1Y3VA

Trypsin inhibitor complex
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A simple protocol to estimate differences in protein binding affinity for enantiomers without prior resolution of racemates.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Trypsin, cationic
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2004-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1y3vA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1y3vA02
1ANBA 1OOKB 3ZZ6A 4B2BA 2AMQA 2QY0B 1AUJA 1UMAH 3ODFA 1MZDA 1UJ1A 2C4FH 2STAE 3VEQB 4TY7A 2Q1JA 4ZKRU 1FIZA 1O2UA 2Z7FE 2TGTA 3BTQE 2F83A 1W8BH 1MQ5A 3UOPA 2ODYB 1FN8A 1GBTA 1C5NH 1NFXA 5L2YH 1LPGB 1TPOA 3F9EA 3ELAH 2QAAA 1XXFA 2ALPA 1GJ9B 2ZFSA 2Z3EA 1NPMA 4FXGH 1J9CH 2BY8X 3SNAA 2W7SA 4K8YA 3SV9A 1GI4A 3U1JB 3BTWE 3T25A 2A0QB 1GI6A 1C2FA 1K1LA 1TPSA 4GCHF 1AB9B 2FO9A 4TYDA 2ZFRH 2ZCLP 2UUJB 1QRXA 3S0NA 3T26A 4NA9H 1BRAA 1IHSH 1HAYB 4K8BA 2P3FH 2C8XB 2OUAA 2QF3A 1HJ9A 1HIAB 3M36A 3MU0A 1QL8A 1BHXB 1P9SA 2QC2A 1G3CA 2BVSH 2FOGA 4UFFH 3AAUA 2RCEA 1ESTA 5GCHG 2EI8A 3SU0A 1RIWC 1HAXB 2VGCC 4I33A 4XSKU 2A45B 1V2OT 2OINA 4OS5A 2ZWLH 1BTZA 3C27B 1TPAE 4JZEH 2ZI2H 4LXBH 5AHGH 2BM2A 3SNCA 2BOHB 5GPIB 1GG6C 1AU8A 2O8TA 3A89A 2TGDA 1SOZA 5E2PA 2G51A 4CHAC 1Z1JA 1O3EA 3N7OA 2IOTA 3Q00A 1TQ7B 1D3QB 1AB9C 3V7TA 3DFLA 3PB1E 4TPYA 1SLVB 1N6XA 2GMTB 3R3GB 2IJOB 1QFKH 5C2ZA 3ZZ8A 1HYLA 1VITH 1J14A 1D3TB 1AUTC 2ZGXH 2ZGCA 1IQKA 3L3TA 3SNBA 2F3CE 1BTWA 1WAYB 1GJAB 2BD4A 3OTJE 3QUMP 1GHBF 3GCTG 2LNCA 1EOJA 1GMCF 3Q77A 1P2IA 3ESTA 1W0YH 1XUHA 1LO6A 5E8EH 1S82A 4VGCC 1D4PB 1IQIA 1P3CA 1LHGH 2FESH 1EPTB 3RM2H 2FOHA 3ATMA 2ZU1A 1C5PA 5GCHF 2VWOA 3LGYA 1JRSA 1CVWH 2A4QA 1SQTA 1ZHPA 1EATA 4XFQA 2RDLA 4INLA 1HJAB 1KXFA 1RTLA 3PTBA 3U98H 1H8DH 3STJA 4CRGA 1B0EA 1GJBB 4YOIA 1A2CH 1LVOA 1BHXF 1RGQA 2BY9X 2H9HA 1C9PA 2GZ7A 4GCHG 1CO7E 3T28A 1LVMA 2GP9B 3EDXB 2ZHQH 5E2OA 2G4TA 3LJOA 5JB9S 2G4UA 1P03A 2PKAA 3PV4A 3JZ2B 3P8FA 2BLOA 5A8XA 1TLDA 2ILNA 1AFEH 2Z9LA 4A6LA 1NRPH 1BDAA 1OS8A 2G8TA 2GCTB 1EXFA 1SGIB 1XUKA 2B9LA 3Q3XA 3ZV9A 1G9IE 5T3HA 1TWXB 1P2QA 1C1RA 2BQ7B 5K7RA 5F8XA 3AW0A 4AZ2B 1JMOH 1DWEH 1V2UT 3F68H 2YOLA 4ZUHA 3KQDA 4FU8A 1UHBB 3PO1C 1NO9H 1UVPA 1QRWA 1C9TA 1ETSH 2NWNA 4E05H 1AZZA 1C2IA 1TE0A 2YNBA 2GZ9A 3DUXH 3ITIA 2CHAB 4CH2B 3QDZB 3DFJA 1F7ZA 3SU4A 2NU4E 1SGRE 2OXSA 3AW1A 1D9IA 3KEEA 1ELCA 3A8CA 3B8JA 3P70B 2FX6A 3RLYH 1HJAC 1OWEA 1J15A 2FYQA 4X2VA 1C5XB 4WF8A 5AFYH 2HALA 1LVYA 3U8OH 2WPKS 1Y3WA 1EAUA 1DWDH 1MBQA 1PQAA 4WXVA 4CHAB 1C1TA 4JZIA 4M7GA 9LPRA 3TLOA 1FY1A 2WPMS 2FX4A 1BTXA 4IC5A 4D7FA 4FUCA 2PGQB 1C5SA 2VGCB 3BTGE 5G4BA 4GPGA 2Y80A 3RDZA 2FOMB 1UTNA 1FAXA 1DFPA 1UTKA 4ZHAA 1O3AA 3FFGA 3PROA 3KF2A 4YLQH 5HM9A 2BVXH 1AGJA 1QTFA 4ZKSU 3EAJA 4XBCA 5ESTE 1Y59T 1P3EA 3AAVA 3LC5A 3NUMA 4NSYA 1N1LA 1INCA 2A5AA 5E0JA 2J4IA 1V3XA 2H5CA 4X1NU 4YT7H 5L30H 4ISNA 5EXNA 1A5HA 3RXVA 2IPHA 1O2JA 4U32A 1NRSH 3M7UA 2HNTF 1B5GH 2WPHS 4NIXA 1PPZA 1ELFA 1JOUB 7GCHF 5IYTA 5ABWA 3M3TA 1GJ5H 4H6SB 1ACBE 3ATLA 1ELTA 2PGBB 5GIBA 2V3HH 1LKBA 1ANEA 1QL7A 2XBWA 1QJ7B 1DWBH 3SJIA 1LTOA 4NFEA 4AB8A 1SBWA 4WH6A 3E91A 4MNXA 1YPMH 1QCPA 4X0WU 2JH6D 1CT2E 1TNIA 2AS9A 4KTCA 3ZYEA 1AWFH 1ORFA 1W7GH 8ESTE 2ANMH 1CHOG 1N8OB 1AFQB 1MCTA 1SOTA 1TFXA 3SNDA 1TGNA 1X7AC 1K22H 4ESTE 5JB8S 1L4ZA 1WQVH 5DP8A 4OS2A 2H6MA 4CR5A 2A5IA 2ZU2A 3ZZ7A 1FPHH 5GJ4B 2QIQA 1XVOA 4X8TH 1SHYA 3HK3B 2BQ6B 3GDSA 5CHAB 3W94A 1P2OA 1Z8IB 2XWBI 4ZROA 3RXIA 1QA7A 1G2LA 2F9PA 5EODA 1CGJE 4JK5A 1GL1A 1QL9A 4HZHA 5BPEA 1TNLA 5T6GA 4K1SA 3E3TA 3SHAH 2PKSB 2Q6DA 1GHWH 1CHOF 1XUIA 2UUFB 3TK9A 1IQHA 2STBE 4DVAU 3ATIA 1MD8A 4AYYB 3SJOA 2BD9A 3PLKA 3Q76A 1GBBA 2OD3B 1P2KA 2ODQA 4IBLH 2AMDA 1TMBH 4CR9A 1TX8A 2ZHWH 4MPXA 1BBRH 1QHRB 1TGCA 1P2JA 1AVXA 2OTVA 1DSUA 4FUGA 1P05A 4Y6DA 1TQ0B 1O3FA 1UK4A 4MNYA 1DITH 1TOMH 3TH4H 1VR1H 1ANCA 4DW2U 1C2KA 5B6OA 1BBRE 1O35A 5TCCA 3SJ8A 1A3EH 1E0FD 1FY3A 3VXFH 2AERH 2FYRA 1W3CA 3KHVA 1TNJA 3TPIZ 1B7XB 3BSQA 1O3MA 1GI5A 3MNCA 4X2YA 5IDKA 1Y8TA 3KQBA 1ZTJA 1MU8B 2BDIA 2V0BA 4DOQA 1NFUA 3Q3YA 3UREA 3RM0H 2HVXA 2A5KA 2FLRH 3RXFA 4D8NA 5E0GA 1YCPM 4JYUH 5EGMA 1FI8A 2ZHEH 1GHAF 3HKIB 1S0RA 4YO9A 1A0HB 6CHAB 3SQHE 2JH5D 3UPEA 1L4DA 2A2QH 5C3NA 1NS3A 1HRTH 5T6FA 5LPFA 2THFB 2G5NA 3CENA 4UD9H 3FP7E 1FZZA 2F9UA 4OS6A 5FX5A 1TAWA 1ZPZA 1GMCG 3HATH 3MH4A 4Q7XA 3DD2H 1PJPA 3RMLH 1T4UH 6GCHF 1MKWH 4HGCA 1C1SA 3H7OA 3RC4A 1AHTH 1WUNH 1ESBA 1F0SA 2OC7A 1QY6A 1SC8U 2SFAA 1BT7A 1BTYA 5FCRA 2D1JA 1PPFE 3K6YA 1C5WB 2WV5A 2BLQA 5GXPA 1TALA 1EJAA 2UUKB 5F03A 4H4FA 3DT0H 3UFAA 4DG4A 1FV9A 1AWHB 2CMYA 2F9NA 1A3BH 2VIPA 4SGBE 1C5VA 1DLEA 2FLBH 1EJMA 1V2JT 3TITA 1NZQH 1FAKH 1RTKA 3MO9A 2BZAA 4B76A 1C1MA 2BD7A 1LHCH 4UFEH 3F9FA 5DP7A 2PTNA 4THNH 3ZV8A 1P9UA 1BRUP 1VGCC 4R0IA 2BD5A 3M5OA 3UWJH 2ZG0H 3GY6A 1BTHH 1GBDA 1EAXA 1C4V2 1UVOA 3TGIE 1K2I1 8KME2 1RJXB 1BQYA 4MNWA 1W10U 3VB4A 2A7CA 1SGCA 5FX6A 1TGBA 3LGWA 3SZNA 1S85A 3LH1A 1C1PA 1DY9A 4KTUA 2TIOA 5CMXH 1GMDF 4AFQA 3T27A 4RKJB 2BDBA 1YCPH 1OKXA 2WPJS 3GYMA 4OS1A 1ZRKA 2TBSA 5C5NA 1D6RA 5HM2A 