1Y3VA

Trypsin inhibitor complex
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A simple protocol to estimate differences in protein binding affinity for enantiomers without prior resolution of racemates.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Trypsin, cationic
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2004-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1y3vA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1y3vA02
1O2NA 1TONA 8GCHF 4OS4A 2FOHA 1UHBA 4INHA 1EAWA 1EXFA 1GBHA 4AX9H 4CR5A 1V2TT 2QIQA 2TPIZ 3IG6B 5TCAA 3RXHA 2F9VA 1QA0A 1K1JA 3D62A 5FAHA 5K7RA 3ZYDA 5LPFA 1XMNB 4GCHF 2QXIA 4XOJA 1O5BB 3SV7A 3SV6A 2VVVA 3KN2A 1C5PA 5SGAE 2ZTZA 4JYVH 3ZZ8A 3ZVDA 1MH0A 4D9RA 1VITH 1PPHE 1GJ9B 3QLPH 1HXEH 3BG4C 4UONA 2EC9H 3ZZDA 1TGTA 3ZV8A 1QJ6B 1SGQE 1SSXA 2QGRA 2STBE 2ZECA 1Y5BT 4B2BA 1BTUA 2AFQB 5C2ZA 2C4FH 2FM2A 1PPGE 2VVUA 2ODYB 1DLEA 3CS0A 1LTOA 2GV6A 4E06H 4XBDA 3ZZAA 3ZVBA 1V2LT 4A7IB 4BTTB 4FVDA 5HMAA 1RGQA 2OC8A 4X2VA 1GMCG 3RXFA 3E16B 1UCYH 1GGDB 3GDUA 1MTUA 1KLJH 1O2SA 3ENSB 3SU0A 4ZUHA 1XUGA 1VR1H 4ABJA 2ZFPH 4CH2B 2ANWA 1H4WA 1AVGH 1A4WH 1ACBE 1J17T 5T3HA 1G2LA 2O8WA 3I78A 4NIVA 2AH4X 3FZZA 5A0CA 1P2JA 2ZF0H 3TPIZ 1GI7B 2QV1A 4JYTA 1PJPA 5JYIA 4NCYA 4Q7ZA 4KTSA 2BB4A 1V2WT 3MFJA 1K1MA 2W5EA 2ZDLA 4KKDA 4IGDA 1GVZA 1Z6JH 2BY8X 1DWCH 1D4PB 3NUMA 2SNVA 3T2NA 2SGFE 3LC5A 3I77A 4CRFA 3BTWE 5AFYH 2CJIA 1HJ8A 3GY7A 5AVDA 4I32A 2GP9B 2QYIA 3LGTA 2FWWA 1SFQB 1FPCH 4ISOA 2UWOA 1LHCH 1F0TA 1T7CA 3JZ2B 3S9BA 2BD8A 4TYDA 4AFQA 1NM6A 3MNCA 3BSQA 1QFKH 1KYNA 1EOLA 3RXJA 1ELGA 3VEQB 5DO4H 3MHWU 1OWEA 4ISHH 4ABHA 2BY9X 1XUKA 2BZAA 1OXGA 1T4VH 1GBDA 4CRGA 4OS7A 8ESTE 4X6OA 1C9TA 1LO6A 2F9OA 2VIQA 3TJOA 1SGRE 1LHGH 2G5VA 1SGFG 5GXPA 1ESAA 1GMDG 2ZO3H 1BCUH 2QY0B 3KQCA 1YC0A 4NSYA 3CENA 2NU4E 1TGBA 4BAOB 1UTNA 2TGTA 3SNAA 4FUGA 4SGAE 1TBQH 1LDTT 3QGNB 1GBBA 4TY7A 1FPHH 3V0XA 1VJ9U 2P95A 1NESE 4GPGA 1E37B 1DY8A 1K9OE 4WVPE 1ZTJA 1GI9B 5FPSA 1S82A 1AKSB 1ELTA 1TABE 4Y79A 2OUAA 1HNEE 4NSVA 4H4FA 3M5LA 3HK6B 1OOKB 3BTME 1UVPA 3QUMP 3MMGA 2O9QA 2FOFA 2R2WU 2ZHWH 2PHBA 1OSSA 1CGJE 4O3UA 3NK8A 2BD9A 1OX1A 3ESTA 1BTXA 4WJG2 3SI4H 1P2MA 1HAOH 3EYDA 3AASA 3ITIA 2HALA 5GWZA 4D7FA 3PLKA 4CHAB 4ZKRU 1QR3E 4AFUA 1C2EA 3QGJA 1ZGIA 1E34B 2ZFRH 3GY4A 3ODDA 4BOHA 2FODA 2ZIQH 3MOCA 1EJAA 2CXVA 2BOKA 1AUTC 4O3TA 1AGJA 1G2MA 3SU4A 3VB3A 2UUJB 1ZPZA 2BOHB 1BITA 2H2ZA 5GIBA 4I33A 3SJOA 1BT7A 3I29A 6CHAC 2A7HA 2V0BA 1G36A 5E0GA 1C5TA 2HGTH 1SB1H 2XC4A 4XE4A 3RU4T 2C3SA 5HM9A 1IQKA 3SBKA 4DIHH 3P6ZB 1J16A 2P59A 1O3HA 3VB6A 4GHQA 5J4SA 5TJXA 1V2QT 1GI1A 3ZVEA 4CH8B 1QA7A 3GISB 3GCHC 4UE7H 2EI6A 2EI7A 4TY6A 2ILNA 3A7XA 4DG4A 1DSTA 4FU7A 2K1QA 2ZKSA 2Q6DA 1T8NA 3UWJH 3FP7E 1Q31A 2W7SA 1SL3A 1DOJA 1GBEA 3GDSA 2BHGA 4DJZB 1CHGA 2PFEA 1NN6A 2PV9B 3U8OH 1A5GH 4FUEA 1TRNA 3RU4D 3PB1E 2Q6GA 4A92A 1KIGH 1JRSA 2D8WA 1NC6A 1ZRBA 2GD4B 2Z3EA 5FHTA 1GDQA 2P3TB 3SHCH 3PV4A 2V35A 1GBLA 3SU1A 2ZNKH 2HPQH 2FX6A 1AE8H 1OP8A 4ABGA 4K3JA 2W26A 3RXKA 1BMLA 2BLQA 2KAIA 3QK1A 2WPLS 8GCHG 3M3SA 4MPWA 1FNIA 1W2KH 1OP0A 2P3FH 3FFGA 3PMHB 5FX6A 1MTNB 1TNHA 1ANEA 2VWMA 4OGYA 1AZZA 1CU1A 2ZU5A 4MDSA 3TNSA 1L0ZA 2J38A 1CT0E 2XC5A 1TPPA 1ORFA 3UR6A 4ISNA 2OTVA 1C5ZB 3TGIE 2ZCHP 3NPSA 7GCHG 4H6SB 4D8NA 2B7DH 1DM4B 3T28A 1MBMA 4Z0KA 4CRAA 1IQFA 1RJXB 4GUXA 1GJCB 2QF0A 4JZFH 1C9PA 2A7CA 2BDGA 1MTSA 2JH5D 1NFWA 3VGCB 1GL1A 1NFYA 4X1PU 4NIXA 1EATA 2GTBA 5EPNA 3UQVA 1MAYA 1GCTC 1OWDA 3U8RH 1KDQA 2A31A 4ABFA 5CMXH 7LPRA 3KL6A 2STAE 5EODA 3A8CA 1V6DA 4IC5A 1PPEE 3KGPA 1BTYA 1PYTD 2G5NA 2R2MB 1HDTH 2AERH 1B7XB 1QRWA 4UFDH 1QHRB 1AO5A 4CHAC 6GCHF 1ABIH 1Y3XA 2ZEBA 1ZMNA 1UK4A 1YKTA 4Y6DA 3W95A 5I46H 1LPKB 4YTAA 4TWWA 1NZQH 3SNCA 2V6NA 1GHXH 1O2RA 1MAXA 4X6PA 1BMNH 1DITH 3URDA 3LDXH 1KTSB 1UVTH 1ELDE 1KXBA 1A3EH 4E7NA 1WV7H 1TNIA 1YGCH 3BG8A 5EPYA 1MCTA 2A1DB 1QY6A 2NWNA 2G8TA 1DICA 3RMMH 2ZGCA 1D6RA 1KLTA 2CHAB 3NZIA 1XVOA 4ZROA 1ZGVA 3PYHA 1O3GA 1J14A 3TJVA 4CRDA 1RIWB 1DUEA 1WCZA 3GICB 1A0HB 2GX4A 2HNTE 3U8TH 3RXUA 3TK5A 2ZDAH 3OTJE 5AHGH 1AUJA 1C1VH 1TNLA 5E0HA 1SGIB 5F8TA 4Y10E 2BTCE 4HTCH 3MO3A 5EQSA 3RXOA 1Q3XA 1Y5UT 1EP6A 3A8AA 1HAVB 3A81A 4AN7A 4B74A 1P04A 1BTWA 9ESTA 1AFQB 3QX5H 4AOQA 1E35B 2C8XB 1JRTA 3PMBB 3HATH 3ZZ3A 1BHXF 3UNQA 4IMZA 1NRSH 1TX6A 2XBWA 1UTQA 1FXYA 1QQUA 1ZR0A 2P16A 1P02A 2D26C 1FI8A 1NRQH 1ANCA 3RP2A 3LPRA 2BXTH 1Z1IA 1UMAH 1O2PA 1ZMJA 2BMGB 1O0DH 1IHTH 3AAVA 3ATIA 1XUHA 1P2OA 1TMBH 1MKXH 1ETTH 2BLOA 2J9NA 3UFAA 1MU8B 4ZKOU 2I6SA 3MO9A 2VH0A 1SHHB 2XBXA 3NWUA 3E0NB 4D76A 1DVAH 4E7RG 1CBWC 4WMDA 2V3HH 1Y3UA 6CHAB 1HYLA 5A2MH 3B8JA 3ZZ6A 1AE5A 3UNSA 1A0JA 2FIRH 4Q2KA 4NFFA 3M7TA 1WYKA 3FVFB 4KTCA 1AZ8A 3UPEA 1H9IE 1HXFH 2CF9H 4H42U 2GCTC 5EGMA 4VGCB 1TA6A 4HFPB 5FBIA 1TX7A 3MH7A 2Y5FA 1RS0A 1ESBA 1PQ8A 2B5TB 4M7GA 1BTPA 2TGPZ 5DK1A 2AGGX 1IHSH 2BQWB 5E8EH 2BDYA 3UTUH 5FPTA 1O2HA 1YLDA 5ESTE 2ZFQH 3Q3YA 1Z8RA 4F4OC 1HBTH 2NU3E 4U2WA 3ATLA 1YPJH 2QCYA 2XCNA 3ATMA 1O3IA 3LONA 8KME2 1AU8A 5T6DA 1FY4A 2LNCA 1D3QB 1G3DA 3RDZA 3UREA 2F91A 4BXWA 