1Y3WA

Trypsin inhibitor complex
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A simple protocol to estimate differences in protein binding affinity for enantiomers without prior resolution of racemates.
pubmed doi rcsb
molecule keywords Trypsinogen, cationic
molecule tags Hydrolase
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2004-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1y3wA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1y3wA02
1ELGA 2VIVA 1V2RT 1ZPZA 2C8WB 1O2WA 3H7OA 2QXGA 4I8HA 1V3XA 1QNJA 4ZHLU 1CHOF 4ABAA 1C1OA 1LCYA 3MWIU 2FDAA 4WH8A 2ANMH 2OC8A 1T8MA 5ESBA 8ESTE 1J17T 4MPUA 1D3QB 2G8TA 2ZPSA 2VB0A 3UY9A 3SNCA 3MNSA 1C5XB 2SGEE 4Y10E 1N1LA 1SR5C 1HJ8A 3LKWA 2Q6GA 1F92A 3E16B 1QB6A 4SGBE 1EZSC 1HYLA 1C1UH 3B9FH 1LPKB 1T31A 1TOCB 3FZZA 1O2GH 3HK3B 3ZZAA 1TRMA 1UVPA 4WXIA 1SQAA 1V2ST 1YF4A 1W8BH 1A5IA 1AE8H 4THNH 1A4WH 2Y82A 2GMTB 4K1TA 5E0JA 2ZFTA 1Y59T 1EXFA 1G32B 2OBQA 1O3IA 2ZA5A 3D62A 3HPTB 1OWHA 3UNSA 5GWZA 4MNWA 3LJJA 5AF9H 1K1OA 1HJAB 1SI5H 1A3EH 1TQ7B 2BY7X 3VXEH 3V3MA 1E36B 2XWBI 1O2IA 2F9VA 3EQ0H 3MNBA 3M5OA 1ZMNA 2VGCB 1TNGA 3S9CA 3RU4T 1FV9A 2GKVE 1SLXB 1XUFA 1V2JT 4OS1A 2C8YB 6LPRA 1WU1A 4JK6A 4RN6A 1VCQA 1ZPBA 1YYY1 1DWDH 3TJUA 3SV8A 2AERH 1YCPK 2BY8X 1P05A 2CF9H 2FI4E 4A1XA 1S5SA 4BTTB 3ZVBA 3FVFB 4AG2A 1LO6A 3DHKH 3BTFE 1C4V2 2VIWA 1UMAH 1O3EA 1QR3E 3M3SA 3UOPA 3TLOA 1C5WB 1QJ7B 2CF8H 1O2VA 2XXLA 2H5DA 2SGDE 5EQRA 2BYAX 3CS0A 4NWLA 1IHSH 5HM2A 5FBEA 4ABFA 3GYLB 3URCA 4UONA 1L1GA 4X6NA 4B71A 1CA0B 5C5OA 1QCPA 4CRCA 3ZZ6A 1IQNA 1DM4B 1ZHPA 1C2DA 1FIWA 2Y5HA 2ZGBH 2Z3CA 4H4FA 1LVMA 1CSOE 1L4DA 2QXIA 5DP4A 1GL1A 2BD3A 4LK4A 3VB7A 1AVGH 1QBNA 1BCUH 1WTHD 1BMMH 3TITA 3SUDA 9ESTA 1LPZB 1GL0E 1DITH 2FMJA 1GGDC 3QDZB 3K6ZA 4NG9H 1MZDA 2FIRH 2A31A 4TPIZ 3TGJE 1GI9B 1DX5M 8GCHG 3FP8E 5A8YA 2ZG0H 4A1VA 1O3CA 1MAXA 1SGTA 1P04A 1F0TA 1IHTH 