3NO4A 4TZ6A 3AIMA 3COYA 5EVJA 3A1FA 3RTBA 4DDVA 4U7DA 1PK8A 2BCGY 4C4SA 1U2GC 1IWOA 2NXCA 2PY6A 4ARAA 1Y1TA 4CCSA 3VR4H 1NVBA 4D0GA 4EP1A 3QOYA 5E6RA 1M75A 2PS1A 1SEVA 2QVZX 1PYOA 2RB5A 2BI8A 4G0NA 5AT1A 1MQ9A 1ZL2A 3KT3A 4HNAA 4R5MA 1IB6A 3ZZUA 4ZVQA 4J76A 4RS4A 1R9MA 4Q7KA 1M2EA 2FPLA 4IH4A 4BFTA 2NXNA 1EUDA 1DZIA 2R00C 1ZM9A 2FWMX 1Z36A 3DWGA 3ESRA 3IJEB 3ITEA 4TV8F 2QR2A 3U6BA 2A1UB 4EG5A 3IALA 3UVEA 1QDUA 2O6LA 4WNIA 5DBIA 4F5DA 1U5AA 3RTEA 4G5RA 1GZUA 4COOA 1DQZA 2BM9A 4E12A 4OCZA 2Z0MA 4IIJF 4Q3BA 3BICA 4QSHA 1W8IA 1L1EA 1DBPA 4ZAGA 1AKVA 2HPVA 2LZ0A 1WW8A 2HHLA 4WIAA 3UFBA 3F2IA 4E4TA 3L7IA 3OCCA 4FGWA 1DIHA 1L5HA 4Y2QA 4XUGB 3ZNNA 2WJWA 5HKKD 4X97A 2GCIA 1BWRA 4PYLA 1NR7A 2UUOA 2FAXA 1MJ5A 3HCWA 4OQDA 1K8YB 2ZQYA 4QU0A 3AVWA 4CLRA 4PWYA 3JQCA 4NYMR 2YJGA 1QAOA 1AMUA 3OBIA 3HCNA 1KSJA 5K99A 5F9MA 1EBBA 1YQEA 3FFXA 4PNHA 4XR4A 3KB2A 1IL0A 1KP9A 4Q9HA 3RHZA 2IPMA 4B6SA 6AT1A 4EG8A 1IEWA 1C3VA 2O23A 1XLTC 2FPIA 2RE8A 3THXA 4R1PA 5DIFA 4D81A 4NE7A 3HN6A 2WJPA 2ZE7A 1RU3A 1FMJA 2FCAA 2B37A 1S02A 4B46A 3PDIB 1DELA 2W00A 3EMBA 3LU1A 4PEVA 4RVOA 4GL2A 2O0KA 4POOA 2BDEA 3AHJA 5E7IA 1Y80A 3BK7A 2BE9A 2HBRA 2J0EA 3UKJA 3HKCB 1WOYA 4O5AA 4BO0A 2ERCA 4Q34A 4CQJA 4K1XA 8ADHA 3GFVA 3KBOA 4B6RA 3GYBA 1M74A 3KEFA 1CG6A 2WWTA 4Q47A 4PIPA 1IUKA 2WMYA 3K9WA 3USCS 3ZHCA 5K3FA 4CUJA 3S1AB 4J4TA 1IBLB 4XOIA 1PFGA 3GVCA 2W2NA 3BTUA 4W6QA 1Z4PX 1YJQA 3QUQA 4K5QA 5NLLA 3WICA 4G0VA 1E89A 4IRXA 4TTRA 1JHPA 1WSAA 2B1RA 3I42A 4KXWA 1G6HA 2IU4A 1G9SA 4MVXA 3TRDA 3VHXB 3DYIA 1I36A 3HB5X 4L02A 3EZYA 5ER9A 2QBYB 4IAOA 4PSAA 1HEIA 1IDN1 5EGNA 2WQ6A 2XB6A 4GE3A 1PUXA 1J2RA 2NWQA 3AY3A 3I5UA 1PFVA 3ILYA 3EIQA 1U3WA 3DXYA 1E5LA 1CVIA 