3EA8A 3STJA 1GG6C 1TB6H 2RCEA 2ZFTA 1AVXA 2VIOA 2JETB 5L30H 4MPVA 1UVSH 4K1SA 4UFGH 5B6OA 3HKIB 1NU7B 4Y0ZE 1C5NH 1QNJA 1EKBB 1TMUH 1MKXK 1GBAA 3T62A 7GCHF 1QIXB 1GVLA 2OQUA 2BQ7B 5DP6A 3MNBA 3B9FH 4F49A 2C8ZB 4GLYA 2ASUB 4MNVA 2OC1A 2B0FA 3AVZA 4B75A 1F2SE 5EW1H 1AY6H 1P11E 1QGFA 1BB0B 4MNWA 1FZZA 1GJ6A 4MTBA 1W7GH 1GI8B 2IOTA 4X8TH 2J92A 2A4OA 4Y11E 1GI2A 3M5MA 1WSSH 5DP8A 2TGDA 4Y7BA 1N8OB 1HAZB 1DANH 1XUFA 1V3XA 1KSNA 1N6YA 2GZ9A 1F0RA 1Y8TA 3STIA 5E2PA 3BTDE 2Y6TA 1LVMA 5JB8S 1SGNE 2THFB 1GHBG 3TK9A 4K69A 2A5KA 4A1XA 2OINA 4K1EA 4WY3A 2QXHA 3SO3A 1ELEE 3SNBA 2WPIS 3QN7A 1AB9C 2A4QA 1C1NA 2GDEH 4MLFB 1V2NT 2UWPA 3UQOA 1B5GH 1ZLRA 2ODPA 2G4UA 1CT4E 3MU1A 1DFPA 5HYOA 3K6ZA 2BD2A 2R9PA 3SU3A 2XYAA 4BANB 1T32A 1TX8A 3BV9B 1TGNA 3LGVA 2GMTC 3VXFH 1FY8E 3EA7A 4NWLA 1SGEE 5EXMA 3MU4A 1CBWB 1P2IA 1O3NA 2VH6A 2GZ8A 3RM0H 1V2PT 2OD3B 4AGKA 2WPJS 2OP9A 2TBSA 1FQ3A 1W8BH 1QJ1B 1G3EA 3K65B 4JK5A 2GGVB 5TCCA 3MH5A 5LGOA 3BTHE 1GI0A 1S5SA 2G00A 2SGDE 2PWXA 2Z94A 1VCQA 2ZPSA 4FU8A 4Y8YA 1WBGB 1O3JA 5DJ7A 2Q6FA 2WV5A 3D49H 3E91A 4YOIA 1VCPA 1MZDA 1QL7A 3RMLH 1MU6B 2W3IA 1FV9A 1S81A 3UWIA 2PSYA 1QRXA 4CRCA 2CMYA 4HZHA 1O2QA 1TE0A 1GHWH 1PPCE 4BNRA 4J1YA 2ZDKA 1TYNA 2GCHF 1B0FA 1TPOA 3BTFE 2BY5X 2H5DA 1O2XA 5GCHG 1LVBA 3AW1A 1PYTC 2HNTF 1QJ7B 2BVXH 1QL8A 3SUGA 2WPKS 1GMCF 1HJ9A 1O2ZA 3SQHE 2VB0A 3MYWA 2FOEA 2F3CE 3E0PB 1GBIA 4I8HA 1L2EA 2FOCA 3M37A 1FIZA 4PROA 1EQ9A 5EOKA 1IOEA 3A7YA 1WQSA 4X1RU 2Z7FE 1BOQA 1P3EA 5C1UA 4A6LA 1ELCA 3SGQE 1EJMA 3MH4A 4ZXXH 3SUEA 3KQBA 2FI5E 3GY5A 5DGJA 1ABJH 2RG3A 3E3TA 1YCPK 4FUFA 3RXIA 1UTOA 3SV9A 4CRBA 5C67A 4UEHH 1NRRH 1D3PB 2PTNA 3BN9A 1DXPA 1EAUA 3EDXB 5FBEA 1O3MA 3L33A 1H8IH 3SI3H 4JZIA 3SUFA 3UOPA 4RN6A 1SLVB 2Y7ZA 4XFQA 1HAVA 1A5HA 1SFIA 2BYAX 1TGSZ 2O8UA 5JPMH 2EEKA 1AWHB 1ESTA 1PQ7A 1C1OA 1H9HE 1YCPM 2QF3A 2C90B 2GCHG 3HPTB 3GYLB 1ELVA 1BRAA 5A09A 3SNDA 9LPRA 1ZZZA 1WTHD 1GMHG 3F1SB 1ZYOA 1DSUA 1C2MA 1ARCA 1GCTB 1TIOA 1TRYA 4AFZA 4MG3A 1EZXC 3GY8A 2FI4E 1SQTA 1L4ZA 1N6XA 1P06A 3JZ1B 1P12E 2KAIB 1KXAA 4UDWH 1T8LA 4I8JA 1C1UH 2BY6X 3TGKE 1G3CA 3SN8A 1FY1A 1DDJA 1O3DA 3BIUH 1VCWA 1YPLH 1O3PB 1IQEA 4DVAU 2FOBA 2WUCA 2OLGA 3V12A 3RXGA 1B0EA 1A7SA 1GDUA 1GG6B 2F9UA 2QXGA 3GY3A 3ZVFA 4DW2U 1C4Y2 1GBJA 1GBTA 1TA2A 2FESH 3DD2H 2Q1JA 2W3KA 1WUNH 2TGAA 1KXEA 4JZDH 2J94A 1ELAA 3V7TA 1V2JT 1P2KA 3IITA 4A5TS 3M3TA 3SGAE 1UTMA 3MO6A 2CN0H 1HUTH 1FMGA 1GJ5H 1WQVH 2SFAA 1QB6A 4X6MA 1BTHH 3PMAB 1INCA 2H9HA 3P8NA 1TALA 1VZQH 1W13U 4B2CA 4GSOA 3EGKH 3GCTG 2BLWA 2Y81A 3RMNH 4FUHA 4CBOA 5I25A 4X8SH 3T27A 1WAYB 3LGUA 3MNXA 3U98H 2FEQH 2JH6D 2BVSH 1NRPH 4SGBE 2SGQE 1AB9B 2BQ6B 5F6MA 3LU9B 1DY9A 3RC6A 1O2TA 3ZZCA 2ESTE 1BA8B 1NY22 1IQHA 1VITF 7ESTE 1JWTA 1C4V2 5PTPA 3SJ9A 2BD4A 4Y76A 1P8VC 3T25A 1S85A 1SR5C 5JBCS 3P92A 5GDSH 3EQ0H 1EPTB 1E0FD 1GJ4H 2BZ6H 3F6UH 6ESTA 4KELA 3SOSA 2H5CA 4ABIA 2XCFA 2A5AA 1MQ5A 1S6HA 1RTFB 1O3EA 1RTKA 2FS9A 1YBWA 1AMHA 1EB1H 2GDDA 3M36A 1DWDH 3P17H 3KEEA 3SUDA 3SV2H 5A8ZA 2F9BH 2ZDMA 3H7OA 2GV7A 1G32B 2WINI 5IYTA 3KF2A 1C2FA 2BM2A 3F9EA 1NFUA 4YM9A 1YCPH 2A45B 2BXUH 1MTVA 2H6MA 1ZHMA 5DKMA 1A2CH 5EXLA 3TH4H 1UTKA 4UFFH 4AG1A 4XSKU 1BBRH 3MI4A 3FAOA 1DUAA 3ODFA 4NA8A 2A0QB 4A1TA 2CV3A 3TH2H 3PWBA 2A5IA 2FOMB 1FLEE 3R0FA 4X2WA 1YLCA 2P8OC 2BD5A 2FTMA 3TIUA 1C1TA 2GT8A 4Y7AA 1J8AA 1NO9H 2Y5GA 5EXNA 4K8YA 3P8FA 4AORA 3K2UA 4FUDA 1GMHF 2NU2E 1A5IA 2BDIA 3FP8E 1MD7A 2F83A 1JXPA 2PKSC 2C8YB 3GCOA 3RMOH 1GBKA 1YPMH 5L2ZH 1DLKB 1TWXB 1O33A 1RXPA 4OS5A 2BDAA 5DP5A 3KNXA 1AFEH 2EI8A 2ANYA 4X1QU 3V13A 1LPGB 1RFNA 1CHOG 1DWEH 1BMMH 1HPGA 3P8GA 2ZDNA 1BRCE 1GHVH 4IMQA 1YPEH 4MPXA 2SGEE 4IC6A 1MTNC 1C5XB 5GJ4B 3RXCA 1UTPA 2G51A 5LPRA 1J9CH 4U30A 2QC2A 3OYPA 1MKWK 4LOYH 1DWBH 1JMOH 1GJBB 4NIYA 4KP0A 4X1NU 5IDKA 1GI6A 3GYMA 4YLUA 5HXFA 1UHBB 5HGGA 3O8RA 3BTGE 3K9XB 4DGJA 2GT7A 2ZP0H 1RRKA 1LHDH 3LT3A 1GI5A 3RXSA 3RXVA 2XWAA 2WUBA 4WF8A 4YLQH 2ZPRA 2NU1E 1EZUC 3Q3XA 3M35A 2FI3E 4AYYB 2XWBI 1SG8B 2M5TA 1KY9A 4X8VH 2VNTA 1GL0E 1GBFA 4IN2A 2YOLA 3ATKA 4FVBA 5C5NA 4ASHA 3A7VA 4FU9A 2D1JA 4Z6AH 2A2QH 2ZPQA 3A8DA 1UVUH 1TBZH 3C27B 1EJNA 2PTCE 1C5MD 3A85A 3ZVCA 1O39A 1FJSA 2OC0A 4ISIH 3SU2A 5A8YA 1P09A 1A0LA 1HRTH 2V3OH 1W12U 1C5LH 1GGDC 1A46H 1VGCC 1ANDA 3LOXA 3UNRA 1ZJDA 4ZH8A 3FANA 1Z8IB 1S0QA 4YT6H 3AW0A 4A1VA 3IWMA 2B9LA 2FP7B 4MNXA 1TOCB 1F0UA 1P9UA 1Q2WA 2XTTB 4ZHLU 1QBVH 3SORA 3FZDA 1SGDE 4YESB 1NS3A 2OBQA 3QZQA 1HAYB 1VGCB 4Q7YA 3P8OA 3F9FA 1T31A 1KDQB 1V2OT 3OY5U 3WY8A 2XNIA 3UR9A 3BF6H 1GBCA 1V2RT 2PKAA 2ALPA 3OY6U 1C5OH 4YO9A 4JCNA 1QURH 2D2DA 1P2NA 1OPHB 4BAQB 1GCDA 1ZPCA 3KHVA 1AKSA 4IS5A 5AFZH 2P93A 1C5WB 2C93B 2EA3A 2QAAA 1ZRKA 3L3TA 2J2UA 4WMFA 5DP9A 1H1BA 2Y7XA 2QA9E 2G52A 4B1TA 5HM2A 1GJ7B 2ZDVH 1YPGH 2GZ7A 3DA9B 1KXFA 4O97A 3OU0A 1C2DA 1LHFH 2ZFSA 3MWIU 1CHOF 3Q3KA 1IQLA 4RKOB 4HGCA 4FXGH 2VIDA 1MMJN 2JKHA 4D7GA 2P8OB 1IQGA 1P9SA 1W10U 5L2YH 1CGHA 2ZU3A 3ZZBA 1XXDA 1D6WA 3F68H 1L1JA 3DUXH 1C1RA 3BEIB 1OKXA 4KTUA 2VJ1A 2O8MA 4R0IA 1GDNA 2BX4A 1UTLM 2FMJA 3PTBA 4KGAA 1SQAA 5C3NA 4OGXA 1L1NA 4GCHG 