1NN6A 4BAKB 1GDNA 2BOKA 5JBBS 4BTTB 1DE7H 2BY6X 1F0UA 1E35B 2AMPA 3BTHE 1SL3A 3U69H 2QXJA 3UR6A 3URDA 1C2LA 1SGEE 2O8MA 1IHTH 3FP6E 5T6DA 4YM9A 3ENSB 3BIUH 4BOHA 3F9GA 1O5GH 1TMUH 3K2UA 2XTTB 1TABE 1HDTH 3PO1B 4JK6A 1PQ7A 2TPIZ 2ZGJA 4ISOA 3MU5A 1GI0A 3LGVA 1DM4B 5EXLA 1ZSLA 1AO5A 3P92A 5FPTA 3O8RA 1IQGA 3A84A 1SGDE 1KLJH 3STIA 1ABIH 4XE4A 4ABDA 1RIWB 2OBOA 1BTPA 4NIYA 2P3TB 5HMAA 2Z9KA 1TB6H 3KQCA 2FOEA 3RP2A 4NSVA 1C2MA 3BTKE 1O3CA 3W95A 4U01A 1HBTH 3M5MA 4BXSA 4FUIA 2VWLA 1KTTB 2ZDVH 3PWCA 5HGGA 3RXHA 2SGPE 1CGHA 3A7VA 5AVDA 4IMZA 1OWKA 2P8OB 4I8HA 3FANA 4X1QU 3SO3A 1E34B 1HB0B 2P93A 4WH8A 1ELGA 1BJUA 2ZNKH 2Z9JA 3P8NA 3R0FA 1AMHA 5A0AE 3MU4A 3OY5U 4HTCH 1O2LA 2TRMA 3ZVDA 1K21H 3KIDU 4I8KA 4D7GA 1GJ8B 5EW2H 3H7TA 1EPTC 1TA6A 1OXGA 3ZVFA 3ZZ4A 1CA0B 4FUHA 1AD8H 1LHDH 2BD2A 1O37A 3I29A 2BXTH 1NRRH 4YOGA 1WYKA 1JXPA 4I32A 2B0FA 3M3VA 1ELBA 4O03A 1W2KH 2FOCA 4UONA 5C1YA 2F9BH 1OWIA 3UUZA 3RXLA 3AASA 1ZSJA 3SGBE 1GI8B 1FONA 1MUEB 7LPRA 2QA9E 4AB9A 1AVWA 4Y76A 5FPSA 3VFEA 2ZC9H 3F1SB 5I25A 2JKHA 1YGCH 1S0QA 4Y10E 1ELVA 2PR3A 4Y0YE 3ZVEA 1KDQB 1C2EA 1SSXA 1CGIE 4D76A 2VINA 2ZDMA 3LOXA 2PKSC 2O9QA 2OQUA 2VWMA 4O9VA 1V2KT 4O3UA 1V6DA 3HGPA 1GPZA 2ZFQH 3MWIU 2HPQH 2PFEA 1MAYA 5AFZH 5JDUB 2W5EA 1QURH 4ISIH 1EZQA 2FODA 1A1RA 5F8ZA 1O5EH 1EQ9A 2RA3A 3SUEA 1F92A 4Y79A 4ABIA 4NIVA 4BANB 2GGVB 2ZGBH 3NWUA 4IS5A 2Q6GA 4ZKNU 3D62A 4ISLA 3A7ZA 2CF9H 1P8VC 4A5TS 1C4Y2 5L2ZH 3RC6A 4JZDH 2VIQA 5E0HA 2WPIS 1OP2A 5EG4A 1NY22 3TK5A 4NZQA 1OPHB 2VIVA 3QN7A 1PPBH 2F9OA 3PYHA 1V2ST 3LKWA 3DHKH 1P09A 2ZO3H 4BAHB 1YLCA 4KP0A 4YT6H 3FVFB 2ZFTA 3SV8A 3A87A 5JBAS 1HAVB 2ASUB 4X6OA 4X6MA 3UNSA 4B2CA 1PFXC 3MFJA 6CHAC 1P02A 2R2WU 2FZZA 1C5QA 2GT7A 3LH3A 1LPZB 2FWWA 2C8WB 3PM3A 1AN1E 2Y82A 1UVTH 6ESTA 1AKSB 2C93B 1ZR0A 3U8TH 2BX4A 4Y8YA 2VWNA 2NU2E 2VIOA 1GBHA 4BNRA 1SG8B 1ZMJA 1DY8A 5DJ7A 1KXDA 1EB2A 1MTUA 4UDWH 3SGQE 4BTIB 3U8RH 3EQ0H 3SJKA 2GKVE 1VJ9U 4OS7A 1MD7A 4FUBA 2XBVA 3A80A 2C8YB 4NG9H 3ZZCA 1HUTH 1P11E 1HAVA 5DK1A 3BN9A 1FQ3A 1GHYH 2PWXA 2ZTXA 3TH3H 1FY8E 4BXWA 1H9IE 1NRNH 4RN6A 5JYIA 3PMAB 4K3JA 1C1NA 3UY9A 1YLDA 4INHA 2GCHF 1U6QA 3TIUA 1WV7H 1Z6EA 3EYDA 4A92A 2WUBA 3BEUA 1HAIH 2P59A 4QT8C 3MTYA 4TWYA 3CS7A 3KQEA 4FU7A 1UHBA 2K1QA 1MTVA 1G36A 1OSSA 1W13U 2FS9A 2W3IA 5DP9A 2BX3A 1GBLA 2ZEBA 4GHQA 1RFNA 3TJOA 1NFYA 2EI6A 3AVZA 3CS0A 1ELDE 2HNTE 1D6WA 5DKMA 3SN8A 2DE8A 1M9UA 1A0LA 1TGSZ 3A82A 1H9LB 1MKXK 1RTFB 1O36A 4LOYH 3EE0B 1UK3A 1C2JA 4MDSA 1DDJA 2CN0H 2ZGHA 2A1DB 2SGEE 4ZAEA 2Y6TA 3SHCH 3IWMA 3VB7A 1CT4E 1Y5BT 2FIRH 1EX3A 3I78A 1GG6B 3RXAA 3MH5A 3ZZ3A 1RRKA 4ZH8A 1HAZB 1TA2A 3A8BA 1F0RA 1TNHA 3RLWH 4Y7BA 2XBXA 1SLWB 3LGIA 4KGAA 1WBGB 2RA0A 2R3YA 1IQMA 3A88A 4H6TA 3M5NA 2AEIH 2J95A 1NM6A 3SU5A 2A4RA 3SI3H 3GISB 4AORA 1ELEE 1QBNA 5DGJA 2ZCHP 1O30A 2BY7X 3QLPH 3TH2H 5LPEA 2A31A 4GVUA 1HLTH 2VH0A 2XCFA 3V0XA 1XXDA 3ZZBA 2J94A 1WOFA 1ZTKA 3V13A 1GHVH 1O2OA 1VCQA 1TGTA 1WQSA 3LGTA 1YYY1 1F5RA 1XVMA 4D9RA 1BA8B 1BZXE 2PSXA 3K65B 1XUFA 1DOJA 4LZ4B 2VVUA 1QRZA 2ESTE 4AFSA 1O2WA 1TRMA 1CSOE 2O8LA 4RSPA 3GICB 4YTAA 3URCA 1DPOA 3GY7A 4B2AA 5FBIA 1ARBA 3K6ZA 4MNVA 1MTSA 1VJAU 4BAQB 4BAOB 3GY5A 3FAOA 4FUDA 1THSH 1MH0A 2EC9H 4X2WA 1HPGA 2HOBA 3ATKA 3LIWA 3LT3A 2GT8A 3A83A 4DCDA 2JETB 2VJ1A 1KLTA 1CBWB 1BMMH 1CQQA 2FI4E 1UTMA 1K1JA 4FUEA 2H5DA 1O2VA 3KCGH 2ZQ2A 2M5TA 1FUJA 1GI7B 2HRVA 3GCHB 1V2LT 4IC6A 1GJDB 1MTNB 3PMBB 1O2KA 1DUEA 1C5MD 2LPRA 2XWAA 1SGNE 3QWCH 4MTBA 2NU3E 3A7XA 3SBKA 1OX1A 4VGCB 3O8CA 4BTUB 3A8AA 3RXSA 3TU7H 1S81A 5ESBA 1SGQE 2GX4A 1AQ7A 1IQFA 3A81A 1GI1A 1G2MA 1LPKB 3SOSA 1DLKB 2ZU3A 1THPB 3PMJA 4WVPE 1O2IA 1DS2E 1QJ6B 1ZTLA 3NXPA 1AE8H 1GBIA 3NPSA 4GUXA 4TY6A 1Z1IA 3M37A 1GDUA 3S9BA 1NESE 1UCYK 1MTNC 2QN5T 2D2DA 1YM0A 4DIIH 1IQNA 5CHAC 1HJ8A 1DANH 2BZ6H 2G5VA 3TGJE 3RU4T 1SGPE 1K1MA 4WMFA 4A1XA 3GYLB 1NU7B 3A7YA 4KKDA 1V2VT 1E38B 1IQEA 1WTGH 3MO6A 4FUJA 5C67A 1LKAA 3M35A 2ZCKP 1TYNA 3A7WA 1GBFA 4NA7A 2ZDKA 5SGAE 3D49H 3UTUH 1SHHB 2ZA5A 1O2HA 1O2MA 1DICA 1GI2A 2HLCA 1Z7KA 2I6SA 1TNKA 3L6PA 3OU0A 1A5IA 1J8AA 1EP6A 4J1YA 3EGKH 2XRCA 3M5LA 1UO6A 3MNXA 2KAIB 1T8MA 3SORA 1AVGH 1ZZZA 1Y3XA 1UTJA 1O2GH 1Y5UT 1A61H 3S69A 1AE5A 3E0PB 1C5ZB 4UEHH 1IQJA 1ELAA 3RXQA 2GDEH 4B71A 1OWDA 4K1EA 3SV7A 3SV2H 1PPHE 2G00A 1B0FA 3GY3A 1EAWA 1MZAA 4X8SH 1P04A 2JH0D 2BTCE 4RKOB 2UUYA 1SFIA 3LU9B 2ZPRA 2GD4B 4JYTA 2NU0E 3F6UH 2BDYA 3VB3A 2ZECA 3BEFB 2AGGX 3QX5H 2GTBA 4Q80A 1QB6A 1VZQH 2R9PA 1C2GA 1QIXB 1OP8A 4YESB 1O3JA 2XXLA 4NZLA 4I8GA 1V2RT 1BBRK 2WUCA 4A7IB 1HXFH 2V3OH 3P6ZB 2RG3A 5GDSH 2CV3A 1O5AB 3MMGA 1YPJH 1FNIA 1NFWA 4FU9A 1HXEH 1MTWA 5LPRA 3S9CA 2WV4A 1VITF 3IG6B 4ABEA 3UR9A 4K60A 3P8GA 4Q2KA 5DP6A 1S6HA 4B73A 4MQAA 1O5BB 1S6FA 1SVPA 1EPTA 2H9EH 1YPGH 4XBBA 2ZZUH 5EPYA 3LONA 2H1UA 1VITG 2NU1E 1DSTA 1DVAH 1DX5M 1QR3E 3RMOH 1THRH 3S7KB 5A0BA 3OYPA 1QB9A 3L33A 1TOCB 2VVVA 4WJG2 2V35A 1ZLRA 4DURA 5F8TA 4XDEA 2SGFE 3GCHC 1O2PA 2ZF0H 3VGCB 2SNWA 1GMDG 5DPAA 1HNEE 2EI7A 1ID5H 1BJVA 4CBNA 4ASHA 1YPHC 1D3PB 1EUFA 1T8LA 1HGTH 2ZTYA 3LGUA 1O2XA 3RXPA 5FCKA 1YC0A 