1EA5A 1EWYA 2P0YA 2OG1A 3OJEA 4AN0A 4F92B 1FY2A 2IBSA 4ZVNA 3JU3A 1AS3A 4PYMA 1X7XA 4H31A 4KBGA 4YCJA 4NPCA 4ZZIA 1K63A 3HA7A 4PZZA 2IXDA 3DMGA 3GROA 4TUYA 1YCGA 5FOSA 1DS6A 2LDXA 3LF2A 2ZJ4A 2RI1A 3R6WA 4KJXA 5EZYB 4DA8A 1WZ2A 4JIMA 2GD2A 1MLDA 4OI0A 4MCAA 2QF7A 4O2AF 1JXOA 3E18A 1EAYA 1GQSA 4HX2A 2BI7A 1PT5A 2EXXA 4EYEA 5TJHA 5BYKA 3BGOS 1P17A 2FOLA 3I0NA 1LPMA 2CJFA 2XOKD 3H4TA 1NNSA 4ZVKA 4JXXA 3CS3A 2ACWA 4TQUS 3KKKA 1WXWA 3TAXA 4HTFB 4CMAA 2YN2A 1JDBC 5FPPA 2BFDB 4N8DA 2FPWA 2EATA 1T15A 4ICIA 4IFEA 5A7GA 2J8ZA 3JZDA 2PZFA 2DCMA 3ONFA 4HPWA 4ARUA 2XTNA 3SMQA 1PW5A 4JX8A 4OSEA 2YVKA 3T52A 3DL4A 1FDRA 1KEWA 1VRWA 1ESNA 3C2QA 3WYGA 5LLTA 3IT1A 4EHKA 4FOPA 2NUAA 3IPCA 2VP3A 4XIJA 4I4TA 3OF5A 3EVFA 1DKOA 4HGZA 2P67A 2I03A 2ZE5A 4TLEA 4CM1A 2JLUA 3A4MA 3NDPA 1T29A 1LLUA 5I9NA 2IE0A 2ASVA 1HTTA 3MMSA 4UDNA 4XSGA 4WLEA 5F1KA 1M2JA 3WMFA 4MW6A 1E2KA 1T5IA 2IYVA 3WRYA 5DX0A 2VDPB 2Q5FA 1ZGBA 5CD1A 5GMOA 1C29B 4EQ6A 2FPIB 1DBRA 4I8DA 1U0BB 3I9OA 2VTBA 5COQA 3OJLA 1XBTA 1JB1A 3LX5A 3OHPA 3QPWA 1ENZA 1UC4B 2ZB2A 3UUFA 4LRQA 3KHSA 4LOJA 1L1RA 2O20A 3IILA 2PT6A 2H7CA 3OTIA 1UKAA 2CLOB 2JC3A 2MHCA 1JMKC 4H4DA 4K9MA 4LYEA 1S4MA 3SY8A 5G1OA 5CXSA 2R6GA 3MWYW 1B8NA 4D9GA 2DULA 3FKQA 3PLNA 2QN2A 2EZ8A 2YS7A 1G5TA 3BUSA 1JFVA 5JMTA 1WB9A 4N41A 4UCQA 2XT0A 1ADBA 4FUQA 1RM3A 1QDLB 5ICFA 3FAKA 2WEKA 3S29A 2NUPB 5I7SA 2OM6A 2P2ZA 1U0OC 4R1LA 3RVOA 2FSVA 2CLHB 2JFBA 5K2OA 3HJUA 4KBYA 2IU6A 2B35A 2I55A 5JSQA 2J5RA 4E5PA 5JISA 2PIDA 2JI6A 2J08A 4EH1A 2MSCB 1RQ2A 4ZAFA 1T3LA 3AC0A 4EB6A 4JOQA 1EK5A 4WW0A 1W5AA 1W52X 2BKXA 3G85A 4RDXA 1YFJA 3EEQA 4W8HA 3D81A 2DFVA 4MVJF 1U65A 3KO8A 3KOWA 3RRNA 3RUFA 3H5LA 3JARB 2GASA 4PG5A 3GLFE 5AXCA 