1XX9A 1BQYA 2A2XH 2ZQ1A 2Z9GA 1C2HA 3W94A 3NXPA 1KXCA 1OYQA 1LQDB 2TIOA 4Q7XA 4ABDA 2ALVA 4WWYA 1NRNH 5F03A 2R3UA 1X7AC 3A82A 3SJIA 2JETC 1AIXH 3CP7A 4NWKA 5GPIB 4YT7H 1TPAE 3Q77A 3RM2H 1D9IA 1C1PA 1V2VT 3O8BA 1HFDA 1V2ST 1G30B 4MVNA 2FLBH 2XBVA 5DP4A 2W7UA 3O8DA 1C1SA 1C2KA 1T4UH 1XM1A 2OCVB 5LPEA 1O2KA 2XRCA 3LGYA 1ZJKA 3QWCH 1H8DH 1K2I1 4K8BA 4Q80A 4DURA 3GY2A 3O8CA 1MCVA 4BAKB 2DE8A 3BTEE 4NGAH 4B76A 1O5CB 1CE5A 4OS6A 1G3BA 2FYQA 3ELAH 3T29A 1JIRA 3D65E 3A87A 1CSOE 1GHBF 2HNTC 1OP2A 3F9GA 5H4IB 1Y3VA 3SGBE 5J4QA 1SLWB 2YNAA 3UY9A 3B23B 1NT1A 1TOMH 1C1WH 2CGAA 1O3CA 1K22H 1VITG 5JBTA 4X8UH 1KXDA 4ABAA 4JZ1A 4ZHAA 1RIWC 1O34A 1K1IA 5K0HA 1ZMLA 3S0NA 1FUJA 2PSXA 1O31A 5JB9S 1QRZA 4UD9H 2Y5HA 3BTQE 1NFXA 2R0LA 2HLCA 1O2WA 5EG4A 3SHAH 2Z9KA 1ZTKA 4DY7B 4H6TA 4NZQA 3VGCC 2VU8E 4I8KA 2ZCKP 1HV7A 1BJVA 3PROA 1A61H 2FLRH 4TPYA 2ZQ2A 3RXPA 4DT7B 4INKA 1GWAA 1TNKA 4I8GA 1ZSLA 1AN1E 1A3BH 3M61U 3GY6A 5DP7A 4JK6A 1BBRE 3U1JB 3E1XB 3PWCA 2IJOB 2ZGHA 3T26A 2Z6BD 2DUCA 1SMFE 1O3AA 1O2MA 3E8LA 3U1IB 3RXDA 3S7KB 6GCHG 2IN2A 3MU8A 3TJNA 4E05H 1F5RA 2CF8H 5T6GA 2ZHDA 2BD7A 1BIOA 1QTFA 1YP9A 1P3CA 3L6PA 3TH3H 2ANMH 1GI3A 5FXLA 2PGQB 5ETXA 3M7QA 3TK6A 1FDPA 1K1PA 3A7WA 1P57B 1AWFH 2A4RA 1JBUH 1ANBA 1ARBA 2AGIX 1QL9A 1THPB 2H9TH 5FCRA 4LZ1H 3TU7H 1BBRK 1HAIH 4ABEA 1JOUB 1SGTA 3KCGH 1GJDB 4FUBA 4I8LA 3A8BA 2FPZA 1GMDF 2H1UA 4K5ZA 4CBNA 4AFSA 2PKSB 2VIWA 1IAUA 3UOUA 3DFLA 2OC7A 1FN8A 2Z9JA 4WXIA 1TGCA 2IPHA 1TRMA 5C5OA 1O3KA 1YF4A 5C20A 2VWLA 1ID5H 1EAIA 1P03A 2AMQA 1DX5M 4OS2A 1WU1A 1S0RA 1TLDA 2ZC9H 1A1RA 2SGAA 2AYWA 1C4U2 1T8MA 1YYY1 1W3CA 2B8OH 5CE1A 4XDEA 5ESBA 4GHTA 3N7OA 1TMTH 1U6QA 1QB1A 1C2GA 4DIIH 4NFEA 1HCGA 1ZHRA 1O2OA 3ZVAA 1Z71A 1GHZA 3BTKE 2AS9A 2XBYA 2ZG0H 4QT8C 1O2YA 3ZYEA 1ETRH 1HLTH 2ZA5A 2ZU2A 1EZSC 1BMAA 3T5FH 3A86A 3RXMA 1O38A 1FY5A 2ZU4A 1G37A 2I6QA 1JIMA 3VXEH 1UO6A 4FUJA 3U69H 2PLXA 2RDLA 2ZWLH 1L4DA 1C5SA 2PUXB 3QO6A 1MD8A 2J34A 2ZU1A 1LKBA 1ZOMA 3MU5A 3VPKA 4DCDA 3LKWA 1LKAA 1K28D 5C1XA 3A83A 2BY7X 4WMEA 1WTGH 2VVCA 4O9VA 1HJAC 2Z9IA 2A4GA 1O3FA 3MH6A 1C5VA 4X6NA 4YZUA 4IBLH 1GHAF 1CGIE 1MUEB 1BRUP 1QBNA 1ZSJA 1GPZA 1SOZA 2OXSA 2ZTXA 4ZAEA 3TGJE 1IQJA 2FYRA 2UUYA 3UIRA 1BZXE 3HGNA 3OX7U 1SGPE 3LGWA 4WH6A 1E38B 1PQAA 2Z9LA 3VB7A 3BG4B 1O3BA 3PO1C 1HB0B 1UK2A 1O2LA 5C1YA 1G9IE 2ZHEH 1DS2E 5EU8A 1Z8GA 1P01A 1XKBC 2AGEX 2O8LA 4FUIA 2VIPA 3RXBA 1N8OC 1O5AB 1N1LA 2C8WB 3NKKA 1C5RA 2ZI2H 1ETSH 2UUKB 1THSH 4NA9H 1PPFE 2RA0A 1C1QA 3M3VA 3SW2B 1OYTH 1C5QA 1BRBE 1FIWA 5G4BA 1DXWA 2J95A 3S9AA 1LHEH 1O2UA 1J15A 2O8TA 3KIDU 1ELBA 4VGCC 1O3OA 1H9LB 3A7ZA 2PUQH 2R3YA 1K1LA 2NU0E 4O03A 1O2GH 1DT2A 1SGFA 2WV4A 1D3DB 1TQ0B 4BTIB 5FCKA 2VWOA 2G55A 2PR3A 1P05A 3HGPA 1MTWA 1PPBH 1HJAB 1OWKA 3SJ8A 3H5CB 1SHYA 2ZTYA 4TWYA 2GMTB 1GHYH 3RXQA 3RXRA 1OS8A 1QCPA 2HRVA 3PTNA 2ZGJA 1C5YB 1O2IA 3EA9A 4D9QA 1OWHA 4ZHMU 1C2JA 1TNJA 2AMDA 1NTPA 1LVOA 2H9EH 4NA7A 2BVRH 4ABBA 3LC3A 3SU5A 5JBAS 3SV8A 1LCYA 5A0BA 4GVUA 1FONA 3RXEA 1F5LA 1CA0C 1YPHC 1W0ZU 1Z8JB 1XVMA 2VINA 1W7XH 2WYGA 1KLIH 2OQ5A 3PO1B 1FN6A 3EE0B 1AI8H 2ODQA 3DFJA 4JYUH 1CA0B 3Q00A 1O5FH 1ZHPA 5A8XA 3RUOA 1GHAG 3R3GB 2F9NA 3GCNA 2R0KA 4AB8A 3S9CA 5JBBS 3HKJB 1GJ8B 3M5NA 4WH8A 1O5DH 1SLUB 1EOJA 2FTLE 2CHAC 5E2OA 2HVXA 1BTZA 2FX4A 1PQ5A 5F8ZA 3S69A 1O37A 2FZZA 3KQEA 4GAWA 1O5GH 1E36B 3A80A 6LPRA 1IQMA 2AIPA 4Y8XA 3GCHB 5ABWA 1CQQA 3AAUA 2FOGA 5LH8A 1WOFA 1O2JA 3H7TA 4JZEH 4X2YA 1SVPA 1BUIA 1KTTB 5CHAB 1XUJA 1S6FA 2ZHFH 1EP5A 3E90B 3QTOH 1TAWA 4NZLA 3TITA 3BTTE 3A84A 2BDHA 2J4IA 4NG9H 3SQEE 2ZZUH 3GCTF 1BHXB 3DHKH 1TBRH 1VJAU 4MNYA 1O2VA 4B2AA 3M5OA 1XKAC 2ZCLP 4ZMAH 2VWNA 2BDBA 1HAHH 1RTLA 2G81E 2FDAA 4TPIZ 1IQNA 2Z3CA 4YOGA 2AIQA 1O32A 2QN5T 2LPRA 1UCYE 2A7JA 1M9UA 5JDUB 1GBMA 1EX3A 1ZSKA 3MNSA 4BAMB 4OS1A 3GOVB 1GI4A 2P3UB 3RLYH 1ZTLA 4B71A 2WPMS 4INLA 2VGCB 1OWJA 1SI5H 3ZV9A 3G01A 3P95A 1GVKB 4CR9A 1D3TB 4IN1A 4K2YA 4XBBA 4HI3A 2OBOA 5AF9H 1L1GA 4YOJA 2UWLA 3ZZ9A 1EPTA 1THRH 2FO9A 1HIAA 5DPAA 1C2IA 3V3MA 5DP3A 4BTUB 2JH0D 4X2XA 2YNBA 1EUFA 4DOQA 1LMWB 5EQQA 3ATWA 4LK4A 1P2QA 1LQEA 3FP6E 1HAXB 1SLXB 1TNGA 1UCYK 4CREA 3CS7A 1SGYE 2TRMA 3BIVH 2DE9A 2Y82A 5CHAC 1K1OA 3TJUA 2ZGXH 4U32A 1ZPBA 3LJOA 1S83A 3RXTA 3KQDA 1LVYA 1Y5AT 1HIAB 2XW9A 1NROH 4BAHB 2Y80A 4I7YH 4X0WU 1Z7KA 1O35A 1AVWA 1FAXA 4MPUA 1HAPH 2GKVE 1CO7E 1K21H 1V2UT 3BEFB 3RC5A 2AMPA 1YM0A 1P10A 5BPEA 4RKJB 1O3LA 4ESTE 1CA8B 3RXLA 1AFQC 1SPJA 1F0SA 3RU4E 5FPYA 3VB4A 7KMEH 1V2MT 3GDVA 3PM3A 3PMJA 2A32A 4NIWA 2VGCC 2P94A 3LH1A 1TPSA 1BDAA 1O5EH 1SOTA 1F92A 3VFEA 2BLVA 2VIVA 5EW2H 4THNH 1OWIA 3SNEA 2XXLA 5E0JA 1QB9A 1AQ7A 3LIWA 4K1TA 4IW4E 3PLBA 1V2KT 3K6YA 4I31A 2XC0A 1TQ7B 1PFXC 1SGCA 3VB5A 1LPZB 2WPHS 1RD3B 1GJAB 2AEIH 3TVJB 3LH3A 3TNTA 3A89A 3A7TA 2BX3A 5BRRE 1EB2A 3NCLA 2FS8A 1CT2E 1EAXA 1SC8U 1SQOA 4JMYA 3LJJA 2ZGBH 1XXFA 3M7UA 1NPMA 2PKAB 4RSPA 1HAGE 3PLPA 4Y0YE 5DG6A 4K60A 1S84A 3SZNA 1F5KU 1AD8H 1BJUA 4Y71A 3RXAA 1P0SH 3ZZ7A 2HOBA 4R8TB 1TFXA 1UJ1A 1MKWH 4ZKNU 3EAJA 1W14U 3ZVGA 2HPPH 2ANKH 1Z1JA 5F8XA 3UUZA 1AHTH 4AGJA 3SU6A 4Y8ZA 1C1MA 1XUIA 5A0AE 3P70B 1C2LA 3C1KA 4AB9A 1MQ6A 5T6FA 2RA3A 2UUFB 4UFEH 3TLOA 2GVFA 4AYVB 3ZZ4A 3RLWH 1CVWH 1YPHE 3URCA 3D23A 2Z3DA 4U01A 3HK3B 1Y59T 1C5UA 4FUCA 5EQRA 3MTYA 2SGPE 1F7ZA 1IQIA 1W11U 2G4TA 2GCTB 2ZHQH 1FY3A 1SBWA 2PGBB 5GCHF 4LZ4B 1ELFA 3OSYA 1EZQA 1T8OA 1Y3WA 3BEUA 3DT0H 4ISLA 4J2YB 4AG2A 2BDCA 1W0YH 1Y3YA 1MBQA 1MZAA 1YPKH 3U9AH 3ZZ5A 2HWLB 2FOAA 4AZ2B 3E6PH 3F9HA 5FX5A 4B73A 4LXBH 4MQAA 2ZFFH 1UK3A 2QXJA 3RC4A 1QBOA 2SNWA 1Z6EA 4XBCA 3QZRA 1O30A 4ZXYH 1DPOA 1DE7H 1EPTC 3A88A 1UTJA 3Q76A 3S7HB 3QDZB 2BD3A 3LGIA 1FAKH 1O36A 2FXRA 4ZKSU 2WYJA 4X1SU 8LPRA 1HGTH 2PW8H 3QTVH 4BXSA 4WXVA 1UVOA 3SJKA 1EASA 3MU0A 1QQ4A 2F9PA 1PPZA 2ULLA 1NU9A 5L6NH 1K1NA