1O2QA 1AY6H 2GCTC 3ATWA 3M61U 1FN6A 1N8OC 3RXTA 2HGTH 5A09A 4AGKA 2UWPA 4TWWA 1EP5A 1TRNA 2WYJA 1L0ZA 3MNBA 4E7RG 1FDPA 2BD8A 1SGFG 1SQAA 1CU1A 1C5LH 1HV7A 5EPNA 3D23A 3E6PH 3NKKA 2GCHG 1DWCH 1O2NA 3OSYA 2CF8H 1C1WH 2HNTC 1Y3YA 4E06H 4O3TA 2W26A 2BMGB 3U9AH 1SPJA 2Z6BD 2BVRH 1GI9B 1HIAA 2BD3A 3RXUA 4MPUA 5A8YA 5F6MA 1O2RA 1QBOA 3PLBA 1QQUA 2QCYA 2XCNA 4LZ1H 1EZXC 2GV7A 1O3OA 2O8WA 4CRDA 5EW1H 2YNAA 3RC5A 5DP4A 4Z6AH 1FY4A 3VB6A 3MI4A 1V2NT 1ZRBA 1GBCA 5TCAA 2Y5GA 1OYQA 3LJJA 2D8WA 3UNRA 2QXIA 4YOJA 3A7TA 1GGDB 2GMTC 4X1RU 1C5OH 2H2ZA 4WXIA 1O3GA 4NGAH 2ZFPH 1LCYA 1VCWA 1G37A 2AGIX 3P17H 7KMEH 3RXOA 3VXEH 3PMHB 1H1BA 4A1VA 1CA8B 2Z3DA 1EOLA 5HXFA 3UIRA 1GVLA 4MPWA 2ZIQH 7ESTE 2ZKSA 4X6PA 2D26C 3ZZDA 2PUQH 2OLGA 3LPRA 2ALVA 3T62A 4F4OC 2UWLA 1XKBC 5HYOA 2BXUH 3BTME 1ZHMA 4MPVA 4FVBA 3K9XB 4MLFB 1ETTH 2JETC 3VPKA 1Z8JB 4BAMB 4HI3A 5FXLA 4X1PU 1NC6A 3NZIA 1MCVA 2BLVA 4IGDA 1F5KU 3RUOA 3UOUA 5A0CA 1V2TT 4OGXA 2ZTZA 1BRBE 1F5LA 1MQ6A 2SGAA 4AN7A 1ZPCA 3RXMA 1YF4A 4IMQA 2B7DH 4AGJA 4CBOA 1O31A 1O34A 2C90B 4DY7B 2FTMA 3TJNA 1A7SA 1ZSKA 2QXGA 4ABGA 3RU4E 3RXRA 1C5YB 3E16B 3PWBA 2XC4A 1MMJN 1EKBB 1PQ8A 2XW9A 1H9HE 2BDGA 1MAXA 3BTFE 2P8OC 1J16A 1TBZH 1O2TA 1QJ1B 2EEKA 2ZDAH 1OYTH 4CREA 2B5TB 1BITA 1A46H 3QZQA 2Y5HA 1DT2A 4J2YB 5L6NH 1KSNA 2HWLB 2QGRA 1TIOA 6GCHG 3B23B 1XMNB 2PW8H 4ZXXH 2FI5E 3E0NB 1ARCA 1TX7A 2F91A 2FM2A 2AH4X 1KTSB 1G3DA 1GVZA 2AFQB 1NTPA 3NCLA 1L2EA 2A4OA 3RMNH 1MKWK 5K0HA 1ETRH 1H4WA 1K9OE 2GZ8A 3OX7U 3BEIB 3S9AA 1O3NA 4GSOA 1AFQC 1JIRA 2FOAA 3MU1A 2J34A 4X2XA 1GBKA 1W7XH 3TJVA 1TPPA 1O3HA 1KXEA 4WMDA 2Z3CA 4CRFA 1GBEA 1CT0E 1EJNA 2J9NA 1AI8H 1GCTB 3MO3A 4I8LA 1V2WT 3EA8A 1YBWA 4IN1A 3SU6A 4IW4E 3GCNA 1ZMLA 4I31A 3ZZ5A 1PYTC 1UTOA 1XUGA 3F9HA 3UNQA 1G3EA 3JZ1B 1GL0E 2SGDE 2PTCE 1BMLA 2CXVA 3QTVH 5J4SA 1Z8GA 1UCYE 4K69A 4CH8B 3RXCA 4NA8A 1PPEE 2WINI 3E90B 3HPTB 3BG4C 1BOQA 2VU8E 2PSYA 4O97A 1FY5A 3RXJA 1O0DH 1CA0C 3FP8E 1VCPA 1C5RA 2TGPZ 4E7NA 2V6NA 1K1PA 3RXDA 1OP0A 1BUIA 4Y11E 2DUCA 4DT7B 1C2DA 4XBDA 4WY3A 1LQEA 3V3MA 1TRYA 4SGAE 5EU8A 1BRCE 5C5OA 3RXKA 1BMNH 1GMHF 1KDQA 1O3DA 5J4QA 1QGFA 3GY4A 5C20A 1SGFA 1S83A 2FDAA 3DA9B 1RS0A 2PLXA 3B9FH 2BDCA 3BG4B 4NFFA 3QTOH 3H5CB 1FXYA 4WMEA 2J2UA 1XKAC 3FZZA 2FP7B 1J17T 3VB5A 1P0SH 3V12A 4UFGH 2BHGA 1PYTD 1AKSA 2Z9IA 1K1OA 1TX6A 1SQOA 5A2MH 3TNTA 2OC1A 1HAPH 3T5FH 3LC3A 2QXHA 1P10A 3QO6A 4JZFH 4AYVB 1GGDC 4ZHMU 2GDDA 5EQRA 2O8UA 3FZDA 4AG1A 2F9VA 2Y7ZA 3SV6A 5FAHA 3ZZ9A 1C1UH 3HKJB 3PTNA 4U2WA 1GDQA 7GCHG 2R3UA 1Q31A 1SMFE 4B74A 1KIGH 4Y8ZA 2R0LA 2OBQA 1E36B 2OC8A 1SFQB 2WYGA 3KN2A 2HPPH 3ZYDA 3ZZAA 2ZHDA 3LDXH 4YLUA 1EASA 4INKA 5FHTA 1TBQH 1GBMA 3I77A 1YPKH 3RU4D 4OGYA 4UFDH 3HK6B 5FBEA 1KY9A 2ULLA 1V2MT 1C5TA 1SB1H 1O2YA 4U30A 3MH6A 1SLXB 2FTLE 2OP9A 4Q7YA 2FXRA 2FOFA 3VGCC 5DP5A 3ZVCA 1G3BA 3ZVBA 1GWAA 2P94A 2XC0A 3TJUA 3TVJB 3TGKE 2CGAA 4JZ1A 1GHBG 3GCTF 3O8DA 3MNSA 1A0JA 1YPEH 2ZPQA 4X1SU 3SUDA 2Z94A 1T31A 3D65E 1BB0B 1HAGE 4AFUA 3GOVB 5BRRE 1D3DB 3GDVA 1C1QA 2ZPSA 1P57B 1ZPBA 3MH7A 3QZRA 5LGOA 1H8IH 1NRQH 1FMGA 2Z9GA 2VVCA 5EQSA 1C4U2 3S7HB 2A4GA 4XOJA 3TNSA 1ABJH 3RMMH 4AX9H 1O32A 2ZDLA 1GJ6A 1Z8RA 3P8OA 1ZGIA 1LHFH 4UE7H 5JPMH 2XYAA 8GCHF 1GHAG 2ODPA 1OWJA 1Q2WA 2P3UB 4NWLA 1HAHH 4CRAA 1C1VH 1L1NA 5AF9H 3KNXA 5GWZA 2Q6FA 2A32A 4Q7ZA 1ZMNA 3A8DA 3UWIA 1KXCA 2R0KA 2VB0A 2PUXB 1Z71A 3OY6U 1SGTA 4ABJA 1KXBA 1O5FH 1YPLH 2XBYA 1Y5AT 2ZU4A 2Y81A 4I7YH 5EQQA 1IAUA 4MG3A 1AZ8A 1Q3XA 3QGJA 1O3LA 1UTQA 1SLUB 1TMTH 3A85A 1XUJA 3GY2A 4GLYA 4CRBA 3GDUA 3NK8A 2TGAA 2VH6A 1NROH 3UQVA 1T8OA 2XC5A 1P12E 1ZYOA 1GMHG 4KELA 3MOCA 4K2YA 3RXGA 1BTUA 1A4WH 1P01A 2P95A 1ANDA 1PPGE 4ZHLU 2AIQA 1RXPA 3QK1A 1GHXH 2G81E 4HFPB 2FPZA 1DUAA 2FOBA 2UWOA 5PTPA 4IN2A 1PPCE 1F2SE 1UK2A 1W11U 2IN2A 3GCOA 3M3SA 4DIHH 2BDHA 1T7CA 5JBCS 1C1OA 1N6YA 1XM1A 5C1XA 3GY8A 5DP3A 1LHEH 4ABBA 1Y3UA 1O5CB 1P06A 4GAWA 1HCGA 2BQWB 3U1IB 2J38A 1P2NA 2FS8A 3P95A 5EOKA 3SU3A 2BYAX 4FVDA 1QNJA 1OWHA 3C1KA 3EA9A 1UVSH 2ANKH 1GBAA 1Y3VA 2H9TH 1O38A 2KAIA 4FUFA 2QV1A 1O3IA 4CRCA 1S5SA 2AYWA 1UVUH 2GVFA 1ZGVA 4ZMAH 1SGYE 4K5ZA 1V2PT 1WU1A 2A7HA 2W7UA 3HGNA 1XX9A 2A7JA 1W14U 2FMJA 1JBUH 1JIMA 4Z0KA 4AOQA 4R8TB 2R2MB 1GBJA 1QQ4A 2G52A 1LMWB 1O3PB 3BG8A 1O3BA 1ZJDA 2BB4A 4NWKA 2QF0A 4K1TA 4YZUA 5EXMA 1O33A 1WCZA 5FPYA 3KL6A 4Y0ZE 6LPRA 1G30B 3SGAE 2FEQH 4GHTA 2VIWA 5JBTA 1L1JA 2XNIA 3E1XB 4TPIZ 3O8BA 3BF6H 1W12U 4DGJA 4KTSA 8GCHG 3BTDE 1G32B 4X8VH 3RXBA 1S84A 2ZP0H 4B75A 1GCTC 1K1IA 1BCUH 1PQ5A 3UQOA 1SI5H 1VGCB 1LVBA 1YPHE 1EB1H 1O3KA 2AIPA 1UTLM 3SUGA 1ZHRA 2FI3E 4Y8XA 2ZHFH 1QB1A 1FIWA 1UCYH 1MKXH 5C1UA 2ANYA 2A2XH 1ZOMA 4ABFA 1P2MA 2SGQE 2WPLS 1C5UA 3M7QA 1HAOH 4ZKOU 1T32A 4JYVH 1T8NA 2OCVB 2VIDA 1SR5C 3MYWA 1AIXH 1GVKB 3BV9B 3ZVGA 5H4IB 1Z6JH 2QYIA 1IQLA 4JCNA 3SW2B 3SU1A 4X8UH 1RD3B 4DJZB 1EAIA 1T4VH 4A1TA 2VNTA 4NCYA 2P16A 1DXPA 3CP7A 1YP9A 2B8OH 5DO4H 3MHWU 2ANWA 1QA0A 1BIOA 2ZDNA 1NT1A 3T29A 5LH8A 1L1GA 4X6NA 3QGNB 1V2QT 4F49A 1GJ7B 3EA7A 1WTHD 4WWYA 1K28D 3KGPA 2OQ5A 2PKAB 2OC0A 1TBRH 1C2HA 2G55A 4I8JA 3WY8A 2EA3A 3SI4H 2C3SA 1W0ZU 1LDTT 2GV6A 1YCPK 2BY5X 2CJIA 3TK6A 5CE1A 3ODDA 1O2ZA 5DG6A 3SUFA 3SNEA 1BMAA 1E37B 4Y7AA 2ZU5A 1KLIH 2Y7XA 1KXAA 3E8LA 5A8ZA 1QBVH 2C8ZB 3Q3KA 3SU2A 2ZFFH 1DXWA 1UTPA 3BIVH 1HFDA 4D9QA 1GJCB 4PROA 5I46H 4JMYA 1EZUC 3BTTE 2BLWA 4H42U 4B1TA 2ZQ1A 1A5GH 2SNVA 2W3KA 1O2SA 5TJXA 1CHGA 1LQDB 4AFZA 4ISHH 1FJSA 4Y71A 1KYNA 3PLPA 1NU9A 3BTEE 1WSSH 3RXEA 1O39A 1TNGA 1CBWC 4NIWA 1GJ4H 2I6QA 1MU6B 3ZVAA 1FPCH 2PHBA 2J92A 2BDAA 4MVNA 3SJ9A 4OS4A 1O5DH 1JRTA 3MU8A 1FLEE 3IITA 4ABHA 2DE9A 1K1NA 1CE5A 2CHAC 3G01A 1GHZA 4ABAA 1IOEA 3M7TA 1YKTA 3A86A 1TONA 4ZXYH 1GCDA 3SQEE 1ZJKA 4AG2A 2AGEX 9ESTA 3T2NA 1EZSC 5ETXA 1F0TA 1JWTA 8LPRA 4LK4A 1GI3A 2Y5FA 1ESAA 1MBMA 2PV9B