2VRCA 1HX7A 2C2ZA 1NPDA 3MJ4A 1FUUA 1QG2A 2NU6B 3AUYA 5EXPA 4ZHQF 2HW8A 4QLAA 5E6RB 2Q0XA 2X2PA 2AMFA 5AW3A 1FDOA 1IE3A 2DMRA 3EWNA 4GUAA 1XKXA 4LFCB 5ALMA 3LX4A 1HKHA 5CA0F 1CIPA 1KMMA 3OU6A 4TKVA 2M6RA 1L7NA 4GOJA 3HKEA 2NV6A 2OHGA 3BIWA 1JQDA 3UMCA 5L7WA 4CLHA 2GBCA 4DJDC 5I7UA 1Y3HA 4E2WA 3E7XA 5J2TF 1ST2A 1UK9A 2RH5A 3G9ZA 5LYYA 2D1SA 4MR9B 4R9UC 2UKDA 5HR5A 4JR1A 2QB5A 4PRZA 1JAYA 1S2DA 2JJYA 2PVPA 2WUDA 3FYTA 3CUUA 3KLMX 3DV0A 2VYFA 3N5CA 1NN5A 4M2LA 4NS4A 1JXAA 1G38A 4LGYA 2YVAA 4KRYA 3ZLBA 2RG1A 1OI3A 2BCEA 2IYXA 5DNDA 1HM5A 1TEZA 2IUUA 3ZWOA 1TTPB 2XYVA 1N2JA 2ETXA 4PLYA 1ECGA 3EIHA 3KKZA 4ZU6X 1VFPA 2FR8A 3TB6A 4Z9BA 3O1IC 1D6MA 1IC6A 3PJDA 2O8FA 4NX2A 2FMHA 4Y6LA 3O91A 3KR2A 4JR2A 3ED5A 1TYDE 2XT6A 3EVCA 3GNQA 3RBXA 3SBOA 3W5UA 4L8GA 4A2QA 1QAMA 3N7TA 2J3JA 2FW6A 1VL8A 1C3EA 2CVFA 2EGHA 4K28A 2AF4C 1EIZA 3JSAA 3K2IA 1E9BA 5IU6A 5CDTA 1KYZA 4F84A 5KKCA 5CLLA 3UBTA 4OHBA 1KVQA 5IVIA 3UT5A 1ELOA 3SDSA 2P4SA 1I5EA 2YJTD 1W581 2CLKB 1KBQA 1UFKA 4L0MA 2P30A 4LHEA 2ABWA 4HGPA 4WCVA 1RP1A 1V8ZA 3FB4A 4I8XA 5BUQA 1II9A 1I51A 3RVNA 3STHA 1Z4OA 2A9PA 5D85A 4D9BA 1KZ7B 2J5KA 2ZE8A 1HC7A 1U9IA 4FCTA 4WFIA 4J2TA 1UJ6A 2ATXA 5LQCA 3W9SA 2HT1A 1U2DA 3IE0A 4LDRA 1UKCA 4XKJA 3SF0A 4YJGB 3C6ZA 2Q6OA 4A2CA 4ZQIA 5I7HA 4LJRA 2JZOA 1CQZA 3TTVA 3WZ2A 2IYUA 5BMVF 2YJ4A 1AKTA 2L19A 4FR2A 4H1VA 4I99A 2HV8A 3ZBUA 2IC5A 4Q05A 5BN4A 2ORYA 1QDEA 3THWB 3DFZA 5BURA 2IHYA 2OO7A 3OPYA 3VSAA 4B2IA 3CKMA 3PXAA 2PX6A 4MO2A 3L84A 3BFKA 1B4DA 1O08A 2BC9A 2FQ1A 3FJOA 4IJ5A 2V7WA 5AKGA 4ZARA 4EGSA 2DKFA 2X1VA 2BLLA 1ISFA 1KNQA 2FZEA 5AI6A 3E2IA 3NUZA 5JD6A 3HZOA 5KOJB 1RZRD 1CEXA 4M0EA 3UICA 3LWNA 3TKYA 4DC1A 5AUPB 1M3SA 5D51S 4FFWA 