chains in the Genus database with same CATH superfamily
1O2NA 1TONA 1UW7A 8GCHF 4OS4A 2FOHA 1UHBA 5EIYA 4INHA 1EAWA 1EXFA 1GBHA 4AX9H 4CR5A 1V2TT 2QIQA 2TPIZ 3IG6B 5TCAA 3RXHA 2F9VA 1QA0A 1K1JA 3D62A 2YMSC 5FAHA 5K7RA 3ZYDA 5LPFA 1XMNB 4GCHF 2QXIA 4XOJA 1O5BB 3SV7A 3SV6A 2VVVA 3KN2A 1C5PA 5SGAE 2ZTZA 4JYVH 3ZZ8A 3ZVDA 1MH0A 4D9RA 1VITH 1PPHE 1GJ9B 1EFRD 3QLPH 1HXEH 3BG4C 4UONA 2EC9H 3ZZDA 1TGTA 3ZV8A 1QJ6B 1SGQE 1SSXA 2QGRA 2STBE 2ZECA 1Y5BT 4B2BA 1BTUA 2AFQB 5C2ZA 2C4FH 2FM2A 1PPGE 2VVUA 2ODYB 1DLEA 3CS0A 1LTOA 2GV6A 4E06H 4XBDA 3ZZAA 3ZVBA 1V2LT 4A7IB 4BTTB 4FVDA 5HMAA 1RGQA 2OC8A 4X2VA 1GMCG 3RXFA 3E16B 1UCYH 1GGDB 3GDUA 1MTUA 1KLJH 1O2SA 3ENSB 3SU0A 4ZUHA 1XUGA 1VR1H 4ABJA 2ZFPH 4CH2B 2ANWA 1H4WA 3PRDA 1AVGH 1A4WH 1ACBE 1J17T 5T3HA 1G2LA 2O8WA 3I78A 4NIVA 2AH4X 3FZZA 5A0CA 1P2JA 2ZF0H 3TPIZ 1GI7B 2QV1A 4JYTA 1PJPA 5JYIA 4NCYA 4Q7ZA 4KTSA 2BB4A 1V2WT 3MFJA 1K1MA 2W5EA 2ZDLA 4KKDA 4IGDA 1GVZA 1Z6JH 2BY8X 1DWCH 1D4PB 3NUMA 2SNVA 3T2NA 2SGFE 3LC5A 3I77A 4CRFA 5EJZA 3BTWE 5AFYH 2CJIA 1HJ8A 3GY7A 5AVDA 4I32A 2WSSD 2GP9B 2QYIA 3LGTA 2FWWA 1E79D 1SFQB 1FPCH 4ISOA 2UWOA 1LHCH 1F0TA 1T7CA 3JZ2B 3S9BA 2BD8A 4TYDA 4AFQA 1NM6A 1SKYE 3MNCA 3BSQA 1QFKH 1KYNA 1EOLA 3RXJA 1ELGA 3VEQB 5DO4H 3MHWU 1OWEA 4ISHH 4ABHA 2BY9X 1XUKA 2BZAA 1OXGA 1T4VH 1GBDA 4CRGA 1WDIA 4OS7A 8ESTE 4X6OA 1C9TA 1LO6A 2F9OA 2VIQA 3TJOA 1SGRE 1LHGH 2G5VA 1SGFG 5GXPA 1ESAA 1GMDG 4ZCNA 2ZO3H 1BCUH 2QY0B 3KQCA 1YC0A 4NSYA 2RDEA 3CENA 2NU4E 1TGBA 4BAOB 1UTNA 2TGTA 3SNAA 4FUGA 4SGAE 1TBQH 1LDTT 3QGNB 1GBBA 4TY7A 1FPHH 3V0XA 1VJ9U 2P95A 1NESE 4GPGA 1E37B 1DY8A 1K9OE 4WVPE 1ZTJA 1GI9B 5FPSA 1S82A 1AKSB 1ELTA 1TABE 5IK2D 4Y79A 2OUAA 1HNEE 4NSVA 4H4FA 3M5LA 3HK6B 1OOKB 3BTME 1UVPA 3QUMP 3MMGA 2O9QA 2FOFA 2R2WU 2ZHWH 2PHBA 1OSSA 1CGJE 4O3UA 3NK8A 2BD9A 1OX1A 3ESTA 1BTXA 4WJG2 3SI4H 1P2MA 1HAOH 3EYDA 3AASA 2F43B 3ITIA 2HALA 5GWZA 4D7FA 3PLKA 3SYJA 4CHAB 4ZKRU 1QR3E 4AFUA 4RI0A 1C2EA 3QGJA 1ZGIA 1E34B 2ZFRH 3GY4A 3ODDA 4FETA 2FODA 2ZIQH 3MOCA 4BOHA 1EJAA 2CXVA 2BOKA 1AUTC 4O3TA 1AGJA 1G2MA 3SU4A 3VB3A 2UUJB 1ZPZA 2BOHB 1BITA 2H2ZA 5GIBA 4I33A 3SJOA 1BT7A 3I29A 6CHAC 2A7HA 2V0BA 1G36A 5E0GA 1C5TA 2HGTH 1SB1H 2XC4A 4XE4A 2GJGA 3RU4T 2C3SA 5HM9A 1IQKA 3SBKA 4DIHH 3P6ZB 1J16A 2P59A 1O3HA 3VB6A 4GHQA 5J4SA 5TJXA 1V2QT 1GI1A 3ZVEA 4CH8B 1QA7A 3GISB 3GCHC 4UE7H 2EI6A 2EI7A 4TY6A 2ILNA 3A7XA 4DG4A 1OHHD 1DSTA 4FU7A 2K1QA 2ZKSA 2Q6DA 1T8NA 3UWJH 3FP7E 1Q31A 2W7SA 1SL3A 1DOJA 1GBEA 3GDSA 2BHGA 4DJZB 1CHGA 2J98A 2PFEA 1NN6A 2PV9B 3U8OH 1A5GH 4FUEA 1TRNA 3RU4D 3PB1E 2Q6GA 4A92A 1KIGH 1JRSA 2D8WA 1NC6A 2RFKC 1ZRBA 2GD4B 2Z3EA 5FHTA 1GDQA 2P3TB 3SHCH 3PV4A 3UAIC 2V35A 1GBLA 4AC9A 3SU1A 2ZNKH 2HPQH 2FX6A 2JDID 1AE8H 4RT0A 1OP8A 4ABGA 4OM9A 4K3JA 2W26A 3RXKA 1BMLA 2BLQA 2KAIA 3QK1A 2WPLS 8GCHG 3M3SA 4MPWA 3N7EA 1FNIA 1W2KH 1OP0A 2P3FH 3FFGA 3PMHB 5FX6A 1MTNB 1TNHA 1ANEA 2VWMA 4OGYA 1AZZA 1CU1A 2ZU5A 4MDSA 3TNSA 1L0ZA 2J38A 1CT0E 2XC5A 1TPPA 1ORFA 3UR6A 4ISNA 2OTVA 1C5ZB 3TGIE 2ZCHP 3NPSA 7GCHG 4H6SB 4D8NA 2B7DH 1DM4B 3T28A 1MBMA 4Z0KA 4CRAA 1IQFA 1RJXB 4GUXA 1GJCB 2QF0A 4JZFH 1C9PA 2A7CA 2BDGA 1MTSA 5DSFA 2JH5D 1NFWA 3VGCB 1GL1A 1NFYA 4X1PU 4NIXA 1EATA 2GTBA 5EPNA 3UQVA 1MAYA 1GCTC 1OWDA 3U8RH 1KDQA 2A31A 4ABFA 5CMXH 7LPRA 3KL6A 2STAE 5EODA 3A8CA 1V6DA 4IC5A 1PPEE 5L6NH 3KGPA 1BTYA 1PYTD 2G5NA 2R2MB 1HDTH 2AERH 1B7XB 1QRWA 4UFDH 1QHRB 1AO5A 4CHAC 6GCHF 1ABIH 1Y3XA 2ZEBA 1ZMNA 1UK4A 1YKTA 4Y6DA 3W95A 5I46H 1LPKB 4YTAA 4TWWA 1NZQH 3SNCA 2V6NA 1GHXH 1O2RA 1MAXA 4X6PA 1BMNH 1DITH 3URDA 3LDXH 1KTSB 1UVTH 1ELDE 1KXBA 1A3EH 4E7NA 1WV7H 1TNIA 1YGCH 3BG8A 5EPYA 1MCTA 3CNRA 2A1DB 1QY6A 2NWNA 3U28C 2G8TA 1DICA 3RMMH 2ZGCA 1D6RA 1KLTA 2CHAB 4HG6A 3NZIA 1XVOA 4ZROA 1ZGVA 3PYHA 2IPQX 1O3GA 1J14A 3TJVA 4CRDA 1RIWB 1DUEA 1WCZA 3GICB 1A0HB 2GX4A 2HNTE 3F3BA 3RXUA 3U8TH 3TK5A 2ZDAH 3OTJE 5AHGH 1AUJA 1C1VH 2KCPA 1TNLA 5E0HA 2AHME 1SGIB 5F8TA 3KQ5A 4Y10E 2BTCE 4HTCH 3MO3A 5EQSA 3RXOA 1Q3XA 1Y5UT 1EP6A 3A8AA 1HAVB 3A81A 4AN7A 4B74A 1P04A 4TSFD 1BTWA 9ESTA 1AFQB 3QX5H 4AOQA 1E35B 2C8XB 1JRTA 3PMBB 3HATH 3ZZ3A 1BHXF 3UNQA 4IMZA 1NRSH 1TX6A 2XBWA 1UTQA 1FXYA 1QQUA 1ZR0A 2P16A 1P02A 2D26C 1FI8A 1NRQH 1ANCA 3RP2A 3LPRA 2BXTH 1Z1IA 1UMAH 1O2PA 1ZMJA 2BMGB 1O0DH 1IHTH 3AAVA 3ATIA 1XUHA 1P2OA 1TMBH 1MKXH 1ETTH 2BLOA 2J9NA 3UFAA 1MU8B 4ZKOU 2I6SA 3MO9A 2VH0A 