chains in the Genus database with same CATH superfamily
1ANBA 1OOKB 3ZZ6A 4B2BA 2AMQA 2QY0B 1AUJA 1UMAH 3ODFA 1MZDA 1UJ1A 2C4FH 2STAE 3VEQB 4TY7A 2Q1JA 4ZKRU 1FIZA 1O2UA 2Z7FE 2TGTA 3BTQE 2F83A 1W8BH 1MQ5A 3UOPA 2ODYB 1FN8A 1GBTA 1C5NH 1NFXA 5L2YH 1LPGB 1TPOA 3F9EA 3ELAH 2QAAA 1XXFA 2ALPA 1GJ9B 2ZFSA 2Z3EA 1NPMA 4FXGH 1J9CH 2BY8X 3SNAA 2W7SA 4K8YA 3SV9A 1GI4A 3U1JB 1H8ED 3BTWE 3T25A 2A0QB 1GI6A 3PV2A 1C2FA 1K1LA 1TPSA 4GCHF 1AB9B 2FO9A 4TYDA 2ZFRH 2ZCLP 1COWD 1QRXA 2UUJB 3S0NA 3T26A 4NA9H 1BRAA 1IHSH 1HAYB 2IPQX 4K8BA 2P3FH 2C8XB 2OUAA 2QF3A 1HJ9A 1HIAB 3M36A 3MU0A 1QL8A 1BHXB 1P9SA 2QC2A 1G3CA 2BVSH 2FOGA 4UFFH 3AAUA 2RCEA 1ESTA 5GCHG 2EI8A 3SU0A 1RIWC 1HAXB 2VGCC 4I33A 4XSKU 2A45B 1V2OT 2OINA 4OS5A 2ZWLH 1BTZA 3C27B 1TPAE 4JZEH 2ZI2H 4LXBH 5AHGH 2BM2A 4P02A 3NRLA 2BOHB 5GPIB 1GG6C 1AU8A 2O8TA 3A89A 2TGDA 1SOZA 4RT0A 5E2PA 2G51A 4CHAC 1Z1JA 2EY4C 3OAAD 1O3EA 3N7OA 2IOTA 3Q00A 1TQ7B 1D3QB 1AB9C 3V7TA 3DFLA 3PB1E 4TPYA 1SLVB 2VBCA 1N6XA 2GMTB 3R3GB 2IJOB 1QFKH 5C2ZA 3ZZ8A 1HYLA 1VITH 1J14A 1D3TB 1AUTC 2ZGXH 2ZGCA 1IQKA 3L3TA 3SNBA 2F3CE 1BTWA 1WAYB 1GJAB 2BD4A 3OTJE 3QUMP 1GHBF 3GCTG 2LNCA 1EOJA 1GMCF 3Q77A 1P2IA 3ESTA 1W0YH 1XUHA 1LO6A 2QF4A 5E8EH 1S82A 4VGCC 1D4PB 1IQIA 1P3CA 1LHGH 2FESH 1EPTB 3RM2H 2FOHA 3ATMA 2ZU1A 1C5PA 4B6EA 5GCHF 2VWOA 2XOKD 3LGYA 1JRSA 1CVWH 2A4QA 1KMHB 1SQTA 1EATA 1ZHPA 4XFQA 2RDLA 4INLA 1HJAB 1KXFA 1RTLA 2QF5A 3PTBA 1H8DH 3DSPA 3STJA 3U98H 4CRGA 1B0EA 1GJBB 1YY3A 4YOIA 1A2CH 1LVOA 1BHXF 1RGQA 2BY9X 2H9HA 1C9PA 2GZ7A 4GCHG 1CO7E 3T28A 1LVMA 2GP9B 3EDXB 2ZHQH 5E2OA 2G4TA 3LJOA 5JB9S 2G4UA 1P03A 2PKAA 4F48B 3PV4A 3JZ2B 3P8FA 2BLOA 5A8XA 1TLDA 2ILNA 1AFEH 2Z9LA 4A6LA 5C17A 1NRPH 1VKYA 4I86A 1BDAA 1OS8A 2G8TA 2GCTB 1EXFA 1SGIB 1XUKA 2B9LA 3Q3XA 3ZV9A 1G9IE 1OHHD 5T3HA 1TWXB 1P2QA 1C1RA 2BQ7B 5K7RA 5F8XA 3AW0A 4AZ2B 1JMOH 1DWEH 1V2UT 3F68H 2YOLA 4ZUHA 3KQDA 4FU8A 1UHBB 3PO1C 4FOUC 1NO9H 1UVPA 1QRWA 1C9TA 1ETSH 2NWNA 4E05H 1AZZA 1C2IA 1TE0A 2YNBA 2GZ9A 3DUXH 3ITIA 2CHAB 2W6ID 4CH2B 3QDZB 3DFJA 1F7ZA 3DSOA 3SU4A 2NU4E 1SGRE 2JIZD 2OXSA 3AW1A 3FKSD 1D9IA 3KEEA 1ELCA 3A8CA 3B8JA 3P70B 2FX6A 3RLYH 1HJAC 1OWEA 1J15A 2FYQA 4X2VA 1C5XB 4WF8A 5AFYH 2HALA 1LVYA 3U8OH 2WPKS 1Y3WA 1EAUA 1DWDH 1MBQA 1PQAA 3KYGA 4WXVA 4CHAB 1C1TA 4JZIA 4M7GA 9LPRA 3TLOA 1FY1A 4ACAA 2WPMS 2FX4A 1BTXA 4IC5A 4D7FA 4FUCA 2PGQB 1C5SA 2VGCB 3BTGE 5G4BA 4GPGA 2Y80A 3RDZA 2FOMB 1UTNA 1FAXA 1DFPA 1UTKA 4ZHAA 1O3AA 3FFGA 2KR7A 3PROA 3KF2A 4YLQH 5HM9A 2BVXH 2K8IA 1AGJA 1QTFA 4ZKSU 3EAJA 4XBCA 5ESTE 1Y59T 1P3EA 3AAVA 3LC5A 3NUMA 4NSYA 1N1LA 1INCA 2A5AA 5E0JA 2J4IA 1V3XA 2H5CA 4X1NU 4YT7H 5L30H 4ISNA 5EXNA 1A5HA 3RXVA 2IPHA 1O2JA 4U32A 1NRSH 3M7UA 2HNTF 1B5GH 2WPHS 4NIXA 4OM9A 1PPZA 1ELFA 1JOUB 7GCHF 5IYTA 2JDID 2KCOA 5ABWA 2YMSC 5DN6D 5HIYA 3M3TA 1GJ5H 4H6SB 1ACBE 3ATLA 1ELTA 2PGBB 5GIBA 2V3HH 1LKBA 1ANEA 1QL7A 2XBWA 1QJ7B 1DWBH 3SJIA 1LTOA 4NFEA 4AB8A 1SBWA 4WH6A 3E91A 2KM0A 4MNXA 1YPMH 1QCPA 4X0WU 2JH6D 1CT2E 1TNIA 2AS9A 4KTCA 3ZYEA 1AWFH 1ORFA 1W7GH 8ESTE 2ANMH 1CHOG 1N8OB 1AFQB 1MCTA 1SOTA 1TFXA 3SNDA 1TGNA 1X7AC 1K22H 4ESTE 5JB8S 1L4ZA 2YMSB 1W0JD 1WQVH 5DP8A 2LP6A 4OS2A 2H6MA 4CR5A 2A5IA 2ZU2A 3ZZ7A 1FPHH 5GJ4B 2QIQA 1XVOA 4X8TH 1SHYA 2WSSD 3HK3B 2BQ6B 3GDSA 5CHAB 3W94A 1P2OA 1Z8IB 2XWBI 3UB0A 4ZROA 3RXIA 1QA7A 1G2LA 2F9PA 2IJD1 1CGJE 4FETA 5EODA 4JK5A 1GL1A 1QL9A 4HZHA 5BPEA 1TNLA 5T6GA 4K1SA 3E3TA 2WV9A 3SHAH 2PKSB 2Q6DA 1GHWH 1CHOF 1XUIA 2UUFB 3TK9A 1IQHA 2STBE 4DVAU 3ATIA 1MD8A 4AYYB 3SJOA 2BD9A 3PLKA 3Q76A 1GBBA 2OD3B 1P2KA 2ODQA 4IBLH 2AMDA 1TMBH 4CR9A 1TX8A 2ZHWH 4MPXA 1BBRH 3PV5A 1QHRB 1TGCA 1P2JA 3OEED 1AVXA 2OTVA 1DSUA 4FUGA 1P05A 4Y6DA 1TQ0B 1O3FA 1UK4A 4MNYA 1DITH 1TOMH 3TH4H 1VR1H 1ANCA 4DW2U 1C2KA 5B6OA 1BBRE 1O35A 5TCCA 3SJ8A 1A3EH 1E0FD 1FY3A 3VXFH 1WDIA 2AERH 2FYRA 1W3CA 3KHVA 1TNJA 3TPIZ 1B7XB 3BSQA 1O3MA 1GI5A 3MNCA 4X2YA 5IDKA 1Y8TA 3KQBA 1ZTJA 1MU8B 2BDIA 2V0BA 4DOQA 1NFUA 2J98B 3Q3YA 3UREA 3RM0H 2HVXA 2A5KA 4Z1MD 2FLRH 3RXFA 4D8NA 5E0GA 1YCPM 4JYUH 5EGMA 1FI8A 2ZHEH 1GHAF 3HKIB 1S0RA 4YO9A 1A0HB 6CHAB 3SQHE 2JH5D 3UPEA 1L4DA 2A2QH 3WWBA 1NS3A 1HRTH 5T6FA 5C3NA 2THFB 2PP6A 2G5NA 3CENA 4UD9H 3FP7E 1FZZA 2F9UA 4OS6A 5FX5A 1TAWA 1ZPZA 1GMCG 3HATH 3MH4A 4Q7XA 3DD2H 1PJPA 3RMLH 1T4UH 6GCHF 1MKWH 4HGCA 1C1SA 3H7OA 3RC4A 1AHTH 1WUNH 1ESBA 1F0SA 2OC7A 1QY6A 1SC8U 