3ZJVA 3Q40A 2O59A 2JI4A 2P2LA 4KPUB 4L8LA 4UUBA 1AMOA 1QB7A 5A4MS 1S89A 1OVGA 3A6PC 1DX4A 5BQ5A 1F06A 2VKQA 3WIUA 2FWRA 3MS7A 2N46A 4HV4A 2FYTA 4JBYA 2MYNA 2VPZA 3KQSA 5CVEA 1NIJA 1PDWA 3DBVO 4LWQA 5DM4A 4BLTA 5G4LA 4HAOA 4PLZA 3MZ0A 2C2WA 4L76A 1YZKA 3DLAA 3HVIA 4MEAA 5AHRA 5FEMA 3VSDA 4QGHA 5JLJA 3TIVA 5CG2A 3LUKA 3ZV3A 2YQ4A 4IDQA 4MMZB 5C3MA 4JLPA 4KHZA 2Q9BA 2ZYWX 2RHDA 4MKHA 5FKJA 3ROEA 5BWNA 2CXTA 3QMVA 1VPTA 3B8EA 5I9LA 3H9CA 4HXGA 1Q57A 4DMUB 2LNDA 5AW5A 2G1JA 2QTVB 2Q1UA 1QS0B 2IV2X 1UT6A 4H7KA 2YJZA 2POQX 3MW8A 3B3QA 3W79A 4KLCA 1L5GB 3HB7A 1BHO1 2EBFX 3DAGA 1XZAA 2C8VA 1GTG1 4PHFA 1K8XB 2PBFA 1GLNA 4ND7A 2AZ4A 3ZIUA 4WKOA 3LF1A 3DPSA 2Y1DA 3IR5A 3PC7A 1JA0A 1SVMA 2O3RA 4R4JA 1DEAA 4UHBA 1PUIA 1ISGA 1QJCA 1YB1A 1EWTA 1V71A 2XA2A 4LHWA 2BMAA 3I5MA 3TSOA 4HP8A 1V11B 5IKEA 4EGJA 7AT1A 4ZVVA 2E1RA 2E4YA 2FSSA 3ELYA 3HK2A 4LEIA 1P5FA 1ECFA 2C3UA 1MB9A 4NL4H 2O2HA 3ZWMA 3I12A 4BS9A 4DDTA 2Q21A 1G8HA 4H3SA 2WDPA 3DMPA 3FNGA 3H2YA 1CV2A 1ESZA 1ZD5A 2XCQA 2YOGA 5E3JA 1QNLA 1T6BY 4G4GA 2ZM5A 4EY8A 1U8YA 4HQOA 4JZKA 5AYVA 1XAHA 3CMCO 5BV1A 4LRWA 1SH7A 2ZU0C 4RQBA 2AFVA 4V3BA 1WX1A 3CZCA 2WUWE 1RYYA 3GD5A 3DNFA 2BBSA 1N3BA 3CCFA 3H1EA 2IZ6A 1UZAA 3HBMA 2B94A 3P7MA 5JNSA 5J23A 3LC0A 2CXPA 2OD7A 3D2AA 1RWWA 3T38A 2W2MA 2P2YA 3ZU5A 5FRDA 4RGVA 3PGMA 3WLFA 1GVHA 3P27A 5FR1A 2AFHE 2W2OA 1I33A 4X1OA 1T9AA 5IJ0A 3JR3A 3H1PA 1KGDA 2SECE 3P0EA 3VR5D 5KKNB 4D3FA 2JIDA 3HCFA 3H2KA 3DBRB 2EV9A 4RBNA 4OI4A 2ZI4A 1XCPA 3IEUA 1YRLA 2RHHA 4KIUA 3VAYA 1W46A 2M6LA 5TMBA 2HYIC 1E99A 4FHZA 5CTJA 4BZPA 1G9TA 3ZE0B 3BRQA 4P4UA 5ADUS 4FYWA 5KQPA 2F3PA 4D82A 1GU7A 2JHAA 2GJKA 4KI0A 4OU5A 4N7MA 4U6SA 2QU8A 3TFOA 2WNHA 1CY1A 3DOCA 4LG1A 