1SHHB 2XBXA 3NWUA 3E0NB 4D76A 2HLDD 1DVAH 4E7RG 1CBWC 4WMDA 2V3HH 1Y3UA 6CHAB 1HYLA 5A2MH 3B8JA 3ZZ6A 1AE5A 3UNSA 1A0JA 2FIRH 4Q2KA 4NFFA 3M7TA 3DSGA 1WYKA 3FVFB 4KTCA 1AZ8A 3UPEA 1H9IE 1HXFH 2CF9H 4H42U 2GCTC 5EGMA 4VGCB 1TA6A 4HFPB 5FBIA 1TX7A 3MH7A 2Y5FA 1RS0A 1ESBA 1PQ8A 2B5TB 4M7GA 1BTPA 2TGPZ 5DK1A 2AGGX 1IHSH 2BQWB 5E8EH 2BDYA 3UTUH 5FPTA 1O2HA 1YLDA 5C0UA 5ESTE 2ZFQH 3Q3YA 1Z8RA 4F4OC 1HBTH 2NU3E 2YMSB 4U2WA 3ATLA 1YPJH 2QCYA 2XCNA 3ATMA 1O3IA 3LONA 8KME2 1AU8A 5T6DA 1FY4A 2LNCA 1D3QB 1G3DA 3RDZA 3UREA 2F91A 4BXWA 5DN6D 3EA8A 3STJA 2QF4A 2WHXA 1GG6C 2LP6A 1TB6H 2RCEA 2ZFTA 1AVXA 2VIOA 2JETB 5L30H 4MPVA 2KCAA 1UVSH 1WXRA 4K1SA 4UFGH 5B6OA 3HKIB 4XRNA 1NU7B 4Y0ZE 1C5NH 1QNJA 1EKBB 1TMUH 1MKXK 1GBAA 3T62A 7GCHF 1QIXB 1GVLA 2OQUA 2BQ7B 5DP6A 3MNBA 3B9FH 4F49A 2C8ZB 4GLYA 2ASUB 4MNVA 2OC1A 2B0FA 3AVZA 4B75A 1F2SE 5EW1H 1AY6H 1P11E 1QGFA 1BB0B 4MNWA 1FZZA 1GJ6A 4MTBA 1W7GH 1GI8B 2IOTA 4X8TH 2J92A 2A4OA 4Y11E 1GI2A 3F0PA 3M5MA 1WSSH 5DP8A 2OK5A 4B6FA 2TGDA 4Y7BA 1N8OB 1HAZB 1DANH 1XUFA 1V3XA 1KSNA 1N6YA 2GZ9A 1F0RA 1Y8TA 3STIA 5E2PA 3BTDE 2Y6TA 1LVMA 5JB8S 1SGNE 2THFB 1GHBG 3TK9A 4K69A 2A5KA 4A1XA 2OINA 4K1EA 4WY3A 2QXHA 3SO3A 1ELEE 3SNBA 2WPIS 3QN7A 1AB9C 2A4QA 1C1NA 2GDEH 4MLFB 1V2NT 2UWPA 3UQOA 1B5GH 1ZLRA 2ODPA 2G4UA 1CT4E 4P02A 3MU1A 1DFPA 5HYOA 3K6ZA 2BD2A 2R9PA 3SU3A 2XYAA 4BANB 1T32A 1SQRA 1TX8A 3BV9B 4I86A 1TGNA 3LGVA 3OFND 2GMTC 3VXFH 4ASUD 1FY8E 3EA7A 4NWLA 1SGEE 5EXMA 3MU4A 2WPDD 1CBWB 1P2IA 1O3NA 2VH6A 2GZ8A 3RM0H 1V2PT 2OD3B 3F2HA 4AGKA 2WPJS 3PRBA 2OP9A 2TBSA 1FQ3A 1W8BH 1QJ1B 1G3EA 3K65B 4JK5A 2GGVB 5TCCA 3MH5A 5LGOA 3BTHE 3F2FA 1GI0A 1S5SA 2G00A 2W6JD 2SGDE 2PWXA 2Z94A 1VCQA 2ZPSA 4FU8A 4Y8YA 1WBGB 1O3JA 3FOAA 5DJ7A 2Q6FA 2WV5A 3D49H 3E91A 2J5UA 1VCPA 4YOIA 4ACBA 1MZDA 1QL7A 3RMLH 1MU6B 2W3IA 1FV9A 5F53A 1S81A 3UWIA 2PSYA 1QRXA 4CRCA 2CMYA 4HZHA 1O2QA 1TE0A 1GHWH 1PPCE 4BNRA 4J1YA 2ZDKA 1TYNA 2GCHF 1B0FA 1TPOA 3BTFE 2BY5X 2H5DA 1O2XA 5GCHG 1LVBA 3AW1A 1PYTC 2HNTF 1QJ7B 2BVXH 1QL8A 3SUGA 2WPKS 1GMCF 1HJ9A 1O2ZA 3SQHE 2VB0A 3MYWA 2FOEA 2F3CE 3E0PB 1GBIA 4I8HA 2WV9A 1L2EA 2FOCA 3M37A 1FIZA 4PROA 1EQ9A 5EOKA 1IOEA 2KCOA 3A7YA 1WQSA 4X1RU 1MABB 2Z7FE 1BOQA 1P3EA 4ACAA 5C1UA 4A6LA 1ELCA 3SGQE 1EJMA 3MH4A 4ZXXH 3SUEA 3KQBA 2FI5E 3F2GA 3GY5A 5DGJA 1ABJH 2RG3A 3E3TA 1YCPK 4FUFA 3RXIA 1UTOA 3SV9A 4CRBA 5C67A 4UEHH 1NRRH 1D3PB 2PTNA 3BN9A 1DXPA 1EAUA 3EDXB 5FBEA 1O3MA 3L33A 1H8IH 3SI3H 4JZIA 3SUFA 3UOPA 4RN6A 1SLVB 2Y7ZA 4XFQA 1HAVA 1A5HA 1SFIA 2BYAX 1TGSZ 2IJD1 2O8UA 5JPMH 2EEKA 1AWHB 1ESTA 4DT4A 1PQ7A 1C1OA 1H9HE 1YCPM 2QF3A 2C90B 2GCHG 3HPTB 3GYLB 1ELVA 1BRAA 5A09A 3SNDA 9LPRA 1ZZZA 1WTHD 1GMHG 3F1SB 1ZYOA 1DSUA 1C2MA 1ARCA 1GCTB 1TIOA 1TRYA 4AFZA 4MG3A 1EZXC 3GY8A 2FI4E 1SQTA 1L4ZA 1N6XA 1P06A 3JZ1B 1P12E 2KAIB 1KXAA 4UDWH 1T8LA 4I8JA 1C1UH 2BY6X 3TGKE 1G3CA 3SN8A 1FY1A 1DDJA 1O3DA 3BIUH 1VCWA 1YPLH 1O3PB 1IQEA 4DVAU 2FOBA 2WUCA 2OLGA 3V12A 3RXGA 1B0EA 1A7SA 1GDUA 1GG6B 2F9UA 2QXGA 3GY3A 3ZVFA 4DW2U 1C4Y2 1GBJA 1GBTA 1TA2A 2FESH 3DD2H 2Q1JA 2W3KA 1WUNH 2TGAA 1KXEA 5B6LA 4JZDH 2J94A 1ELAA 3V7TA 1V2JT 1P2KA 3IITA 4A5TS 3M3TA 4Q63A 3SGAE 1UTMA 3MO6A 2CN0H 1HUTH 1FMGA 1GJ5H 1WQVH 3N99A 2SFAA 1QB6A 4X6MA 1BTHH 3PMAB 1INCA 2H9HA 3P8NA 1TALA 1VZQH 2L74A 1W13U 4GSOA 4B2CA 3EGKH 3GCTG 2BLWA 2Y81A 3RMNH 4FUHA 4CBOA 5I25A 4X8SH 3T27A 1WAYB 3LGUA 3MNXA 3U98H 2FEQH 2JH6D 1NBMD 2BVSH 1NRPH 4SGBE 2SGQE 1AB9B 2BQ6B 5F6MA 3LU9B 1DY9A 3RC6A 1O2TA 3ZZCA 2ESTE 1VKYA 1BA8B 1NY22 1IQHA 1VITF 7ESTE 1JWTA 1C4V2 5PTPA 3SJ9A 2BD4A 4Y76A 1P8VC 3T25A 1S85A 1SR5C 5JBCS 3P92A 5GDSH 3EQ0H 1K0HA 1EPTB 1E0FD 1GJ4H 2BZ6H 3F6UH 3KYFA 6ESTA 4KELA 3SOSA 2H5CA 4ABIA 2XCFA 2A5AA 1MQ5A 1S6HA 1RTFB 1O3EA 1RTKA 2FS9A 1YBWA 1AMHA 1EB1H 2GDDA 3M36A 1DWDH 3P17H 3KEEA 3SUDA 3SV2H 5A8ZA 2F9BH 2ZDMA 1E1QD 3H7OA 2GV7A 1G32B 2WINI 5IYTA 3KF2A 1C2FA 2BM2A 3F9EA 1NFUA 4YM9A 1YCPH 2A45B 2BXUH 1MTVA 2H6MA 1ZHMA 5DKMA 1A2CH 5EXLA 3TH4H 1UTKA 4UFFH 4AG1A 4XSKU 1BBRH 3MI4A 3FAOA 3UB0A 1DUAA 3ODFA 4NA8A 5T1VA 2A0QB 4A1TA 2CV3A 3TH2H 3PWBA 2A5IA 2FOMB 1FLEE 3R0FA 4X2WA 1YLCA 2P8OC 3OEED 2BD5A 2FTMA 3TIUA 1C1TA 2GT8A 4Y7AA 1J8AA 1NO9H 2Y5GA 5EXNA 4K8YA 3P8FA 4AORA 3K2UA 4FUDA 1GMHF 2NU2E 1A5IA 2BDIA 3FP8E 1MD7A 2F83A 1JXPA 2PKSC 2C8YB 3GCOA 3RMOH 1GBKA 1YPMH 5L2ZH 1DLKB 1TWXB 1O33A 1RXPA 4OS5A 2BDAA 5DP5A 3KNXA 1AFEH 2EI8A 2ANYA 4X1QU 3V13A 1LPGB 1RFNA 1CHOG 1DWEH 1BMMH 1HPGA 3P8GA 2ZDNA 1BRCE 1GHVH 4IMQA 1YPEH 4MPXA 2SGEE 4IC6A 1MTNC 1C5XB 5GJ4B 3RXCA 1UTPA 2G51A 5CDFE 5LPRA 1J9CH 4U30A 2K8IA 2QC2A 3OYPA 1MKWK 4LOYH 1DWBH 1JMOH 2F4LA 1GJBB 2VBCA 4NIYA 4KP0A 4X1NU 5IDKA 1GI6A 3GYMA 4YLUA 5HXFA 1UHBB 5HGGA 3O8RA 3BTGE 3K9XB 4DGJA 2GT7A 2ZP0H 1RRKA 1LHDH 3LT3A 1GI5A 3RXSA 3RXVA 2XWAA 2WUBA 4WF8A 4YLQH 2ZPRA 2NU1E 1EZUC 3Q3XA 3M35A 2FI3E 4AYYB 2XWBI 1SG8B 2M5TA 1KY9A 4X8VH 2KZ4A 2VNTA 1GL0E 1GBFA 4IN2A 2YOLA 3ATKA 4FVBA 5C5NA 4ASHA 3A7VA 4FU9A 2D1JA 4Z6AH 2A2QH 2ZPQA 3A8DA 1UVUH 1TBZH 3C27B 1EJNA 2PTCE 1C5MD 3A85A 3ZVCA 1O39A 1FJSA 2OC0A 4ISIH 3SU2A 3WWFA 5A8YA 1P09A 1A0LA 