2SFAA 1BT7A 1BTYA 5FCRA 2D1JA 1PPFE 3K6YA 1C5WB 2WV5A 2BLQA 5GXPA 1TALA 1EJAA 2UUKB 5F03A 4H4FA 3DT0H 3UFAA 4DG4A 1FV9A 1AWHB 2CMYA 2F9NA 1A3BH 2VIPA 4SGBE 1C5VA 1DLEA 2FLBH 1EJMA 1V2JT 3TITA 1NZQH 1FAKH 1RTKA 2KFWA 3MO9A 2BZAA 4B76A 1C1MA 2BD7A 2KZ4A 1LHCH 4UFEH 3F9FA 5EJZA 5DP7A 2PTNA 4THNH 4M9FA 1QZ8A 3ZV8A 1P9UA 1BRUP 1VGCC 4R0IA 2BD5A 3M5OA 3UWJH 2ZG0H 3GY6A 1BTHH 1GBDA 2V3MA 1EAXA 1C4V2 1UVOA 3TGIE 1K2I1 8KME2 1RJXB 1BQYA 4MNWA 1W10U 3VB4A 2A7CA 1SGCA 5FX6A 5IK2D 1TGBA 3LGWA 3SZNA 1S85A 3LH1A 1WXRA 1C1PA 1DY9A 4KTUA 2TIOA 5CMXH 3OEHD 1GMDF 4AFQA 3T27A 4RKJB 2BDBA 2QE7D 1YCPH 1OKXA 2WPJS 3GYMA 4OS1A 4TT3D 1ZRKA 2TBSA 5C5NA 1D6RA 5HM2A 1FX0B 1NN6A 4BAKB 1GDNA 2BOKA 5JBBS 4BTTB 1DE7H 2BY6X 1F0UA 1E35B 2AMPA 3BTHE 1SL3A 3U69H 2QXJA 3UR6A 3URDA 1C2LA 1SGEE 2O8MA 1IHTH 3FP6E 5T6DA 4YM9A 3ENSB 3BIUH 4BOHA 3F9GA 1O5GH 1TMUH 3K2UA 2XTTB 1TABE 1HDTH 3PO1B 4JK6A 1PQ7A 2TPIZ 2ZGJA 4ISOA 3MU5A 1GI0A 3LGVA 1DM4B 5EXLA 1ZSLA 1AO5A 3P92A 5FPTA 3O8RA 1IQGA 3A84A 1SGDE 1KLJH 3STIA 1ABIH 3AK5A 4XE4A 4ABDA 1RIWB 2OBOA 1BTPA 4NIYA 2P3TB 5HMAA 2Z9KA 4Q63A 1TB6H 3KQCA 5T1VA 2FOEA 3RP2A 4NSVA 1C2MA 3BTKE 1O3CA 3W95A 4U01A 3W1EA 5B6LA 1HBTH 3M5MA 4BXSA 4FUIA 2VWLA 1KTTB 2ZDVH 3PWCA 5HGGA 3RXHA 2SGPE 1CGHA 3A7VA 5AVDA 4IMZA 1OWKA 2P8OB 4I8HA 3FANA 4X1QU 3SO3A 1E34B 1HB0B 2P93A 4WH8A 1ELGA 1BJUA 2ZNKH 2Z9JA 2KCPA 3P8NA 3R0FA 1AMHA 5A0AE 3MU4A 3OY5U 4HTCH 3MQKC 1O2LA 2TRMA 3ZVDA 1K21H 3KIDU 4I8KA 4D7GA 2OK5A 1GJ8B 5EW2H 3H7TA 1EPTC 1TA6A 1OXGA 4RI0A 3ZVFA 3ZZ4A 1CA0B 4FUHA 1AD8H 1LHDH 2BD2A 1O37A 3I29A 2BXTH 1NRRH 4YOGA 1WYKA 1JXPA 4I32A 2B0FA 3M3VA 1ELBA 4O03A 4DT4A 1W2KH 2FOCA 4UONA 5C1YA 2F9BH 1OWIA 3F3BA 3UUZA 3RXLA 3AASA 4ASUD 1ZSJA 3SGBE 1GI8B 1FONA 1MUEB 7LPRA 2QA9E 4AB9A 1AVWA 4Y76A 5FPSA 3VFEA 2ZC9H 3F1SB 5I25A 2JKHA 1YGCH 1S0QA 4Y10E 2KX4A 1ELVA 2PR3A 4Y0YE 3ZVEA 1KDQB 1C2EA 5KEDA 1SSXA 1CGIE 4D76A 2VINA 2ZDMA 3FO8D 3LOXA 2PKSC 2O9QA 2OQUA 2VWMA 4O9VA 1V2KT 4O3UA 1V6DA 3HGPA 1GPZA 2ZFQH 3MWIU 2HPQH 2PFEA 1MAYA 5AFZH 2JJ2D 5JDUB 2W5EA 1QURH 4ISIH 1EZQA 2FODA 1A1RA 5F8ZA 1O5EH 1EQ9A 2RA3A 3SUEA 1F92A 4Y79A 2KCYA 4ABIA 4NIVA 4BANB 2GGVB 2ZGBH 3NWUA 4IS5A 2Q6GA 4ZKNU 3D62A 4ISLA 3A7ZA 3N7DA 2CF9H 1P8VC 3CNRA 4A5TS 1C4Y2 5L2ZH 3RC6A 4JZDH 2L6OA 2VIQA 5E0HA 2WPIS 1OP2A 5EG4A 1NY22 3TK5A 4NZQA 1OPHB 4YXWD 2VIVA 3QN7A 1PPBH 2F9OA 3PYHA 1V2ST 3LKWA 3DHKH 1P09A 2ZO3H 1NBME 4XRNA 1E79D 4BAHB 1YLCA 4KP0A 4YT6H 3FVFB 2ZFTA 3SV8A 3A87A 5JBAS 1HAVB 2ASUB 4X6OA 4X6MA 3UNSA 5FL7D 4B2CA 1PFXC 3MFJA 6CHAC 1P02A 2R2WU 2FZZA 1C5QA 2GT7A 3LH3A 1LPZB 3H09A 2FWWA 2C8WB 3PM3A 1AN1E 2Y82A 1UVTH 6ESTA 5EJLA 1AKSB 2C93B 1ZR0A 3U8TH 2BX4A 4Y8YA 2VWNA 2NU2E 3F2HA 2VIOA 1GBHA 4BNRA 1SG8B 1ZMJA 1DY8A 5DJ7A 1KXDA 1EB2A 1MTUA 4UDWH 3SGQE 4BTIB 3U8RH 3EQ0H 3SJKA 2GKVE 1VJ9U 2F4LA 4OS7A 1MD7A 4FUBA 2XBVA 3A80A 2C8YB 4NG9H 3ZZCA 1HUTH 1P11E 1HAVA 5DK1A 3BN9A 1FQ3A 1GHYH 2PWXA 2RDEA 2YMSD 2ZTXA 3TH3H 1FY8E 4BXWA 1H9IE 3FOAA 1NRNH 4RN6A 5JYIA 3OE7D 3PMAB 4K3JA 1C1NA 3UY9A 1YLDA 4INHA 2GCHF 1U6QA 3TIUA 1WV7H 1Z6EA 3EYDA 4A92A 2WUBA 3BEUA 1HAIH 2P59A 4QT8C 3MTYA 4TWYA 3CS7A 3KQEA 4FU7A 1UHBA 3EE7A 2K1QA 1MTVA 1G36A 5HIZA 1OSSA 1W13U 2FS9A 2W3IA 5DP9A 2BX3A 1GBLA 2ZEBA 2EQNA 4GHQA 1RFNA 3TJOA 1NFYA 2EI6A 3AVZA 3CS0A 1ELDE 2HNTE 1D6WA 5DKMA 3SN8A 2DE8A 1M9UA 1A0LA 1TGSZ 3A82A 1H9LB 1MKXK 1RTFB 1O36A 4LOYH 2RFKC 3EE0B 1UK3A 2CK3D 1C2JA 4MDSA 1DDJA 2CN0H 2ZGHA 2A1DB 2SGEE 4ZAEA 2Y6TA 3SHCH 3IWMA 3VB7A 1CT4E 1Y5BT 2W6JD 2FIRH 1EX3A 3I78A 1GG6B 3RXAA 3MH5A 3ZZ3A 1RRKA 4ZH8A 1HAZB 1MABB 1TA2A 3A8BA 1F0RA 1TNHA 3RLWH 4Y7BA 2XBXA 1SLWB 3LGIA 3F0PA 4KGAA 1WBGB 2RA0A 2R3YA 1IQMA 3A88A 4H6TA 3M5NA 5C94A 2AEIH 2J95A 1NM6A 3SU5A 2J5UA 2A4RA 3SI3H 3GISB 4AORA 1ELEE 1QBNA 5DGJA 2ZCHP 1O30A 2BY7X 3QLPH 3TH2H 5LPEA 2A31A 4GVUA 1HLTH 2VH0A 2XCFA 3V0XA 1XXDA 3ZZBA 2J94A 1WOFA 1ZTKA 3V13A 1GHVH 1O2OA 1VCQA 1TGTA 1WQSA 3LGTA 1YYY1 1F5RA 1XVMA 4D9RA 1BA8B 1BZXE 2PSXA 3K65B 1XUFA 1DOJA 4LZ4B 1QRZA 2ESTE 2VVUA 4AFSA 1O2WA 1TRMA 3OFND 1CSOE 2O8LA 4RSPA 3GICB 4YTAA 3URCA 1SKYE 1DPOA 3GY7A 4B2AA 5FBIA 1ARBA 3K6ZA 4MNVA 1MTSA 1VJAU 4BAQB 4BAOB 3GY5A 3FAOA 4FUDA 1THSH 1MH0A 2EC9H 4X2WA 1HPGA 2HOBA 3ATKA 3LIWA 3LT3A 2GT8A 3A83A 4DCDA 2JETB 2VJ1A 1KLTA 1CBWB 1BMMH 1CQQA 2FI4E 1YWUA 1UTMA 1K1JA 4FUEA 2H5DA 1O2VA 3KCGH 2ZQ2A 2M5TA 1FUJA 1GI7B 2HRVA 3GCHB 1V2LT 3DSGA 4IC6A 1GJDB 1MTNB 3PMBB 1O2KA 1DUEA 1C5MD 2LPRA 2XWAA 1SGNE 3QWCH 4MTBA 2NU3E 3A7XA 3SBKA 3WWFA 1OX1A 4VGCB 3O8CA 4BTUB 3A8AA 3RXSA 3TU7H 1S81A 5ESBA 1SGQE 1E1QD 2GX4A 1AQ7A 1IQFA 3A81A 1GI1A 1G2MA 1LPKB 3SOSA 5KGOA 1DLKB 2ZU3A 1THPB 3PMJA 4WVPE 1O2IA 1DS2E 1QJ6B 1ZTLA 3NXPA 1AE8H 1GBIA 3NPSA 4GUXA 4TY6A 1Z1IA 3M37A 1GDUA 3S9BA 1NESE 1UCYK 1MTNC 2QN5T 2D2DA 1YM0A 4DIIH 1IQNA 5CHAC 1HJ8A 1DANH 2BZ6H 2G5VA 4ACBA 3RU4T 2L74A 3TGJE 1SGPE 1SQRA 1K1MA 4WMFA 4A1XA 3GYLB 1NU7B 3A7YA 4KKDA 1V2VT 1E38B 1IQEA 1WTGH 3MO6A 4FUJA 5C67A 1LKAA 3M35A 2ZCKP 1TYNA 3A7WA 1GBFA 4NA7A 2ZDKA 5SGAE 3D49H 3UTUH 3GS9A 1SHHB 2ZA5A 1O2HA 1O2MA 1DICA 1GI2A 2HLCA 1Z7KA 2I6SA 