4TLDA 4AMZA 2HAEA 4XJTA 2JI9A 5DYIA 3K5PA 4XEUA 1G1MA 1U2RA 2WF7A 1ZD4A 1TCVA 1SUWA 2MIIA 4XR9A 4PBTA 4ATNA 5LQNA 2CNWD 3FDFA 2IUSA 1PHRA 2OSVA 2INGX 5LXTA 1G3MA 1LTKA 1ZQ1A 2CXOA 2IXEA 1ZUD1 2LP4Y 3HEAA 4FN5A 4KWEA 4M1KA 2VT2A 1GKIA 4RX1A 4A8JC 1APBA 3H3FA 3FJYA 2P9FA 1X8JA 4I9FA 2PXXA 1BCRB 4UVHA 3ACDA 4QDKA 2DWQA 2ANCA 2R65A 4UUPA 5JO0A 2CJPA 4ZO4A 1EZ4A 2H4HA 5L51A 2GEKA 1Z0JA 2QENA 3EOZA 5DTRA 1LRJA 1OI7A 3RT9A 3DS8A 3C3KA 3F7OA 3QX9A 4TMZA 4HLNA 4MYRA 1LI4A 2GB4A 4DA9A 2OLEA 5ALZA 3TLKA 1RHQA 4M7RA 4JB3A 5A0TA 2G3YA 4J0EA 2HPAA 1OXKB 3ZXUB 3HZRA 4GQAA 1N9KA 2YY6A 2EQBA 3CEMA 4LRUA 2OXEA 3KZMA 3TW8A 4YR9A 3WWEA 5A2QA 2O1WA 1HSOA 3AFHA 4K8RB 3PL5A 2ZSJA 1V9LA 2QEQA 3K5WA 3MMPA 4B4UA 1JJAA 1YFZA 2OT3B 5DHFA 1L7RA 2YFQA 3EDYA 1CQJA 4GX0A 2PJRA 3AKCA 1WD7A 2DU8A 3IQIX 3CF2A 4RJIA 4Z4IA 1PDOA 3HU3A 1HLPA 3PWKA 4RJTA 7GPBA 4CHGA 2HMWA 3GLHA 4ZEWA 4X6UA 1KFCB 2QR5A 4UBMA 2B36A 1IM2A 2H5EA 2MSEB 4Q4DA 4TL7A 3RUEA 3QVKA 1T3SA 3TRFA 1JXMA 1DINA 2I1QA 1N2CB 1ONBA 2GPNA 2Z9CA 3LZ6A 4OOFA 2DLNA 3M4XA 3OE1A 3UJHA 2D5BA 1BKDR 1NE7A 3DA8A 2ZLBA 1HE4A 2C00A 1K68A 3T15A 4XQ9A 3ZDRA 1FLVA 3DQQA 5AVOA 3GRFA 4NXMB 3TIGA 3FN4A 4IIXA 1GGNA 3PTAA 2WINI 1O95C 4PPNA 5FBLB 1U0LA 4Q0MA 3MCVA 4Y8VA 4MULA 5T41A 1G2OA 3FNRA 4IDDA 4AYTA 3EOBI 1E1KA 2NXEA 3KDAA 3N2IA 4XXHA 1GRNA 3HRHA 1OGIA 4KN6A 2IW3A 3LXRA 2GSWA 3DBLB 5EL0A 1SKUA 3A4NA 2BFCB 5FIUA 3V33A 4NCJA 3WDSA 3IE1A 1UDRA 1OWOA 2P9QA 3ODPA 4IOMA 5C7YA 4W5OA 3RUAA 1JT9A 4TQ9A 3ZIAD 1JI3A 4F11A 1W2WB 2IYOA 2GBFA 2NQ8A 2X4DA 5AK5A 2F1OA 4UFNA 4G67A 2ZTMA 2UXCB 2ATCA 4BMYA 3FMGA 1QG6A 4DREA 2RDMA 4HD8A 3UV7A 3L82B 3PP8A 3AESB 4NECA 1CKEA 2VJQA 1TEHA 1PGNA 2AR9A 2O3UA 3IKJA 5AUOB 