1HRTH 2V3OH 1W12U 1C5LH 1GGDC 1A46H 1VGCC 1ANDA 2J97A 3LOXA 3UNRA 1ZJDA 4ZH8A 3FANA 1Z8IB 1S0QA 4YT6H 3OAAD 3AW0A 4A1VA 3IWMA 2B9LA 2FP7B 4MNXA 1TOCB 3AK5A 1F0UA 1BMFD 1P9UA 1Q2WA 1YY3A 2XTTB 4ZHLU 1QBVH 3SORA 3FZDA 1SGDE 4YESB 2EQNA 1NS3A 2OBQA 3QZQA 1HAYB 1VGCB 4Q7YA 3P8OA 3F9FA 1T31A 1KDQB 1V2OT 3OY5U 3WY8A 2XNIA 3UR9A 3BF6H 1GBCA 1V2RT 2PKAA 2ALPA 3OY6U 1C5OH 4YO9A 4JCNA 1QURH 2D2DA 1P2NA 1OPHB 4BAQB 1GCDA 1ZPCA 3DCLA 1AKSA 3KHVA 4IS5A 5AFZH 2P93A 1C5WB 2C93B 2EA3A 2QAAA 1ZRKA 3L3TA 2J2UA 3DSPA 4WMFA 5DP9A 1H1BA 2Y7XA 2QA9E 2G52A 4B1TA 5HM2A 1GJ7B 2ZDVH 1YPGH 2GZ7A 3DA9B 1KXFA 4O97A 3OU0A 1C2DA 1LHFH 2QF5A 2ZFSA 3MWIU 1CHOF 3Q3KA 1IQLA 4RKOB 4HGCA 4FXGH 2VIDA 1MMJN 2JKHA 4D7GA 2P8OB 1IQGA 1P9SA 2HVYB 1W10U 5L2YH 1CGHA 2ZU3A 3ZZBA 1XXDA 1D6WA 1YWUA 3F68H 1L1JA 3DUXH 1C1RA 3OEHD 4F55A 3BEIB 1OKXA 4KTUA 2VJ1A 2O8MA 4R0IA 1GDNA 2BX4A 1UTLM 2FMJA 2KR7A 3PTBA 4KGAA 1SQAA 5C3NA 4OGXA 1L1NA 4GCHG 1XX9A 1BQYA 2A2XH 2ZQ1A 2Z9GA 1C2HA 3W94A 3NXPA 1KXCA 1OYQA 1LQDB 1NBME 1E1RD 2TIOA 4FOUC 2XNDD 4Q7XA 4ABDA 2ALVA 4WWYA 1NRNH 5F03A 2R3UA 1X7AC 2LELA 3A82A 3SJIA 2JETC 1AIXH 3CP7A 4NWKA 5GPIB 4YT7H 1TPAE 3Q77A 3RM2H 1D9IA 1C1PA 1V2VT 3O8BA 4Q4LA 1HFDA 1V2ST 1G30B 4MVNA 2FLBH 2XBVA 5DP4A 2W7UA 3O8DA 1W0KD 1C1SA 1C2KA 1T4UH 1XM1A 2OCVB 5LPEA 1O2KA 2XRCA 3LGYA 1ZJKA 3QWCH 1H8DH 1K2I1 4K8BA 4Q80A 4DURA 3GY2A 3O8CA 1MCVA 4BAKB 2DE8A 3BTEE 4NGAH 4B76A 1O5CB 1CE5A 4OS6A 1G3BA 2FYQA 3ELAH 3T29A 1JIRA 3D65E 3A87A 2JIZD 1CSOE 1GHBF 2HNTC 1OP2A 3F9GA 5H4IB 1Y3VA 3SGBE 5J4QA 1SLWB 2YNAA 3UY9A 3B23B 1NT1A 1TOMH 1C1WH 2CGAA 1O3CA 1K22H 1VITG 1S6LA 5JBTA 4X8UH 1KXDA 4ABAA 4JZ1A 4ZHAA 1RIWC 1O34A 1K1IA 5K0HA 1ZMLA 3S0NA 1FUJA 4Z1MD 2PSXA 1O31A 5JB9S 1QRZA 3N7DA 4UD9H 2Y5HA 3BTQE 1NFXA 2QE7D 2R0LA 2HLCA 1O2WA 5EG4A 5FL7D 2Z9KA 1ZTKA 3SHAH 4H6TA 4DY7B 4P00A 4NZQA 3VGCC 2VU8E 4I8KA 2ZCKP 1HV7A 1BJVA 3PROA 1A61H 2FLRH 2JJ1D 4TPYA 2ZQ2A 3RXPA 4DT7B 4INKA 1GWAA 1TNKA 4I8GA 1ZSLA 1AN1E 1A3BH 3M61U 3GY6A 5DP7A 4JK6A 5KECA 1BBRE 3U1JB 3E1XB 3PWCA 2IJOB 2ZGHA 3T26A 2Z6BD 2DUCA 1SMFE 1O3AA 1O2MA 3E8LA 3U1IB 3RXDA 3S7KB 6GCHG 2IN2A 3MU8A 3TJNA 4E05H 1F5RA 2CF8H 5T6GA 2ZHDA 2BD7A 2V7QD 3WW7A 1BIOA 1QTFA 1YP9A 1P3CA 3L6PA 3TH3H 2ANMH 1GI3A 5FXLA 5KEDA 2PGQB 5ETXA 3M7QA 2KCYA 3TK6A 1FDPA 1K1PA 3A7WA 1P57B 1AWFH 2A4RA 1JBUH 1ANBA 1ARBA 2AGIX 1QL9A 1THPB 2H9TH 5FCRA 4LZ1H 3TU7H 2K0QA 1BBRK 1HAIH 4ABEA 1JOUB 1SGTA 3KCGH 1GJDB 4FUBA 4I8LA 3A8BA 2FPZA 1GMDF 2H1UA 4K5ZA 4CBNA 4AFSA 2PKSB 2VIWA 1IAUA 3UOUA 3DFLA 2OC7A 1FN8A 2Z9JA 4WXIA 1TGCA 2IPHA 1TRMA 5C5OA 1O3KA 1YF4A 5C20A 2VWLA 1ID5H 1EAIA 1P03A 2AMQA 1DX5M 4OS2A 1WU1A 1S0RA 1TLDA 2ZC9H 1A1RA 2SGAA 2AYWA 1C4U2 1T8MA 1K1NA 1YYY1 1W3CA 2B8OH 5CE1A 4XDEA 5ESBA 4GHTA 2EY4C 3N7OA 3W1EA 1TMTH 1U6QA 5HIYA 1QB1A 1C2GA 4DIIH 1H8ED 4NFEA 1HCGA 1ZHRA 1O2OA 4TT3D 3ZVAA 1Z71A 1GHZA 3BTKE 2AS9A 2XBYA 2ZG0H 4QT8C 1O2YA 3ZYEA 1ETRH 1HLTH 2ZA5A 2ZU2A 1EZSC 1BMAA 3T5FH 3A86A 3RXMA 1O38A 1FY5A 2ZU4A 2CK3D 1G37A 5EJ1A 2I6QA 5KGOA 2KFWA 5C94A 1JIMA 3H09A 4F48B 3VXEH 1UO6A 4FUJA 3U69H 2PLXA 2RDLA 2ZWLH 1L4DA 1C5SA 2PUXB 3QO6A 1MD8A 2J34A 2ZU1A 1LKBA 1ZOMA 3MU5A 3VPKA 4DCDA 1W0JD 3LKWA 1LKAA 3FKSD 1K28D 5C1XA 3A83A 3MQKC 2BY7X 4WMEA 1WTGH 2VVCA 4O9VA 1HJAC 2Z9IA 2A4GA 1O3FA 3MH6A 1C5VA 4X6NA 4YZUA 4IBLH 1GHAF 1QZ8A 1CGIE 1MUEB 1BRUP 3GS9A 1QBNA 1ZSJA 1GPZA 1SOZA 2OXSA 2ZTXA 4ZAEA 3TGJE 1IQJA 2FYRA 2UUYA 3UIRA 1BZXE 3HGNA 5HKKD 3OX7U 1SGPE 3LGWA 4M9FA 4WH6A 1E38B 1PQAA 2Z9LA 3VB7A 3BG4B 1O3BA 3PO1C 1HB0B 1UK2A 1O2LA 5C1YA 1G9IE 2ZHEH 1DS2E 5EU8A 1Z8GA 1P01A 1XKBC 2AGEX 2O8LA 3NRLA 4RT1A 5GNDA 4FUIA 2VIPA 3RXBA 1N8OC 1O5AB 1N1LA 2C8WB 3NKKA 1C5RA 2ZI2H 1ETSH 2UUKB 1THSH 4NA9H 1PPFE 2RA0A 1C1QA 3OTPA 3M3VA 3SW2B 1OYTH 1C5QA 1BRBE 1FIWA 3FN8A 2L6OA 5G4BA 1DXWA 2J95A 3S9AA 1LHEH 1O2UA 1J15A 2O8TA 3KIDU 1ELBA 2WZQA 4VGCC 1O3OA 1H9LB 3A7ZA 2PUQH 2R3YA 1K1LA 2NU0E 4O03A 1O2GH 1DT2A 1SGFA 2WV4A 1D3DB 1TQ0B 4BTIB 5FCKA 2VWOA 2G55A 2PR3A 1P05A 3HGPA 1MTWA 1PPBH 1HJAB 1OWKA 3SJ8A 3H5CB 1SHYA 2ZTYA 4TWYA 2GMTB 1GHYH 3RXQA 3RXRA 1OS8A 1QCPA 2HRVA 3PTNA 2ZGJA 1C5YB 1O2IA 3EA9A 4D9QA 1OWHA 4ZHMU 1C2JA 1TNJA 2AMDA 2W6ID 1NTPA 1LVOA 2H9EH 4NA7A 2BVRH 4ABBA 3LC3A 3SU5A 5JBAS 3SV8A 1LCYA 5A0BA 4GVUA 1FONA 4XD7D 3RXEA 1F5LA 1CA0C 1YPHC 1W0ZU 1Z8JB 1XVMA 2VINA 1W7XH 2WYGA 1KLIH 4B6EA 2OQ5A 3PO1B 1FN6A 3EE0B 1AI8H 2ODQA 3DFJA 4JYUH 1CA0B 3Q00A 1O5FH 1ZHPA 5A8XA 3RUOA 1GHAG 3R3GB 5EJLA 2F9NA 1FX0B 3GCNA 2R0KA 4AB8A 3S9CA 5JBBS 3HKJB 1GJ8B 3WWBA 3M5NA 4WH8A 1O5DH 1SLUB 1EOJA 2FTLE 2CHAC 5E2OA 2HVXA 1BTZA 2FX4A 1PQ5A 5F8ZA 3S69A 1O37A 2FZZA 3KQEA 4YXWD 4GAWA 1O5GH 1E36B 3A80A 6LPRA 1IQMA 2AIPA 4Y8XA 3GCHB 5ABWA 1CQQA 3AAUA 2FOGA 5LH8A 3ZIAD 1WOFA 1O2JA 3H7TA 4JZEH 4X2YA 1SVPA 1BUIA 1KTTB 5CHAB 1XUJA 1S6FA 2ZHFH 1EP5A 3E90B 3QTOH 1TAWA 4NZLA 3TITA 3BTTE 3A84A 2BDHA 2J4IA 4NG9H 3SQEE 2ZZUH 1H8HD 3GCTF 1BHXB 3DHKH 1TBRH 1VJAU 4MNYA 1O2VA 3PV5A 4B2AA 3M5OA 1XKAC 2ZCLP 4ZMAH 2VWNA 2BDBA 1HAHH 1RTLA 2G81E 2FDAA 2J98B 4TPIZ 1IQNA 2Z3CA 4YOGA 2AIQA 1O32A 2QN5T 2LPRA 2M2AA 