1TNKA 3L6PA 3OU0A 1A5IA 1J8AA 1EP6A 4J1YA 3EGKH 2XRCA 3M5LA 1UO6A 3MNXA 2AHME 2WZQA 2KAIB 1T8MA 3SORA 1AVGH 1ZZZA 1Y3XA 1UTJA 1O2GH 1Y5UT 1A61H 3S69A 1AE5A 3E0PB 5CHBA 1C5ZB 4UEHH 3FN8A 1IQJA 1ELAA 3RXQA 2GDEH 4B71A 1OWDA 4K1EA 3SV7A 3SV2H 1K0HA 1PPHE 2G00A 1B0FA 3GY3A 1EAWA 1MZAA 4X8SH 1P04A 2JH0D 2BTCE 3SNCA 4RKOB 2UUYA 1SFIA 3LU9B 2ZPRA 2GD4B 4JYTA 2NU0E 3F6UH 2BDYA 3VB3A 2ZECA 3BEFB 2AGGX 3QX5H 2GTBA 4Q80A 1QB6A 1VZQH 2R9PA 1C2GA 1QIXB 1OP8A 4YESB 1O3JA 2XXLA 4NZLA 4I8GA 1V2RT 1BBRK 2WUCA 4A7IB 1HXFH 2V3OH 3P6ZB 2RG3A 5GDSH 2CV3A 1O5AB 3MMGA 1YPJH 1FNIA 1NFWA 4FU9A 1HXEH 1MTWA 5LPRA 3S9CA 2WV4A 1VITF 3UAIC 3IG6B 4ABEA 3UR9A 4K60A 3P8GA 4Q2KA 5DP6A 1S6HA 4B73A 4MQAA 1O5BB 1S6FA 1SVPA 1EPTA 2H9EH 1YPGH 4XBBA 2ZZUH 5EPYA 3LONA 2H1UA 1VITG 2NU1E 1DSTA 1DVAH 1DX5M 1QR3E 3RMOH 1THRH 3S7KB 5A0BA 3OYPA 1QB9A 3L33A 1TOCB 2VVVA 4WJG2 2V35A 1ZLRA 4DURA 5F8TA 4XDEA 2SGFE 3GCHC 1O2PA 2ZF0H 3VGCB 2SNWA 1GMDG 5DPAA 1HNEE 2EI7A 1ID5H 4TSFD 1BJVA 4CBNA 4ASHA 1YPHC 1D3PB 1EUFA 1T8LA 1HGTH 2ZTYA 3F2GA 3LGUA 5C0TA 3SZEA 4B6FA 1O2XA 3RXPA 5FCKA 1YC0A 1O2QA 4AC9A 1AY6H 2GCTC 3ATWA 3M61U 1FN6A 1N8OC 3RXTA 2HGTH 4F55A 5A09A 4AGKA 2UWPA 4TWWA 1EP5A 1TRNA 2WYJA 2HLDD 1L0ZA 3MNBA 4E7RG 1FDPA 2BD8A 1SGFG 1SQAA 1CU1A 1C5LH 1HV7A 5EPNA 3D23A 3E6PH 3NKKA 2GCHG 1DWCH 1O2NA 3OSYA 2CF8H 1C1WH 2HNTC 1Y3YA 4E06H 4O3TA 2W26A 2BMGB 3U9AH 1SPJA 2Z6BD 2BVRH 1GI9B 3WW7A 1HIAA 2BD3A 3RXUA 4MPUA 5A8YA 5F6MA 1O2RA 1QBOA 3PLBA 4HG6A 1QQUA 2QCYA 2XCNA 4LZ1H 1EZXC 5CDFE 2GV7A 1O3OA 2O8WA 4CRDA 5EW1H 2YNAA 2WPDD 3RC5A 5DP4A 1YLNA 4Z6AH 1FY4A 3VB6A 3MI4A 1V2NT 1ZRBA 1GBCA 5TCAA 1OYQA 2Y5GA 3LJJA 2D8WA 3UNRA 2QXIA 4YOJA 3A7TA 1GGDB 2GMTC 4X1RU 1C5OH 2H2ZA 4WXIA 1O3GA 4NGAH 2ZFPH 1LCYA 1VCWA 1G37A 2AGIX 3P17H 7KMEH 3RXOA 3VXEH 3PMHB 1H1BA 4A1VA 1CA8B 2Z3DA 1EOLA 5HXFA 3UIRA 1GVLA 4MPWA 2ZIQH 7ESTE 2ZKSA 4X6PA 2D26C 3ZZDA 2PUQH 2OLGA 3LPRA 2ALVA 3T62A 4F4OC 2UWLA 1XKBC 5HYOA 2BXUH 3BTME 1ZHMA 4MPVA 4FVBA 3K9XB 2LELA 4MLFB 1ETTH 2JETC 3VPKA 1Z8JB 4BAMB 4HI3A 5FXLA 4X1PU 1NC6A 3NZIA 1MCVA 2BLVA 4IGDA 1F5KU 3OTPA 3RUOA 3UOUA 5A0CA 1V2TT 4OGXA 2ZTZA 1BRBE 1F5LA 1MQ6A 2SGAA 4AN7A 1ZPCA 3RXMA 1YF4A 1UW7A 4IMQA 2B7DH 4AGJA 4CBOA 1O31A 1O34A 2C90B 3PRDA 2FTMA 4DY7B 3TJNA 1A7SA 1ZSKA 2QXGA 4ABGA 3RU4E 3RXRA 1C5YB 3E16B 3PWBA 2XC4A 1MMJN 1EKBB 1PQ8A 2XW9A 1H9HE 2BDGA 1MAXA 3BTFE 2P8OC 1J16A 1TBZH 1O2TA 1QJ1B 2EEKA 2ZDAH 1OYTH 4CREA 2B5TB 1BITA 1A46H 3QZQA 2Y5HA 3N7EA 1DT2A 4J2YB 5L6NH 1KSNA 2HWLB 2QGRA 1TIOA 6GCHG 1S6LA 3B23B 1XMNB 2PW8H 4ZXXH 2FI5E 3E0NB 1ARCA 1TX7A 2F91A 2FM2A 3VG8A 2J97A 2AH4X 1KTSB 1G3DA 1GVZA 2AFQB 1NTPA 3NCLA 1L2EA 2A4OA 3RMNH 1MKWK 5K0HA 1ETRH 1H4WA 1K9OE 2GZ8A 3OX7U 3BEIB 3S9AA 1O3NA 4GSOA 1AFQC 1JIRA 2FOAA 3MU1A 2J34A 4X2XA 1GBKA 1W7XH 3TJVA 1TPPA 1O3HA 1KXEA 4WMDA 2Z3CA 4CRFA 3F2FA 1GBEA 1CT0E 1EJNA 5EJ1A 2J9NA 1AI8H 1GCTB 3MO3A 4I8LA 1V2WT 3EA8A 2XNDD 1YBWA 4IN1A 3SU6A 5GNDA 4IW4E 1EFRD 3GCNA 1ZMLA 4I31A 3ZZ5A 1PYTC 1UTOA 1XUGA 3F9HA 3UNQA 1G3EA 3JZ1B 1GL0E 2SGDE 2PTCE 1BMLA 2CXVA 3QTVH 5J4SA 1Z8GA 1UCYE 4K69A 4CH8B 3RXCA 4NA8A 1PPEE 2WINI 3E90B 3HPTB 3BG4C 1BOQA 2VU8E 2PSYA 4O97A 1FY5A 3RXJA 1O0DH 1CA0C 3FP8E 1VCPA 1C5RA 2TGPZ 4E7NA 2V6NA 1K1PA 3RXDA 1OP0A 1BUIA 4Y11E 2DUCA 4DT7B 1C2DA 4XBDA 4WY3A 1LQEA 1W0KD 3V3MA 1TRYA 4SGAE 5EU8A 1BRCE 5C5OA 3RXKA 1BMNH 1GMHF 1KDQA 1O3DA 5J4QA 1QGFA 3GY4A 5C20A 1SGFA 1S83A 2FDAA 3DA9B 1RS0A 2PLXA 3B9FH 2BDCA 3BG4B 4NFFA 3QTOH 3H5CB 1FXYA 4WMEA 2J2UA 1XKAC 3FZZA 2FP7B 2V7QD 1J17T 3VB5A 1P0SH 3V12A 4UFGH 2BHGA 1PYTD 3KQ5A 1AKSA 2Z9IA 1K1OA 5F53A 1TX6A 1SQOA 5A2MH 3TNTA 2OC1A 1HAPH 3T5FH 3LC3A 2QXHA 1P10A 3QO6A 4JZFH 3U28C 4AYVB 1GGDC 4ZHMU 2GDDA 5EQRA 2O8UA 3FZDA 4AG1A 2F9VA 2Y7ZA 3SV6A 5FAHA 3ZZ9A 1C1UH 3HKJB 3PTNA 4U2WA 1GDQA 7GCHG 2R3UA 1Q31A 1SMFE 4B74A 1KIGH 2HVYB 4Y8ZA 2R0LA 2OBQA 1E36B 2OC8A 1SFQB 2WYGA 3KN2A 2HPPH 3ZYDA 3ZZAA 2ZHDA 3LDXH 4YLUA 1EASA 4INKA 5FHTA 5DSFA 1TBQH 1GBMA 3I77A 1YPKH 5LPFA 3RU4D 4OGYA 4UFDH 3HK6B 5FBEA 1KY9A 2ULLA 1V2MT 1C5TA 1SB1H 1O2YA 4U30A 3MH6A 1SLXB 2FTLE 2OP9A 4Q7YA 2FXRA 2FOFA 3VGCC 5DP5A 3ZVCA 1G3BA 3ZVBA 1GWAA 2P94A 2XC0A 3TJUA 3TVJB 3TGKE 2CGAA 4JZ1A 1GHBG 3GCTF 3O8DA 3MNSA 1A0JA 1YPEH 2ZPQA 4X1SU 5KECA 3SUDA 2Z94A 1T31A 3D65E 1BB0B 1HAGE 4AFUA 3GOVB 5BRRE 1D3DB 3GDVA 1C1QA 2ZPSA 1P57B 1ZPBA 3MH7A 3QZRA 5LGOA 1H8IH 1NRQH 1FMGA 4XD7D 2Z9GA 2VVCA 5EQSA 1C4U2 4Q4LA 2A4GA 3S7HB 4XOJA 3TNSA 1ABJH 3RMMH 4AX9H 1O32A 2ZDLA 1GJ6A 1Z8RA 3P8OA 1ZGIA 1LHFH 4UE7H 5JPMH 2XYAA 8GCHF 1GHAG 2ODPA 1OWJA 1Q2WA 2P3UB 4NWLA 1HAHH 4CRAA 1C1VH 1L1NA 5AF9H 3KNXA 5GWZA 2Q6FA 2A32A 4Q7ZA 1ZMNA 3A8DA 2K0QA 3UWIA 1KXCA 2R0KA 2VB0A 2PUXB 1Z71A 3OY6U 1SGTA 4ABJA 1KXBA 1O5FH 1YPLH 2XBYA 1Y5AT 2ZU4A 2Y81A 4I7YH 5EQQA 1IAUA 4MG3A 1AZ8A 1Q3XA 3QGJA 1O3LA 1UTQA 1SLUB 1TMTH 3A85A 1XUJA 3GY2A 4GLYA 4CRBA 5EIYA 3GDUA 3NK8A 2TGAA 2VH6A 1NROH 3UQVA 1T8OA 2JJ1D 2XC5A 1P12E 1ZYOA 1GMHG 4KELA 3MOCA 4K2YA 3RXGA 1BTUA 1A4WH 1P01A 2P95A 3DCLA 1ANDA 1PPGE 4ZHLU 2AIQA 1RXPA 3QK1A 1GHXH 2G81E 4HFPB 2FPZA 1DUAA 2FOBA 2UWOA 