3VPKA 2VWNA 1GGDB 2F83A 1GI2A 2XC5A 1O38A 4NZLA 2GTBA 2J34A 2PW8H 1OOKB 2VH0A 1A46H 4B74A 1H9LB 2BOKA 1Y5BT 2CXVA 3MU0A 2AEIH 2F91A 2YNAA 3RXTA 4YESB 2C93B 2ZDNA 3IITA 3RXQA 1MTSA 3T26A 5L2ZH 1IQHA 3SI3H 4ZHAA 4WY3A 2KAIB 1C5ZB 1NZQH 1C5UA 3BIUH 3EDXB 1B7XB 1LVBA 1H4WA 2B9LA 2WPJS 2M5TA 3NXPA 1YC0A 3U9AH 1O3OA 3GISB 1OPHB 1V2UT 1GBMA 1QHRB 4J2YB 1A0HB 5A8ZA 4ABBA 5C3NA 4WF8A 5GDSH 5EQQA 2HPQH 3RXRA 1F5RA 1F7ZA 2Y80A 1SMFE 2QV1A 3SUEA 4Q2KA 1GMCG 5GCHF 3UOUA 1TX7A 5JBBS 1MBMA 3MYWA 3GCTG 2Z94A 1O2QA 3NCLA 1O2JA 8KME2 5FCRA 1SGDE 3HKIB 5IYTA 1NRPH 1P9SA 2AMDA 2H9TH 4ZAEA 1GCTB 2G4UA 1HBTH 2IJOB 4X8VH 4FUEA 1X7AC 2PKSC 1AFEH 3ATIA 1AKSA 3BTHE 1P11E 1TBRH 1CA8B 4INHA 3M35A 1HLTH 1QQUA 1IOEA 2FESH 1IQLA 1TYNA 2LNCA 4YOJA 1K21H 2H5CA 3MU5A 2WYGA 3LGYA 1JOUB 1QIXB 4TY6A 1UTJA 1DDJA 3MU1A 3RLWH 1QFKH 5DJ7A 2PR3A 3GDUA 1SGNE 1FXYA 3R3GB 4GAWA 3OYPA 1O3GA 1L1JA 4UFEH 4ABHA 1F5KU 1Z6JH 2FI3E 2GCHG 2PFEA 1QA0A 1OS8A 1DFPA 1EAUA 2AFQB 2TGPZ 1LHEH 2A5AA 3SU1A 1K1MA 5AHGH 1S84A 1TNLA 1SVPA 3DD2H 4U01A 4OGXA 1Z8GA 2QXHA 2ZP0H 3GY5A 4INKA 1HRTH 1THPB 3P17H 3D49H 1L1NA 2Z9KA 1C5YB 1GHBF 1ANDA 1FN6A 3ZZ9A 4FUDA 1WV7H 3SGAE 2OQUA 1EZQA 1CBWC 5FHTA 5EXLA 1UTQA 4X6PA 2XC4A 3VB6A 1C5SA 1BHXF 3EE0B 1HAVA 3P8FA 4IGDA 2ZFRH 3PWBA 1UVSH 3ZZ8A 1UVTH 3RXMA 3BF6H 2Q1JA 1BBRH 5A0CA 1Y3WA 2QAAA 2WPKS 3AASA 2FOFA 1GBLA 3M3VA 4KELA 1A1RA 1UTMA 1A0LA 3SV2H 1UK2A 3UR9A 1JWTA 1K1LA 1ARBA 3M5NA 1SB1H 1PPZA 3GCNA 4X2WA 1LMWB 3PMAB 4XBDA 2O8UA 1PJPA 1W14U 4Y7AA 1OWIA 5LPEA 2R9PA 4AORA 1PPHE 2G00A 4CRDA 4MPVA 1ANEA 1KXEA 1T4VH 3BTQE 1DY9A 4FVDA 1G9IE 4ZKNU 1GG6B 2C8XB 5EPYA 3NWUA 3BG4B 4I31A 1DLKB 1D3TB 2A7JA 1V2QT 1E35B 3SNAA 4B2AA 2BXTH 4D76A 3N7OA 1MQ6A 4IN2A 1O5CB 4Y6DA 1QBVH 1C2LA 4WMDA 1O36A 1Z6EA 4X0WU 5LPFA 3TH3H 2HVXA 1GI6A 2OXSA 2J2UA 1VJ9U 1GVLA 2XCFA 4BTIB 1UCYH 1OWKA 1EX3A 4MPXA 1C2GA 3ESTA 4CH2B 1YPMH 