3BJRA 3BHJA 4BZWA 2PZ8A 4KE6A 1QF7A 4OXNA 2J30A 4C2UA 4PR3A 3N8HA 5IC4A 3D0QA 3ANTA 3C6QA 3GIDA 4TWAA 1CUXA 1LFDB 2Q3CA 4RY9A 1HYHA 1Y6JA 4UVGA 2ZRQA 4MS1A 4J3NA 5KU1A 1R7RA 2OFFA 4N0EA 2LPMA 2I6QA 2Z08A 1T36A 3NBXX 2QMOA 1SU7A 5BRJA 1HGXA 2ODAA 3NVMB 4YVFA 1RHMA 4FDUA 3UV6A 3K20A 4S04A 3I3SR 3FCOA 1Z8NA 3QPBA 1E2PA 2NG1A 2XYHA 5B36A 4DV5B 3TM4A 2HXGA 1U1FA 2VAVA 1DJNA 4CT0A 3GXBA 1JGTA 5H4GA 2I54A 2PUAA 1JHRA 2FOIA 2LCFA 1T2UA 2P5YA 1MGOA 2WF9A 4MRMA 4WRRA 4FZ5A 5AXBA 2O1EA 1GPJA 4B87A 4Q3DA 1EFHA 3SLKA 4HFRA 3AXTA 3IESA 1P31A 3OPYI 3P9XA 2FMKA 1JLRA 3OZVA 4DY4A 3SC2B 4NU8X 4C4RA 3PEFA 2A92A 1N2ZA 4M89A 4QFCA 1ORDA 3RGWS 1N1MA 1HETA 4GXTA 5KWVA 1ML3A 2CBXA 2PFGA 2EKLA 3EZ6A 4HG2A 4U5XA 4YJKA 4I5GA 4ESOA 1ZMRA 4RZXA 4OIFA 4HUJA 3EGOA 3TTWA 3O9VA 1MD9A 4G5YA 1N2IA 5CBKA 5EQTA 1U3CA 1EJ0A 1PR9A 4BB5A 3F5FA 1PZMA 1SZPA 5C35A 3MLAA 4GOMD 2EBHX 4MUIA 4UHJA 4YONB 3AG5A 5B57C 3HP7A 3PVZA 4F8EA 4XLLA 2LRHA 1V25A 4RTQA 1DAFA 3IOMA 4RD0A 1CFJA 5CA0B 1VIAA 3MRXA 1KQNA 3TQHA 5B4TA 1NBIA 3B2EA 1W1UA 3LDAA 2C8JA 4G1UC 4JH0A 1YR7A 2NZ8A 4EW1A 2FX2A 2J31A 3BGDA 5AM1A 5HZKA 1P0FA 2MYUA 1Z0FA 4H77A 1KPHA 3LLMA 3NOOA 3W78A 2IP2A 4RPGA 3Q0EA 4MRRA 2UYHA 1RQLA 2II6A 3ECCA 5EIHA 3IJRA 2OCPA 3NWJA 1B23P 1F8UA 1QG0A 2O0JA 1SKYE 2AEJA 3V4PB 1DNPA 1OZ0A 1Q77A 3U4AA 1QF6A 2HHCA 3IP3A 3FYUC 3NDRA 3WA6A 3I83A 3C8HA 4NE9A 4DLZA 3O31A 3LDFA 3D5EA 3VSEA 1HUQA 1O7JA 4CTKA 3V8RA 3NHKA 3TNLA 7REQA 3BMOA 1G5FA 1P1IA 3FIUA 3JD0A 3M1AA 2HBZA 3PU6A 4FZ3A 4BLQA 5C80A 1GPAA 2PH5A 3ER8A 4MQ4A 4O2RA 1B3BA 3NTLA 1Z16A 1PZNA 4GSYA 5DM2A 1AN0A 3SXUA 3U13A 3WK9A 1DBVO 2BY4A 4QPPA 4Y2TA 5IN5A 4RJ2A 4AWBA 2ROQA 1O03A 3GMDA 1SZJG 3IO3A 4S12A 2OUIA 1OTHA 2MT9A 