5PTPA 4IN2A 1PPCE 1F2SE 1UK2A 1W11U 2IN2A 3GCOA 3M3SA 4DIHH 2BDHA 1T7CA 5JBCS 1C1OA 1N6YA 1XM1A 5C1XA 3GY8A 5DP3A 1LHEH 4ABBA 1NBMD 1Y3UA 1O5CB 1P06A 4GAWA 1HCGA 2BQWB 3U1IB 2J38A 1P2NA 2FS8A 3P95A 5EOKA 3SU3A 2BYAX 4FVDA 1QNJA 1OWHA 3C1KA 3EA9A 1UVSH 2ANKH 1GBAA 1Y3VA 2H9TH 1O38A 2KAIA 4FUFA 2QV1A 1O3IA 4CRCA 1S5SA 2AYWA 1UVUH 2GVFA 1ZGVA 4ZMAH 1SGYE 4K5ZA 1V2PT 1WU1A 2A7HA 2W7UA 3HGNA 1XX9A 2A7JA 4RT1A 1W14U 2FMJA 1JBUH 1JIMA 4Z0KA 4AOQA 4R8TB 2R2MB 1GBJA 1QQ4A 2G52A 1LMWB 1O3PB 1H8HD 3BG8A 1O3BA 1ZJDA 2BB4A 2F43B 4NWKA 2QF0A 4K1TA 4YZUA 2GJGA 5EXMA 1O33A 1WCZA 5FPYA 3KL6A 4Y0ZE 6LPRA 3F0OA 1G30B 3SGAE 2FEQH 4GHTA 2VIWA 5JBTA 1L1JA 2XNIA 3E1XB 4P00A 4TPIZ 3O8BA 3BF6H 1W12U 4DGJA 4KTSA 8GCHG 3BTDE 1G32B 4X8VH 3RXBA 1S84A 2ZP0H 4B75A 1GCTC 1K1IA 1E1RD 1BCUH 1PQ5A 3UQOA 1SI5H 1VGCB 1LVBA 3N99A 1YPHE 1EB1H 1O3KA 2AIPA 1UTLM 3SUGA 1ZHRA 2FI3E 4Y8XA 2ZHFH 1QB1A 1FIWA 1UCYH 1MKXH 5C1UA 2ANYA 2A2XH 1ZOMA 4ABFA 2J98A 1P2MA 2SGQE 2WPLS 1C5UA 3M7QA 1HAOH 4ZKOU 1T32A 4JYVH 1T8NA 2OCVB 2VIDA 1SR5C 3MYWA 1AIXH 1GVKB 3BV9B 3ZVGA 5H4IB 1Z6JH 2QYIA 1IQLA 4JCNA 3SW2B 3SU1A 4X8UH 1RD3B 4DJZB 1EAIA 1T4VH 4A1TA 2VNTA 4NCYA 2P16A 3SYJA 1DXPA 3CP7A 1YP9A 2B8OH 5DO4H 3MHWU 2ANWA 1QA0A 1BIOA 2ZDNA 1NT1A 3T29A 5LH8A 1L1GA 4X6NA 3QGNB 1V2QT 4F49A 1GJ7B 3EA7A 1WTHD 4WWYA 1K28D 3KGPA 2OQ5A 2PKAB 2OC0A 1TBRH 1C2HA 2G55A 4I8JA 3WY8A 2EA3A 3SI4H 2C3SA 1W0ZU 1LDTT 2GV6A 1YCPK 2BY5X 2CJIA 5C0UA 3TK6A 5HKKD 5CE1A 3ODDA 1O2ZA 5DG6A 3SUFA 3SNEA 1BMAA 1E37B 4Y7AA 2ZU5A 1KLIH 2Y7XA 1KXAA 3E8LA 5A8ZA 1QBVH 2C8ZB 3Q3KA 3SU2A 2ZFFH 1DXWA 1UTPA 3BIVH 1HFDA 4D9QA 1GJCB 3PRBA 4PROA 5I46H 4JMYA 3KYFA 1EZUC 3BTTE 2BLWA 4H42U 4B1TA 2ZQ1A 1A5GH 2SNVA 2W3KA 1O2SA 5TJXA 1CHGA 1LQDB 4AFZA 4ISHH 1FJSA 2WHXA 4Y71A 1KYNA 3PLPA 1NU9A 3BTEE 1WSSH 3RXEA 1O39A 1TNGA 1CBWC 4NIWA 1GJ4H 2KCAA 2I6QA 1MU6B 3ZVAA 1FPCH 2PHBA 2J92A 2BDAA 4MVNA 3SJ9A 4OS4A 1O5DH 3ZIAD 1JRTA 3MU8A 1FLEE 1BMFD 3IITA 4ABHA 2DE9A 1K1NA 1CE5A 2CHAC 3G01A 1GHZA 4ABAA 1IOEA 3M7TA 1YKTA 3A86A 1TONA 4ZXYH 1GCDA 3SQEE 1ZJKA 4AG2A 2AGEX 9ESTA 3T2NA 1EZSC 5ETXA 1F0TA 1JWTA 8LPRA 4LK4A 1GI3A 2Y5FA 4ZCNA 1ESAA 2M2AA 1MBMA 2PV9B
chains in the Genus database with same CATH topology
1ANBA 1OOKB 3ZZ6A 4B2BA 2AMQA 2QY0B 1AUJA 1UMAH 3ODFA 1MZDA 1UJ1A 2C4FH 2STAE 3VEQB 4TY7A 2Q1JA 4ZKRU 1FIZA 1O2UA 2Z7FE 2TGTA 3BTQE 2F83A 1W8BH 1MQ5A 3UOPA 2ODYB 1FN8A 1GBTA 1C5NH 1NFXA 5L2YH 1LPGB 1TPOA 3F9EA 3ELAH 2QAAA 1XXFA 2ALPA 1GJ9B 2ZFSA 2Z3EA 1NPMA 4FXGH 1J9CH 2BY8X 3SNAA 2W7SA 4K8YA 3SV9A 1GI4A 3U1JB 3BTWE 3T25A 2A0QB 1GI6A 1C2FA 1K1LA 1TPSA 4GCHF 1AB9B 2FO9A 4TYDA 2ZFRH 2ZCLP 2UUJB 1QRXA 3S0NA 3T26A 4NA9H 1BRAA 1IHSH 1HAYB 4K8BA 2P3FH 2C8XB 2OUAA 2QF3A 1HJ9A 1HIAB 3M36A 3MU0A 1QL8A 1BHXB 1P9SA 2QC2A 1G3CA 2BVSH 2FOGA 4UFFH 3AAUA 2RCEA 1ESTA 5GCHG 2EI8A 3SU0A 1RIWC 1HAXB 2VGCC 4I33A 4XSKU 2A45B 1V2OT 2OINA 4OS5A 2ZWLH 1BTZA 3C27B 1TPAE 4JZEH 2ZI2H 4LXBH 5AHGH 2BM2A 3SNCA 2BOHB 5GPIB 1GG6C 1AU8A 2O8TA 3A89A 2TGDA 1SOZA 5E2PA 2G51A 4CHAC 1Z1JA 1O3EA 3N7OA 2IOTA 3Q00A 1TQ7B 1D3QB 1AB9C 3V7TA 3DFLA 3PB1E 4TPYA 1SLVB 1N6XA 2GMTB 3R3GB 2IJOB 1QFKH 5C2ZA 3ZZ8A 1HYLA 1VITH 1J14A 1D3TB 1AUTC 2ZGXH 2ZGCA 1IQKA 3L3TA 3SNBA 2F3CE 1BTWA 1WAYB 1GJAB 2BD4A 3OTJE 3QUMP 1GHBF 3GCTG 2LNCA 1EOJA 1GMCF 3Q77A 1P2IA 3ESTA 1W0YH 1XUHA 1LO6A 5E8EH 1S82A 4VGCC 1D4PB 1IQIA 1P3CA 1LHGH 2FESH 1EPTB 3RM2H 2FOHA 3ATMA 2ZU1A 1C5PA 5GCHF 2VWOA 3LGYA 1JRSA 1CVWH 2A4QA 1SQTA 1ZHPA 1EATA 4XFQA 2RDLA 4INLA 1HJAB 1KXFA 1RTLA 3PTBA 3U98H 1H8DH 3STJA 4CRGA 1B0EA 1GJBB 4YOIA 1A2CH 1LVOA 1BHXF 1RGQA 2BY9X 2H9HA 1C9PA 2GZ7A 4GCHG 1CO7E 3T28A 1LVMA 2GP9B 3EDXB 2ZHQH 5E2OA 2G4TA 3LJOA 5JB9S 2G4UA 1P03A 2PKAA 3PV4A 3JZ2B 3P8FA 2BLOA 5A8XA 1TLDA 2ILNA 1AFEH 2Z9LA 4A6LA 1NRPH 1BDAA 1OS8A 2G8TA 2GCTB 1EXFA 1SGIB 1XUKA 2B9LA 3Q3XA 3ZV9A 1G9IE 5T3HA 1TWXB 1P2QA 1C1RA 2BQ7B 5K7RA 5F8XA 3AW0A 4AZ2B 1JMOH 1DWEH 1V2UT 3F68H 2YOLA 4ZUHA 3KQDA 4FU8A 1UHBB 3PO1C 1NO9H 1UVPA 1QRWA 1C9TA 1ETSH 2NWNA 4E05H 1AZZA 1C2IA 1TE0A 2YNBA 2GZ9A 3DUXH 3ITIA 2CHAB 4CH2B 3QDZB 3DFJA 1F7ZA 3SU4A 2NU4E 1SGRE 2OXSA 3AW1A 1D9IA 3KEEA 1ELCA 3A8CA 3B8JA 3P70B 2FX6A 3RLYH 1HJAC 1OWEA 1J15A 2FYQA 4X2VA 1C5XB 4WF8A 5AFYH 2HALA 1LVYA 3U8OH 2WPKS 1Y3WA 1EAUA 1DWDH 1MBQA 1PQAA 4WXVA 4CHAB 1C1TA 4JZIA 4M7GA 9LPRA 3TLOA 1FY1A 2WPMS 2FX4A 1BTXA 4IC5A 4D7FA 4FUCA 2PGQB 1C5SA 2VGCB 3BTGE 5G4BA 4GPGA 2Y80A 3RDZA 2FOMB 1UTNA 1FAXA 1DFPA 1UTKA 4ZHAA 1O3AA 3FFGA 3PROA 3KF2A 4YLQH 5HM9A 2BVXH 1AGJA 1QTFA 4ZKSU 3EAJA 4XBCA 5ESTE 1Y59T 1P3EA 3AAVA 3LC5A 3NUMA 4NSYA 1N1LA 1INCA 2A5AA 5E0JA 2J4IA 1V3XA 2H5CA 4X1NU 4YT7H 5L30H 4ISNA 5EXNA 1A5HA 3RXVA 2IPHA 1O2JA 4U32A 1NRSH 3M7UA 2HNTF 1B5GH 2WPHS 4NIXA 1PPZA 1ELFA 1JOUB 7GCHF 5IYTA 5ABWA 3M3TA 1GJ5H 4H6SB 1ACBE 3ATLA 1ELTA 2PGBB 5GIBA 2V3HH 1LKBA 1ANEA 1QL7A 2XBWA 1QJ7B 1DWBH 3SJIA 1LTOA 4NFEA 4AB8A 1SBWA 4WH6A 3E91A 4MNXA 1YPMH 1QCPA 4X0WU 2JH6D 1CT2E 1TNIA 2AS9A 4KTCA 3ZYEA 1AWFH 1ORFA 1W7GH 8ESTE 2ANMH 1CHOG 1N8OB 1AFQB 1MCTA 1SOTA 1TFXA 3SNDA 1TGNA 1X7AC 1K22H 4ESTE 5JB8S 1L4ZA 