1ZRKA 1VITG 2FOBA 4AB9A 5JBAS 1QRWA 3A89A 4Y0YE 3RXCA 1GJCB 1FQ3A 2CV3A 1QJ1B 2B7DH 3MI4A 1AHTH 4FUGA 1TA6A 2OC7A 3A7TA 4CR5A 2A5IA 3UNQA 1MQ5A 3A8AA 1FY4A 2ZHQH 3BEUA 3TJOA 1C2HA 2W26A 1F0UA 2VWOA 3A8BA 1GI3A 1NRRH 1BRBE 1TBQH 4ABIA 1EAWA 3BTKE 5FX6A 1DANH 1ZR0A 1XUHA 2BVSH 3JZ2B 4CBNA 3HK6B 4NIXA 1HJ9A 2VU8E 1BJVA 1PPGE 3OY6U 3QZQA 2JH6D 5T6DA 3CS7A 3PMHB 3DFLA 1E34B 2ZFSA 4E7RG 4OS5A 4X2YA 3V12A 1ZZZA 2ZI2H 1O3BA 2SNWA 4AZ2B 2CHAC 2ZNKH 1EZUC 1O3PB 3RXBA 1LQDB 2G5VA 2ZIQH 1O3NA 1NC6A 1FJSA 4IBLH 1W12U 3BEFB 1ZSLA 2BLQA 4YT6H 1HAZB 4H6TA 1KTTB 2BD8A 2HLCA 4H42U 5LPRA 5TCCA 2CHAB 1OX1A 3ZZCA 1TWXB 3RU4D 4D7FA 4MNXA 1RJXB 3TGIE 3F9EA 1O2XA 4BOHA 3U8RH 3MMGA 3VGCC 4MVNA 3I78A 4X2XA 1SGFA 2AIPA 1ZJDA 2BDHA 2I6SA 3SHCH 3TNSA 1GJBB 1NU9A 3GICB 4JK5A 3FAOA 1DWBH 1W0YH 1S0RA 4FVBA 1WQSA 1GCDA 1C1RA 5TCAA 3O8CA 1SGFG 2J92A 3UPEA 2ZHEH 4KGAA 3A7ZA 3GDSA 1SC8U 1ELBA 2OTVA 4I32A 1GBDA 1J8AA 1YCPH 4Y79A 1PYTD 2UUYA 4QT8C 4OGYA 2GZ8A 1EASA 1QBOA 1BBRK 2W7SA 4B1TA 1Z8IB 1BTPA 5CHAC 1W11U 1C1VH 2BDAA 2QN5T 2JETC 1RXPA 4NWKA 3IG6B 1KDQA 4NA9H 1HAGE 1KTSB 1C2FA 2PTNA 1GMCF 3VB5A 1IAUA 1WCZA 4HFPB 2QIQA 3U8OH 1SGQE 3GCTF 3SHAH 2OBOA 2HOBA 1XM1A 2AIQA 2Y5GA 3RXUA 1KXBA 1S0QA 1TB6H 3RXGA 1OKXA 1KLTA 2G81E 2EC9H 1C5MD 3KL6A 2A4OA 2PUQH 1XXFA 3TK6A 3PYHA 4WXVA 1V2WT 2XRCA 1AVXA 1LVYA 4KTUA 1S83A 3RXAA 1QL8A 1WAYB 3ATKA 4B73A 4X8UH 4ISIH 1GBTA 1QRXA 1THSH 2UUJB 1XUJA 1YPJH 1ZYOA 1XUKA 3LC3A 3SU2A 4DURA 1O2HA 3Q3XA 4BAMB 3UR6A 4HGCA 3GCHC 3RU4E 5LH8A 1OYTH 2W3IA 5FXLA 1AIXH 1L0ZA 1SLWB 3OSYA 1RD3B 1UCYK 1FY3A 1GHBG 1O33A 4WH6A 1WSSH 2GCHF 3P6ZB 1P57B 1O30A 4O97A 1GI4A 2R3UA 1MD7A 4UFFH 1O2YA 3ZZ4A 1HPGA 1ELFA 4IW4E 3S0NA 1ZRBA 2V3HH 3L33A 4A1TA 1UCYE 5FPSA 1EKBB 2BQ7B 4KTSA 2UUFB 1HAOH 2VH6A 1WUNH 4NFEA 1AY6H 4BNRA 3LGTA 1D6WA 1GDUA 4X1QU 1JRSA 3QTVH 3P8NA 1GI1A 1ORFA 2IOTA 5BPEA 2A7CA 3DT0H 3ZZ7A 2XNIA 