3IPXA 4ZODA 4Y2YA 4UASA 3FOZA 4N54A 2V54A 2DFNA 3VMFA 4RAQA 3FR8A 4PE5B 3SIPA 1SXJD 4EAAA 3L46A 4AYXA 1DXOA 4Z7QB 4JDUA 5FAXA 1OXUA 1JDZA 2WYOA 2QHXA 5U4XA 1P0PA 4LMRA 1CDOA 2BBWA 2H1RA 4PNZA 3RC1A 1UCFA 1PJTA 3K70D 2OBNA 5JI2E 3PENA 3RVMA 5TC4A 4EF5A 5F2NA 4AZ3A 1G3IA 3JYPA 3C4JA 2V8BA 4YMGA 2IYFA 3QMMA 1XD8A 4RY2A 3P2YA 4UEKA 2BFCA 5JSZB 4CGYA 4A5OA 1OFTA 3VOSA 5DSZA 3VZBA 3WFJA 1Y8QB 2Q49A 3FNBA 1W85A 1NXWA 1K0FA 5CHEA 1N4AA 1JYSA 4FMDF 4TWZA 5E1DA 2D8AA 1BX0A 1Y7TA 1AJEA 2XE6A 3DPIA 3ABIA 4FC6A 4FTWA 3RKUA 3EPJA 2ECQA 4DLTA 1SB9A 4EABA 2F6RA 2IS1A 1XAGA 1UFQA 3H05A 2AG6A 1U63A 4FFMA 1BWSA 4PZPA 3FPFA 1O6CA 5KSOA 2AXNA 3O83A 2OZVA 4GYKA 4JL5A 4Y6PA 3STTA 3TQCA 3FB1A 1D2RA 3I2GA 1ZIDA 2ID4A 3AZQA 2XOKA 3ELWA 1WE2A 3C3BA 3I9V1 4EUEA 2A2ZA 1F8GA 2OG2A 5HILA 5JCJA 4G6ZA 3LM8A 3UEOA 3ZVLA 3U4CA 2GCOA 4O2BB 4UREA 3ADKA 4JENA 1FX0B 3LP6A 4PAOA 3H0KA 5EE3A 1IMOA 2OMEA 1NMYA 4JHLA 1QRUA 1O77A 3DM5A 2EAUA 4EG1A 1E79A 1AHHA 4MVJM 5LIPA 3L07A 1GUZA 5JPCA 4RD4A 1B6GA 2GHIA 2IHJA 3EEOA 3AW9A 1QX3A 1UQTA 3O2SB 4KQ1A 2ZOSA 1E4VA 1MB2A 3KEQA 4Q21A 1S96A 3TO5A 4AN4A 1GXSA 4MPRA 2ZKIA 2P5SA 1KBZA 1Z2EA 1ZITA 3B78A 2E89A 3D6FA 1SBCA 3WYDA 1IJEA 2NYUA 5IBRA 4NCNA 3YASA 5HVNA 1KO8A 1XD9A 4MW0A 1TM1E 1GTMA 3BBPA 2GYVA 5AXAA 4RD2A 5C4MA 3PX2A 1XWWA 1EGQA 1PQ4A 1LF5A 1Q2UA 2PLRA 3EXG1 4GXQA 4HDOB 1KI6A 4LK2A 4OJMX 4ZCMA 4IJUA 3EC1A 4EEKA 5JPDA 2XZLA 3F3KA 1BC5A 4PBSA 1XXLA 1RKBA 4BUJA 5GINE 2FG5A 2HF9A 4UAGA 1CVLA 4EEZA 1QGDA 2ZJ1A 5IDQA 2WV9A 1EXWA 4IX9A 5TNXA 1XTIA 1J06A 1KH2A 1TIKA 1QZUA 4HNAB 4TQGA 3ZH2A 1FXSA 4WOCA 2WIDA 1XLUA 4ARIA 2OHXA 2RJOA 3LX6A 1G59A 1ZD3A 3FWYA 4FSDA 4XWAA 5H4HA 2YINC 5FL7A 1BAPA 4QOGA 1RNLA 3HA5A 