1WQVH 5DP8A 4OS2A 2H6MA 4CR5A 2A5IA 2ZU2A 3ZZ7A 1FPHH 5GJ4B 2QIQA 1XVOA 4X8TH 1SHYA 3HK3B 2BQ6B 3GDSA 5CHAB 3W94A 1P2OA 1Z8IB 2XWBI 4ZROA 3RXIA 1QA7A 1G2LA 2F9PA 5EODA 1CGJE 4JK5A 1GL1A 1QL9A 4HZHA 5BPEA 1TNLA 5T6GA 4K1SA 3E3TA 3SHAH 2PKSB 2Q6DA 1GHWH 1CHOF 1XUIA 2UUFB 3TK9A 1IQHA 2STBE 4DVAU 3ATIA 1MD8A 4AYYB 3SJOA 2BD9A 3PLKA 3Q76A 1GBBA 2OD3B 1P2KA 2ODQA 4IBLH 2AMDA 1TMBH 4CR9A 1TX8A 2ZHWH 4MPXA 1BBRH 1QHRB 1TGCA 1P2JA 1AVXA 2OTVA 1DSUA 4FUGA 1P05A 4Y6DA 1TQ0B 1O3FA 1UK4A 4MNYA 1DITH 1TOMH 3TH4H 1VR1H 1ANCA 4DW2U 1C2KA 5B6OA 1BBRE 1O35A 5TCCA 3SJ8A 1A3EH 1E0FD 1FY3A 3VXFH 2AERH 2FYRA 1W3CA 3KHVA 1TNJA 3TPIZ 1B7XB 3BSQA 1O3MA 1GI5A 3MNCA 4X2YA 5IDKA 1Y8TA 3KQBA 1ZTJA 1MU8B 2BDIA 2V0BA 4DOQA 1NFUA 3Q3YA 3UREA 3RM0H 2HVXA 2A5KA 2FLRH 3RXFA 4D8NA 5E0GA 1YCPM 4JYUH 5EGMA 1FI8A 2ZHEH 1GHAF 3HKIB 1S0RA 4YO9A 1A0HB 6CHAB 3SQHE 2JH5D 3UPEA 1L4DA 2A2QH 5C3NA 1NS3A 1HRTH 5T6FA 5LPFA 2THFB 2G5NA 3CENA 4UD9H 3FP7E 1FZZA 2F9UA 4OS6A 5FX5A 1TAWA 1ZPZA 1GMCG 3HATH 3MH4A 4Q7XA 3DD2H 1PJPA 3RMLH 1T4UH 6GCHF 1MKWH 4HGCA 1C1SA 3H7OA 3RC4A 1AHTH 1WUNH 1ESBA 1F0SA 2OC7A 1QY6A 1SC8U 2SFAA 1BT7A 1BTYA 5FCRA 2D1JA 1PPFE 3K6YA 1C5WB 2WV5A 2BLQA 5GXPA 1TALA 1EJAA 2UUKB 5F03A 4H4FA 3DT0H 3UFAA 4DG4A 1FV9A 1AWHB 2CMYA 2F9NA 1A3BH 2VIPA 4SGBE 1C5VA 1DLEA 2FLBH 1EJMA 1V2JT 3TITA 1NZQH 1FAKH 1RTKA 3MO9A 2BZAA 4B76A 1C1MA 2BD7A 1LHCH 4UFEH 3F9FA 5DP7A 2PTNA 4THNH 3ZV8A 1P9UA 1BRUP 1VGCC 4R0IA 2BD5A 3M5OA 3UWJH 2ZG0H 3GY6A 1BTHH 1GBDA 1EAXA 1C4V2 1UVOA 3TGIE 1K2I1 8KME2 1RJXB 1BQYA 4MNWA 1W10U 3VB4A 2A7CA 1SGCA 5FX6A 1TGBA 3LGWA 3SZNA 1S85A 3LH1A 1C1PA 1DY9A 4KTUA 2TIOA 5CMXH 1GMDF 4AFQA 3T27A 4RKJB 2BDBA 1YCPH 1OKXA 2WPJS 3GYMA 4OS1A 1ZRKA 2TBSA 5C5NA 1D6RA 5HM2A 1NN6A 4BAKB 1GDNA 2BOKA 5JBBS 4BTTB 1DE7H 2BY6X 1F0UA 1E35B 2AMPA 3BTHE 1SL3A 3U69H 2QXJA 3UR6A 3URDA 1C2LA 1SGEE 2O8MA 1IHTH 3FP6E 5T6DA 4YM9A 3ENSB 3BIUH 4BOHA 3F9GA 1O5GH 1TMUH 3K2UA 2XTTB 1TABE 1HDTH 3PO1B 4JK6A 1PQ7A 2TPIZ 2ZGJA 4ISOA 3MU5A 1GI0A 3LGVA 1DM4B 5EXLA 1ZSLA 1AO5A 3P92A 5FPTA 3O8RA 1IQGA 3A84A 1SGDE 1KLJH 3STIA 1ABIH 4XE4A 4ABDA 1RIWB 2OBOA 1BTPA 4NIYA 2P3TB 5HMAA 2Z9KA 1TB6H 3KQCA 2FOEA 3RP2A 4NSVA 1C2MA 3BTKE 1O3CA 3W95A 4U01A 1HBTH 3M5MA 4BXSA 4FUIA 2VWLA 1KTTB 2ZDVH 3PWCA 5HGGA 3RXHA 2SGPE 1CGHA 3A7VA 5AVDA 4IMZA 1OWKA 2P8OB 4I8HA 3FANA 4X1QU 3SO3A 1E34B 1HB0B 2P93A 4WH8A 1ELGA 1BJUA 2ZNKH 2Z9JA 3P8NA 3R0FA 1AMHA 5A0AE 3MU4A 3OY5U 4HTCH 1O2LA 2TRMA 3ZVDA 1K21H 3KIDU 4I8KA 4D7GA 1GJ8B 5EW2H 3H7TA 1EPTC 1TA6A 1OXGA 3ZVFA 3ZZ4A 1CA0B 4FUHA 1AD8H 1LHDH 2BD2A 1O37A 3I29A 2BXTH 1NRRH 4YOGA 1WYKA 1JXPA 4I32A 2B0FA 3M3VA 1ELBA 4O03A 1W2KH 2FOCA 4UONA 5C1YA 2F9BH 1OWIA 3UUZA 3RXLA 3AASA 1ZSJA 3SGBE 1GI8B 1FONA 1MUEB 7LPRA 2QA9E 4AB9A 1AVWA 4Y76A 5FPSA 3VFEA 2ZC9H 3F1SB 5I25A 2JKHA 1YGCH 1S0QA 4Y10E 1ELVA 2PR3A 4Y0YE 3ZVEA 1KDQB 1C2EA 1SSXA 1CGIE 4D76A 2VINA 2ZDMA 3LOXA 2PKSC 2O9QA 2OQUA 2VWMA 4O9VA 1V2KT 4O3UA 1V6DA 3HGPA 1GPZA 2ZFQH 3MWIU 2HPQH 2PFEA 1MAYA 5AFZH 5JDUB 2W5EA 1QURH 4ISIH 1EZQA 2FODA 1A1RA 5F8ZA 1O5EH 1EQ9A 2RA3A 3SUEA 1F92A 4Y79A 4ABIA 4NIVA 4BANB 2GGVB 2ZGBH 3NWUA 4IS5A 2Q6GA 4ZKNU 3D62A 4ISLA 3A7ZA 2CF9H 1P8VC 4A5TS 1C4Y2 5L2ZH 3RC6A 4JZDH 2VIQA 5E0HA 2WPIS 1OP2A 5EG4A 1NY22 3TK5A 4NZQA 1OPHB 2VIVA 3QN7A 1PPBH 2F9OA 3PYHA 1V2ST 3LKWA 3DHKH 1P09A 2ZO3H 4BAHB 1YLCA 4KP0A 4YT6H 3FVFB 2ZFTA 3SV8A 3A87A 5JBAS 1HAVB 2ASUB 4X6OA 4X6MA 3UNSA 4B2CA 1PFXC 3MFJA 6CHAC 1P02A 2R2WU 2FZZA 1C5QA 2GT7A 3LH3A 1LPZB 2FWWA 2C8WB 3PM3A 1AN1E 2Y82A 1UVTH 6ESTA 1AKSB 2C93B 1ZR0A 3U8TH 2BX4A 4Y8YA 2VWNA 2NU2E 2VIOA 1GBHA 4BNRA 1SG8B 1ZMJA 1DY8A 5DJ7A 1KXDA 1EB2A 1MTUA 4UDWH 3SGQE 4BTIB 3U8RH 3EQ0H 3SJKA 2GKVE 1VJ9U 4OS7A 1MD7A 4FUBA 2XBVA 3A80A 2C8YB 4NG9H 3ZZCA 1HUTH 1P11E 1HAVA 5DK1A 3BN9A 1FQ3A 1GHYH 2PWXA 2ZTXA 3TH3H 1FY8E 4BXWA 1H9IE 1NRNH 4RN6A 5JYIA 3PMAB 4K3JA 1C1NA 3UY9A 1YLDA 4INHA 2GCHF 1U6QA 3TIUA 1WV7H 1Z6EA 3EYDA 4A92A 2WUBA 3BEUA 1HAIH 2P59A 4QT8C 3MTYA 4TWYA 3CS7A 3KQEA 4FU7A 1UHBA 2K1QA 1MTVA 1G36A 1OSSA 1W13U 2FS9A 2W3IA 5DP9A 2BX3A 1GBLA 2ZEBA 4GHQA 1RFNA 3TJOA 1NFYA 2EI6A 3AVZA 3CS0A 1ELDE 2HNTE 1D6WA 5DKMA 3SN8A 2DE8A 1M9UA 1A0LA 1TGSZ 3A82A 1H9LB 1MKXK 1RTFB 1O36A 4LOYH 3EE0B 1UK3A 1C2JA 4MDSA 1DDJA 2CN0H 2ZGHA 2A1DB 2SGEE 4ZAEA 2Y6TA 3SHCH 3IWMA 3VB7A 1CT4E 1Y5BT 2FIRH 1EX3A 3I78A 1GG6B 3RXAA 3MH5A 3ZZ3A 1RRKA 4ZH8A 1HAZB 1TA2A 3A8BA 1F0RA 1TNHA 3RLWH 4Y7BA 2XBXA 1SLWB 3LGIA 4KGAA 1WBGB 2RA0A 2R3YA 1IQMA 3A88A 4H6TA 3M5NA 2AEIH 2J95A 1NM6A 3SU5A 2A4RA 3SI3H 3GISB 4AORA 1ELEE 1QBNA 5DGJA 2ZCHP 1O30A 2BY7X 3QLPH 3TH2H 5LPEA 2A31A 4GVUA 1HLTH 2VH0A 2XCFA 3V0XA 1XXDA 3ZZBA 2J94A 1WOFA 1ZTKA 3V13A 1GHVH 1O2OA 1VCQA 1TGTA 1WQSA 3LGTA 1YYY1 1F5RA 1XVMA 4D9RA 1BA8B 1BZXE 2PSXA 3K65B 1XUFA 1DOJA 4LZ4B 2VVUA 1QRZA 2ESTE 4AFSA 1O2WA 1TRMA 1CSOE 2O8LA 4RSPA 3GICB 4YTAA 3URCA 1DPOA 3GY7A 4B2AA 5FBIA 1ARBA 3K6ZA 4MNVA 1MTSA 1VJAU 4BAQB 4BAOB 3GY5A 3FAOA 4FUDA 1THSH 1MH0A 2EC9H 4X2WA 1HPGA 2HOBA 3ATKA 3LIWA 3LT3A 2GT8A 3A83A 4DCDA 2JETB 2VJ1A 1KLTA 1CBWB 1BMMH 1CQQA 2FI4E 1UTMA