1UCYE 2A7JA 1M9UA 5JDUB 1GBMA 1EX3A 1ZSKA 3MNSA 4BAMB 4OS1A 3GOVB 1GI4A 2P3UB 5HIZA 3RLYH 1ZTLA 4B71A 2WPMS 4INLA 2VGCB 1OWJA 1SI5H 3ZV9A 3G01A 3P95A 1GVKB 4CR9A 1D3TB 4IN1A 4K2YA 4XBBA 4HI3A 2OBOA 5AF9H 1COWD 1L1GA 4YOJA 3VG8A 2UWLA 3ZZ9A 1EPTA 1THRH 2FO9A 1HIAA 5DPAA 1C2IA 3V3MA 5DP3A 4BTUB 2JH0D 4X2XA 2YNBA 1EUFA 2YMSD 4DOQA 1LMWB 5EQQA 3ATWA 4LK4A 1P2QA 1LQEA 2JJ2D 3FP6E 1HAXB 1SLXB 1TNGA 1UCYK 4CREA 3CS7A 1SGYE 2TRMA 3BIVH 2DE9A 2Y82A 5CHAC 3FO8D 1K1OA 3TJUA 2ZGXH 4U32A 1ZPBA 3LJOA 1S83A 3RXTA 3KQDA 1LVYA 1Y5AT 1HIAB 2XW9A 1NROH 4BAHB 2Y80A 4I7YH 4X0WU 1Z7KA 1O35A 3SZEA 1AVWA 1FAXA 4MPUA 1HAPH 2GKVE 1CO7E 1K21H 1V2UT 3BEFB 3RC5A 2AMPA 1YM0A 1P10A 5BPEA 4RKJB 1O3LA 4ESTE 1CA8B 3RXLA 1AFQC 1SPJA 1F0SA 5CHBA 5FPYA 3RU4E 3VB4A 7KMEH 1V2MT 3GDVA 3PM3A 3PMJA 2A32A 2V3MA 4NIWA 2VGCC 2P94A 3EE7A 3KYGA 3LH1A 1TPSA 1BDAA 1O5EH 1SOTA 1F92A 3VFEA 2BLVA 2VIVA 5EW2H 4THNH 1OWIA 3SNEA 2XXLA 5E0JA 1QB9A 1AQ7A 3LIWA 4K1TA 4IW4E 3PLBA 1V2KT 3K6YA 4I31A 2XC0A 1TQ7B 1PFXC 1SGCA 3VB5A 1LPZB 2WPHS 1RD3B 2XOKD 1GJAB 2AEIH 3TVJB 3LH3A 5C0TA 3TNTA 3A89A 3A7TA 2BX3A 5BRRE 1EB2A 3NCLA 2FS8A 1CT2E 1EAXA 1SC8U 1SQOA 4JMYA 3LJJA 2ZGBH 1XXFA 3M7UA 1NPMA 2PKAB 4RSPA 1HAGE 3PLPA 4Y0YE 5DG6A 4K60A 1S84A 3SZNA 1F5KU 1AD8H 1BJUA 1KMHB 4Y71A 3RXAA 1P0SH 3ZZ7A 2HOBA 4R8TB 1TFXA 1UJ1A 1MKWH 4ZKNU 3EAJA 1W14U 3ZVGA 2HPPH 2ANKH 1Z1JA 5F8XA 3UUZA 1AHTH 4AGJA 3SU6A 3PV2A 4Y8ZA 1C1MA 1XUIA 5A0AE 3P70B 1C2LA 2KX4A 3C1KA 4AB9A 1MQ6A 5T6FA 2RA3A 3F0OA 2UUFB 4UFEH 3TLOA 2GVFA 4AYVB 3ZZ4A 3RLWH 1CVWH 1YPHE 3URCA 3D23A 2Z3DA 4U01A 3HK3B 1Y59T 1C5UA 4FUCA 5EQRA 3MTYA 2SGPE 1F7ZA 1IQIA 1W11U 2G4TA 2GCTB 2ZHQH 1FY3A 1SBWA 2PGBB 5GCHF 4LZ4B 1ELFA 3OSYA 1EZQA 1T8OA 1Y3WA 3BEUA 3DT0H 4ISLA 4J2YB 4AG2A 2BDCA 1W0YH 1Y3YA 1MBQA 1MZAA 1YPKH 3U9AH 3ZZ5A 2HWLB 2FOAA 4AZ2B 3E6PH 3F9HA 5FX5A 4B73A 4LXBH 4MQAA 3OE7D 2ZFFH 1UK3A 2PP6A 2QXJA 3DSOA 3RC4A 1QBOA 2SNWA 1Z6EA 4XBCA 3QZRA 1O30A 4ZXYH 1DPOA 1DE7H 1EPTC 3A88A 1UTJA 3Q76A 3S7HB 3QDZB 2BD3A 3LGIA 1FAKH 1O36A 2FXRA 4ZKSU 2WYJA 4X1SU 8LPRA 1HGTH 2PW8H 3QTVH 4BXSA 4WXVA 1UVOA 3SJKA 1EASA 5C17A 3MU0A 1QQ4A 2F9PA 1PPZA 2ULLA 1NU9A 1YLNA 2KM0A
chains in the Genus database with same CATH topology
1O2NA 1TONA 8GCHF 4OS4A 2FOHA 1UHBA 4INHA 1EAWA 1EXFA 1GBHA 4AX9H 4CR5A 1V2TT 2QIQA 2TPIZ 3IG6B 5TCAA 3RXHA 2F9VA 1QA0A 1K1JA 3D62A 5FAHA 5K7RA 3ZYDA 5LPFA 1XMNB 4GCHF 2QXIA 4XOJA 1O5BB 3SV7A 3SV6A 2VVVA 3KN2A 1C5PA 5SGAE 2ZTZA 4JYVH 3ZZ8A 3ZVDA 1MH0A 4D9RA 1VITH 1PPHE 1GJ9B 3QLPH 1HXEH 3BG4C 4UONA 2EC9H 3ZZDA 1TGTA 3ZV8A 1QJ6B 1SGQE 1SSXA 2QGRA 2STBE 2ZECA 1Y5BT 4B2BA 1BTUA 2AFQB 5C2ZA 2C4FH 2FM2A 1PPGE 2VVUA 2ODYB 1DLEA 3CS0A 1LTOA 2GV6A 4E06H 4XBDA 3ZZAA 3ZVBA 1V2LT 4A7IB 4BTTB 4FVDA 5HMAA 1RGQA 2OC8A 4X2VA 1GMCG 3RXFA 3E16B 1UCYH 1GGDB 3GDUA 1MTUA 1KLJH 1O2SA 3ENSB 3SU0A 4ZUHA 1XUGA 1VR1H 4ABJA 2ZFPH 4CH2B 2ANWA 1H4WA 1AVGH 1A4WH 1ACBE 1J17T 5T3HA 1G2LA 2O8WA 3I78A 4NIVA 2AH4X 3FZZA 5A0CA 1P2JA 2ZF0H 3TPIZ 1GI7B 2QV1A 4JYTA 1PJPA 5JYIA 4NCYA 4Q7ZA 4KTSA 2BB4A 1V2WT 3MFJA 1K1MA 2W5EA 2ZDLA 4KKDA 4IGDA 1GVZA 1Z6JH 2BY8X 1DWCH 1D4PB 3NUMA 2SNVA 3T2NA 2SGFE 3LC5A 3I77A 4CRFA 3BTWE 5AFYH 2CJIA 1HJ8A 3GY7A 5AVDA 4I32A 2GP9B 2QYIA 3LGTA 2FWWA 1SFQB 1FPCH 4ISOA 2UWOA 1LHCH 1F0TA 1T7CA 3JZ2B 3S9BA 2BD8A 4TYDA 4AFQA 1NM6A 3MNCA 3BSQA 1QFKH 1KYNA 1EOLA 3RXJA 1ELGA 3VEQB 5DO4H 3MHWU 1OWEA 4ISHH 4ABHA 2BY9X 1XUKA 2BZAA 1OXGA 1T4VH 1GBDA 4CRGA 4OS7A 8ESTE 4X6OA 1C9TA 1LO6A 2F9OA 2VIQA 3TJOA 1SGRE 1LHGH 2G5VA 1SGFG 5GXPA 1ESAA 1GMDG 2ZO3H 1BCUH 2QY0B 3KQCA 1YC0A 4NSYA 3CENA 2NU4E 1TGBA 4BAOB 1UTNA 2TGTA 3SNAA 4FUGA 4SGAE 1TBQH 1LDTT 3QGNB 1GBBA 4TY7A 1FPHH 3V0XA 1VJ9U 2P95A 1NESE 4GPGA 1E37B 1DY8A 1K9OE 4WVPE 1ZTJA 1GI9B 5FPSA 1S82A 1AKSB 1ELTA 1TABE 4Y79A 2OUAA 1HNEE 4NSVA 4H4FA 3M5LA 3HK6B 1OOKB 3BTME 1UVPA 3QUMP 3MMGA 2O9QA 2FOFA 2R2WU 2ZHWH 2PHBA 1OSSA 1CGJE 4O3UA 3NK8A 2BD9A 1OX1A 3ESTA 1BTXA 4WJG2 3SI4H 1P2MA 1HAOH 3EYDA 3AASA 3ITIA 2HALA 5GWZA 4D7FA 3PLKA 4CHAB 4ZKRU 1QR3E 4AFUA 1C2EA 3QGJA 1ZGIA 1E34B 2ZFRH 3GY4A 3ODDA 4BOHA 2FODA 2ZIQH 3MOCA 1EJAA 2CXVA 2BOKA 1AUTC 4O3TA 1AGJA 1G2MA 3SU4A 3VB3A 2UUJB 1ZPZA 2BOHB 1BITA 2H2ZA 5GIBA 4I33A 3SJOA 1BT7A 3I29A 6CHAC 2A7HA 2V0BA 1G36A 5E0GA 1C5TA 2HGTH 1SB1H 2XC4A 4XE4A 3RU4T 2C3SA 5HM9A 1IQKA 3SBKA 4DIHH 3P6ZB 1J16A 2P59A 1O3HA 3VB6A 4GHQA 5J4SA 5TJXA 1V2QT 1GI1A 3ZVEA 4CH8B 1QA7A 3GISB 3GCHC 4UE7H 2EI6A 2EI7A 4TY6A 2ILNA 3A7XA 4DG4A 1DSTA 4FU7A 2K1QA 2ZKSA 2Q6DA 1T8NA 3UWJH 3FP7E 1Q31A 2W7SA 1SL3A 1DOJA 1GBEA 3GDSA 2BHGA 4DJZB 1CHGA 2PFEA 1NN6A 2PV9B 3U8OH 1A5GH 4FUEA 1TRNA 3RU4D 3PB1E 2Q6GA 4A92A 1KIGH 1JRSA 2D8WA 1NC6A 1ZRBA 2GD4B 2Z3EA 5FHTA 1GDQA 2P3TB 3SHCH 3PV4A 2V35A 1GBLA 3SU1A 2ZNKH 2HPQH 2FX6A 1AE8H 1OP8A 4ABGA 4K3JA 2W26A 3RXKA 1BMLA 2BLQA 2KAIA 3QK1A 2WPLS 8GCHG 3M3SA 4MPWA 1FNIA 1W2KH 1OP0A 2P3FH 3FFGA 3PMHB 5FX6A 1MTNB 1TNHA 1ANEA 2VWMA 4OGYA 1AZZA 1CU1A 2ZU5A 4MDSA 3TNSA 1L0ZA 2J38A 1CT0E 2XC5A 1TPPA 1ORFA 3UR6A 4ISNA 2OTVA 1C5ZB 3TGIE 2ZCHP 3NPSA 7GCHG 4H6SB 4D8NA 2B7DH 1DM4B 3T28A 1MBMA 