1DPOA 1FUJA 2O8WA 1AI8H 1O2KA 1E37B 2Y7XA 4UD9H 1G3CA 1EOLA 2NU4E 5C5NA 2D1JA 1AZ8A 5DKMA 1YPEH 1BA8B 2JKHA 2ZO3H 1YM0A 2EEKA 3KQBA 1GDQA 3MNCA 3P95A 3T27A 3DFJA 1CU1A 2Z9GA 4M7GA 4CRAA 3PLPA 2RA0A 4YZUA 1HAIH 1C5PA 4XE4A 2ZCKP 2XBVA 1C1QA 4CRGA 1NU7B 4UE7H 2IN2A 1OXGA 5EXNA 3A85A 1GDNA 3MTYA 3TH2H 3A7XA 4XBBA 3SV9A 4X2VA 3F68H 1TFXA 3ATWA 1TMBH 3NUMA 3O8BA 1ETSH 3MO3A 3EGKH 1A7SA 3BTEE 1TGNA 2XW9A 2ZHWH 3RC4A 1HAVB 2ALVA 1NFXA 1O5EH 5DP8A 1HCGA 2GX4A 4DT7B 1PQAA 2ZKSA 1XMNB 3AVZA 1C1MA 1LPGB 3BN9A 2Z7FE 3MH7A 1HNEE 3A82A 1C1TA 3SU3A 3VFEA 4ABJA 1NPMA 5AFYH 3RM2H 3SQEE 3ZYEA 1EPTC 2SFAA 3UWJH 1QGFA 1UTLM 2R2WU 1SGEE 2AYWA 4IC6A 4Q7XA 4YOIA 3E91A 1T32A 1SOZA 3UFAA 4ZKOU 1ABIH 1EPTB 1YPKH 1FAXA 1GMDG 3SJKA 1VITF 2ZGJA 2D2DA 1EAIA 2AGIX 7KMEH 3BTGE 2ZHFH 4NIVA 1P10A 9LPRA 5DPAA 3RMNH 1LTOA 2A4QA 1ETRH 3M5LA 1TBZH 2BM2A 4O03A 4D7GA 2TGAA 2VWLA 5DP5A 3MHWU 1GJ4H 1G3EA 2LPRA 1ZHMA 1Q3XA 2P3TB 1Y3UA 2Y81A 1S81A 1EOJA 2W3KA 4JZIA 1KXFA 3SUGA 1TABE 1UJ1A 5DG6A 3NKKA 2ODYB 2FTLE 3RUOA 2HPPH 5GXPA 2QA9E 1CQQA 5CE1A 5F8TA 7ESTE 1ZOMA 3EYDA 4JZ1A 2Q6DA 1XUIA 1O34A 4Y8XA 1ELVA 1O3HA 1OWDA 5HXFA 2ALPA 4YO9A 1TMTH 2H1UA 4RKOB 1VCPA 4HTCH 1CHGA 3RXLA 3SW2B 3SNBA 4LZ4B 2SGAA 3C27B 1TNKA 3RMOH 2PV9B 1S85A 2ANWA 1N6YA 2G5NA 1E38B 2F9PA 4WVPE 4K1EA 4AYVB 3E0NB 4CREA 1NFWA 2BX4A 2SNVA 1A5HA 2PLXA 3QWCH 3T25A 1FN8A 1GBEA 1K1IA 4X6MA 2Z9IA 2FTMA 2GT8A 2BHGA 4DG4A 3S7KB 4ESTE 5ESTE 4CHAC 1GVKB 1DWEH 3AAUA 1SSXA 1HIAB 1O2RA 4GLYA 1UTOA 3O8DA 1Q2WA 4UFGH 1ELEE 1A0JA 4ZXXH 1GBCA 1V2MT 3A84A 1T8OA 3BTTE 4IS5A 4K60A 1MZAA 5GJ4B 1O3FA 4JYTA 4AB8A 1W2KH 2XC0A 3KN2A 1BTXA 1LKBA 1P3EA 5EPNA 5L2YH 1LHDH 3RM0H 3GCOA 2BMGB 4NCYA 3QGNB 1NM6A 1W3CA 1RS0A 1UHBA 1GBFA 2FPZA 3OTJE 2FM2A 3TIUA 1W13U 4OS7A 5GPIB 2PKSB 5T6FA 3OX7U 2FX4A 2SGFE 1AGJA 1SBWA 2O8LA 3A83A 5EODA 1PQ5A 3BIVH 1KLJH 1YP9A 2GV7A 2C3SA 1C9TA 1TMUH 