4M36A 4V0MA 3W4KA 3CLVA 4EA9A 2LE0A 3A27A 5AI4A 5HRAA 1YF3A 1NNEA 2X0RA 4Y6RA 4F21A 4JJAA 1PJCA 1WCV1 2QSJA 3PWTA 3GLIE 2VK1A 2OO5A 2GJ4A 2WNIA 3Q87B 2Q6KA 1QYXA 4C4PA 5C8VA 4E3WA 3UMBA 1VG8A 2WMOB 4ZT2A 5AVYA 5KMGA 2I34A 3BERA 2JIBA 4X7MA 5K3BA 3D4LA 1N0WA 3KT6A 4XWGA 3K0CC 3E7PA 4G5GA 2FRDC 2RGAA 4MVJA 1SU8A 4YRFA 1YU9A 3NAZA 2WMNB 3PA8A 4RHTA 4BMZA 1CNMA 2H54A 4D4KA 5AKKA 4URZR 3KUUA 4GR5A 4PSDA 2QX8A 1UOOA 4DMKA 3HGMA 2Y27A 3ACBA 1A5TA 3ZHYA 4ESHA 5HM8A 1ZD1A 1DV2A 1RMQA 4JCOA 4WZBE 5JADA 4MUXA 2QIPA 1JEOA 3VPHA 1GPKA 4P8RA 1JE0A 4J75A 4ILEA 1E0AA 1TZBA 1M0TA 1QC5B 4W99A 2CYBA 4L75A 5JAIA 3IOYA 5JNRA 2W83A 3SF8B 5TIIA 1QQ5A 4LJSA 4JJEA 1OXXK 2K87A 4NCKA 3RFCA 1QO0D 1I6LA 4XVQA 2KJQA 5BVHB 1XTQA 1LPOA 1NYRA 5AM0A 1D8AA 2BP7B 2XMQA 1XN4A 2E5FA 2RH9B 1SCBA 4I46A 5EWJB 5KWJA 1R4NA 1IN5A 5DTIA 3ER6A 3WB9A 4E21A 2J6BA 3O26A 1CY2A 1TEVA 4GC9A 1XTVA 4RF3A 1Y1PA 2NO9A 4I1YA 4LFAB 3SX2A 1N6LA 1XHFA 4KXQA 3I9V6 3COJA 4DCMA 1AXGA 5KYNA 1NOJA 3FDZB 1WJGA 2O8EA 1Q3TA 3MJEA 3Q3CA 4IUBS 4F7WA 3D31A 2CMKA 2AVDA 4QRIA 3STXA 4CDGA 3M1LA 1BA3A 3EXHA 1PG2A 1UXKA 2JF0A 2N47A 3T7KA 3O7MA 1Z28A 1G6Q1 3RYHB 2CZCA 4MW1A 4EJSC 1DKNA 4LJ5A 4CTNA 2UUAB 2A30A 2I2DA 2PEYA 3W1EA 2DR0A 3IERA 3LIIA 2QMYA 3KXDA 1JDSA 2EFYA 4JB0A 1JSCA 3UT0A 1WEKA 2Y0EA 1Q1AA 2C9MA 3KKOA 3OIYA 5U9CA 1JKJB 1AKWA 2FH5B 2PSJA 2IEDA 2UVDA 3R6TA 4WXRA 3WBFA 5KSZA 1I32A 1ZIOA 3GJ7A 1AGNA 2H59A 2Y1KA 3EAQA 4HVTA 3NNDA 4PY2A 1AHIA 4M54A 3ZGYA 3VJRA 4RIEA 1SO8A 5BWCA 3ZK8A 1HORA 1OBHA 4NH4A 1FSZA 5CTAA 1NU8A 4AY3A 5A02A 4CEIA 2HJSA 4M8IA 3ZW8A 4EG6A 3W5SA 1RPZA 5E6SB 5BVGB 5IT4A 4WK6A 3DOIA 2G1KA 1KAGA 3AUKA 1WU8A 4MARA 5A4DA 2EIXA 1E3TA 3D1LA 1RZUA 1IN4A 1KI1A 3I01M