4Z0KA 4CRAA 1IQFA 1RJXB 4GUXA 1GJCB 2QF0A 4JZFH 1C9PA 2A7CA 2BDGA 1MTSA 2JH5D 1NFWA 3VGCB 1GL1A 1NFYA 4X1PU 4NIXA 1EATA 2GTBA 5EPNA 3UQVA 1MAYA 1GCTC 1OWDA 3U8RH 1KDQA 2A31A 4ABFA 5CMXH 7LPRA 3KL6A 2STAE 5EODA 3A8CA 1V6DA 4IC5A 1PPEE 3KGPA 1BTYA 1PYTD 2G5NA 2R2MB 1HDTH 2AERH 1B7XB 1QRWA 4UFDH 1QHRB 1AO5A 4CHAC 6GCHF 1ABIH 1Y3XA 2ZEBA 1ZMNA 1UK4A 1YKTA 4Y6DA 3W95A 5I46H 1LPKB 4YTAA 4TWWA 1NZQH 3SNCA 2V6NA 1GHXH 1O2RA 1MAXA 4X6PA 1BMNH 1DITH 3URDA 3LDXH 1KTSB 1UVTH 1ELDE 1KXBA 1A3EH 4E7NA 1WV7H 1TNIA 1YGCH 3BG8A 5EPYA 1MCTA 2A1DB 1QY6A 2NWNA 2G8TA 1DICA 3RMMH 2ZGCA 1D6RA 1KLTA 2CHAB 3NZIA 1XVOA 4ZROA 1ZGVA 3PYHA 1O3GA 1J14A 3TJVA 4CRDA 1RIWB 1DUEA 1WCZA 3GICB 1A0HB 2GX4A 2HNTE 3U8TH 3RXUA 3TK5A 2ZDAH 3OTJE 5AHGH 1AUJA 1C1VH 1TNLA 5E0HA 1SGIB 5F8TA 4Y10E 2BTCE 4HTCH 3MO3A 5EQSA 3RXOA 1Q3XA 1Y5UT 1EP6A 3A8AA 1HAVB 3A81A 4AN7A 4B74A 1P04A 1BTWA 9ESTA 1AFQB 3QX5H 4AOQA 1E35B 2C8XB 1JRTA 3PMBB 3HATH 3ZZ3A 1BHXF 3UNQA 4IMZA 1NRSH 1TX6A 2XBWA 1UTQA 1FXYA 1QQUA 1ZR0A 2P16A 1P02A 2D26C 1FI8A 1NRQH 1ANCA 3RP2A 3LPRA 2BXTH 1Z1IA 1UMAH 1O2PA 1ZMJA 2BMGB 1O0DH 1IHTH 3AAVA 3ATIA 1XUHA 1P2OA 1TMBH 1MKXH 1ETTH 2BLOA 2J9NA 3UFAA 1MU8B 4ZKOU 2I6SA 3MO9A 2VH0A 1SHHB 2XBXA 3NWUA 3E0NB 4D76A 1DVAH 4E7RG 1CBWC 4WMDA 2V3HH 1Y3UA 6CHAB 1HYLA 5A2MH 3B8JA 3ZZ6A 1AE5A 3UNSA 1A0JA 2FIRH 4Q2KA 4NFFA 3M7TA 1WYKA 3FVFB 4KTCA 1AZ8A 3UPEA 1H9IE 1HXFH 2CF9H 4H42U 2GCTC 5EGMA 4VGCB 1TA6A 4HFPB 5FBIA 1TX7A 3MH7A 2Y5FA 1RS0A 1ESBA 1PQ8A 2B5TB 4M7GA 1BTPA 2TGPZ 5DK1A 2AGGX 1IHSH 2BQWB 5E8EH 2BDYA 3UTUH 5FPTA 1O2HA 1YLDA 5ESTE 2ZFQH 3Q3YA 1Z8RA 4F4OC 1HBTH 2NU3E 4U2WA 3ATLA 1YPJH 2QCYA 2XCNA 3ATMA 1O3IA 3LONA 8KME2 1AU8A 5T6DA 1FY4A 2LNCA 1D3QB 1G3DA 3RDZA 3UREA 2F91A 4BXWA 3EA8A 3STJA 1GG6C 1TB6H 2RCEA 2ZFTA 1AVXA 2VIOA 2JETB 5L30H 4MPVA 1UVSH 4K1SA 4UFGH 5B6OA 3HKIB 1NU7B 4Y0ZE 1C5NH 1QNJA 1EKBB 1TMUH 1MKXK 1GBAA 3T62A 7GCHF 1QIXB 1GVLA 2OQUA 2BQ7B 5DP6A 3MNBA 3B9FH 4F49A 2C8ZB 4GLYA 2ASUB 4MNVA 2OC1A 2B0FA 3AVZA 4B75A 1F2SE 5EW1H 1AY6H 1P11E 1QGFA 1BB0B 4MNWA 1FZZA 1GJ6A 4MTBA 1W7GH 1GI8B 2IOTA 4X8TH 2J92A 2A4OA 4Y11E 1GI2A 3M5MA 1WSSH 5DP8A 2TGDA 4Y7BA 1N8OB 1HAZB 1DANH 1XUFA 1V3XA 1KSNA 1N6YA 2GZ9A 1F0RA 1Y8TA 3STIA 5E2PA 3BTDE 2Y6TA 1LVMA 5JB8S 1SGNE 2THFB 1GHBG 3TK9A 4K69A 2A5KA 4A1XA 2OINA 4K1EA 4WY3A 2QXHA 3SO3A 1ELEE 3SNBA 2WPIS 3QN7A 1AB9C 2A4QA 1C1NA 2GDEH 4MLFB 1V2NT 2UWPA 3UQOA 1B5GH 1ZLRA 2ODPA 2G4UA 1CT4E 3MU1A 1DFPA 5HYOA 3K6ZA 2BD2A 2R9PA 3SU3A 2XYAA 4BANB 1T32A 1TX8A 3BV9B 1TGNA 3LGVA 2GMTC 3VXFH 1FY8E 3EA7A 4NWLA 1SGEE 5EXMA 3MU4A 1CBWB 1P2IA 1O3NA 2VH6A 2GZ8A 3RM0H 1V2PT 2OD3B 4AGKA 2WPJS 2OP9A 2TBSA 1FQ3A 1W8BH 1QJ1B 1G3EA 3K65B 4JK5A 2GGVB 5TCCA 3MH5A 5LGOA 3BTHE 1GI0A 1S5SA 2G00A 2SGDE 2PWXA 2Z94A 1VCQA 2ZPSA 4FU8A 4Y8YA 1WBGB 1O3JA 5DJ7A 2Q6FA 2WV5A 3D49H 3E91A 4YOIA 1VCPA 1MZDA 1QL7A 3RMLH 1MU6B 2W3IA 1FV9A 1S81A 3UWIA 2PSYA 1QRXA 4CRCA 2CMYA 4HZHA 1O2QA 1TE0A 1GHWH 1PPCE 4BNRA 4J1YA 2ZDKA 1TYNA 2GCHF 1B0FA 1TPOA 3BTFE 2BY5X 2H5DA 1O2XA 5GCHG 1LVBA 3AW1A 1PYTC 2HNTF 1QJ7B 2BVXH 1QL8A 3SUGA 2WPKS 1GMCF 1HJ9A 1O2ZA 3SQHE 2VB0A 3MYWA 2FOEA 2F3CE 3E0PB 1GBIA 4I8HA 1L2EA 2FOCA 3M37A 1FIZA 4PROA 1EQ9A 5EOKA 1IOEA 3A7YA 1WQSA 4X1RU 2Z7FE 1BOQA 1P3EA 5C1UA 4A6LA 1ELCA 3SGQE 1EJMA 3MH4A 4ZXXH 3SUEA 3KQBA 2FI5E 3GY5A 5DGJA 1ABJH 2RG3A 3E3TA 1YCPK 4FUFA 3RXIA 1UTOA 3SV9A 4CRBA 5C67A 4UEHH 1NRRH 1D3PB 2PTNA 3BN9A 1DXPA 1EAUA 3EDXB 5FBEA 1O3MA 3L33A 1H8IH 3SI3H 4JZIA 3SUFA 3UOPA 4RN6A 1SLVB 2Y7ZA 4XFQA 1HAVA 1A5HA 1SFIA 2BYAX 1TGSZ 2O8UA 5JPMH 2EEKA 1AWHB 1ESTA 1PQ7A 1C1OA 1H9HE 1YCPM 2QF3A 2C90B 2GCHG 3HPTB 3GYLB 1ELVA 1BRAA 5A09A 3SNDA 9LPRA 1ZZZA 1WTHD 1GMHG 3F1SB 1ZYOA 1DSUA 1C2MA 1ARCA 1GCTB 1TIOA 1TRYA 4AFZA 4MG3A 1EZXC 3GY8A 2FI4E 1SQTA 1L4ZA 1N6XA 1P06A 3JZ1B 1P12E 2KAIB 1KXAA 4UDWH 1T8LA 4I8JA 1C1UH 2BY6X 3TGKE 1G3CA 3SN8A 1FY1A 1DDJA 1O3DA 3BIUH 1VCWA 1YPLH 1O3PB 1IQEA 4DVAU 2FOBA 2WUCA 2OLGA 3V12A 3RXGA 1B0EA 1A7SA 1GDUA 1GG6B 2F9UA 2QXGA 3GY3A 3ZVFA 4DW2U 1C4Y2 1GBJA 1GBTA 1TA2A 2FESH 3DD2H 2Q1JA 2W3KA 1WUNH 2TGAA 1KXEA 4JZDH 2J94A 1ELAA 3V7TA 1V2JT 1P2KA 3IITA 4A5TS 3M3TA 3SGAE 1UTMA 3MO6A 2CN0H 1HUTH 1FMGA 1GJ5H 1WQVH 2SFAA 1QB6A 4X6MA 1BTHH 3PMAB 1INCA 2H9HA 3P8NA 1TALA 1VZQH 1W13U 4B2CA 4GSOA 3EGKH 3GCTG 2BLWA 2Y81A 3RMNH 4FUHA 4CBOA 5I25A 4X8SH 3T27A 1WAYB 3LGUA 3MNXA 3U98H 2FEQH 2JH6D 2BVSH 1NRPH 4SGBE 2SGQE 1AB9B 2BQ6B 5F6MA 3LU9B 1DY9A 3RC6A 1O2TA 3ZZCA 2ESTE 1BA8B 1NY22 1IQHA 1VITF 7ESTE 1JWTA 1C4V2 5PTPA 3SJ9A 2BD4A 4Y76A 1P8VC 3T25A 1S85A 1SR5C 5JBCS 3P92A 5GDSH 3EQ0H 1EPTB 1E0FD 1GJ4H 2BZ6H 3F6UH 6ESTA 4KELA 3SOSA 2H5CA 4ABIA 2XCFA 2A5AA 1MQ5A 1S6HA 1RTFB 1O3EA 1RTKA 2FS9A 1YBWA 1AMHA 1EB1H 2GDDA 3M36A 1DWDH 3P17H 3KEEA 3SUDA 3SV2H 5A8ZA 2F9BH 2ZDMA 3H7OA 2GV7A 1G32B 2WINI 5IYTA 3KF2A 1C2FA 2BM2A 3F9EA 1NFUA 4YM9A 1YCPH 2A45B 2BXUH 1MTVA 2H6MA 1ZHMA 5DKMA 1A2CH 5EXLA 3TH4H 1UTKA 4UFFH 4AG1A 4XSKU 1BBRH 3MI4A 3FAOA 1DUAA 3ODFA 4NA8A 2A0QB 4A1TA 2CV3A 3TH2H 3PWBA 2A5IA 2FOMB 1FLEE 3R0FA 4X2WA 1YLCA 2P8OC 2BD5A 2FTMA 3TIUA 1C1TA