2BZAA 4Q80A 1SOTA 3UTUH 5H4IB 3AW0A 1DICA 4BANB 2PSXA 4TPYA 4A7IB 2ZU1A 3A86A 1G2LA 2BDBA 2UWPA 1GJAB 4E05H 1IQIA 1XVOA 3RXOA 1MTWA 3GY6A 3M61U 2A5KA 3RDZA 4CH8B 3PO1C 3SU6A 1HB0B 4F4OC 1QJ6B 3BSQA 2XBXA 1KDQB 1UVUH 3KF2A 3MU8A 1SLVB 2FZZA 1DVAH 3DA9B 1ZPCA 2ZDKA 1TX8A 1OP0A 1GBBA 1T4UH 3TJNA 3ZVCA 1O3MA 1TPOA 3PTBA 3PO1B 2ZC9H 2OCVB 3SGBE 3T5FH 3PROA 3U1JB 1G2MA 2PGQB 2UUKB 5JPMH 1C4Y2 1VGCC 1TA2A 2ANKH 4RSPA 5EXMA 4KP0A 3VXFH 1SQTA 4TYDA 1TPPA 3KGPA 1EZXC 1DE7H 1CBWB 1GWAA 2V3OH 2WV5A 1IQFA 1XXDA 1AMHA 3RLYH 1AUTC 4BAHB 2F9UA 1K1PA 4U32A 2GCTC 1CGHA 2ZU3A 3F9GA 5IDKA 1EB1H 2Q6FA 1SQOA 2R3YA 4Y71A 3U1IB 1BHXB 4KTCA 3RXIA 5HYOA 3M37A 2HWLB 3F9HA 1EPTA 1QRZA 4DY7B 1C1PA 4AOQA 1LDTT 2NU3E 4K8BA 2EI6A 2WUCA 1T8NA 3G01A 2C4FH 2H6MA 2A7HA 2F9NA 4A5TS 1W0ZU 5JBTA 1ZMLA 5JDUB 4ZHMU 2WPLS 3ZV8A 3UQOA 1K1JA 3OU0A 2ZU5A 2BD2A 1ANBA 4ISOA 1ZJKA 1O2ZA 1HFDA 3ZVFA 3QTOH 4XBCA 2HNTE 1O0DH 1UK3A 1FY1A 3MH6A 5DK1A 1G3BA 3M5MA 2YNBA 3HGNA 4X6OA 5J4QA 2BVRH 1QURH 3URDA 2FYQA 4NGAH 1TGBA 1NESE 3GY3A 4JMYA 2XWAA 3KEEA 3RXHA 3CENA 3V13A 3RXJA 3F1SB 2P3UB 4WMFA 1J15A 3T28A 2BD4A 1G37A 3RP2A 2XCNA 1F2SE 3L3TA 1Z71A 4DOQA 5E2PA 2QF3A 3T29A 1GJ9B 4CR9A 1HAHH 4ABDA 4IMZA 3K65B 1GHYH 2ZWLH 2C8ZB 2Z3EA 2ZGXH 1DXWA 2J4IA 2HNTC 2ZQ2A 3TPIZ 4WWYA 1PFXC 4TY7A 1PPBH 3LONA 3NZIA 1NRQH 1TLDA 3PWCA 1KXAA 1J16A 1BRAA 4YOGA 3TNTA 1O3AA 1BB0B 1GHZA 1GMDF 4BAKB 1Z1JA 4ZKSU 1GBAA 4D9RA 2FODA 1BT7A 2G52A 4YLQH 4AFSA 3T2NA 1GHVH 1NRNH 4YT7H 5FPYA 1V2TT 1A5GH 3U8TH 2THFB 1GI5A 1F0RA 1V2VT 3S69A 1J14A 1O2SA 4YLUA 1H8IH 4Y8YA 1TGSZ 2V35A 1GI7B 4B2BA 1SFQB 3B8JA 1HGTH 1IQGA 3QLPH 5L6NH 1EP6A 1HIAA 3PM3A 1VJAU 3AAVA 2BLWA 2UWLA 3BTDE 1V2OT 3KCGH 3SV6A 3L6PA 2BY6X 3Q3YA 4ZROA 1WBGB 1FZZA 1AFQC 1O5BB 4Y11E 1YPHE 4AX9H 1GI0A 1PQ7A 3FANA 1TNHA 3SV7A 5A2MH 4Q7ZA 1TX6A 2FOCA 2DUCA 5SGAE 1FDPA 1TOMH 3ODFA 1P06A 1P2KA 1NRSH 2P95A 3LGUA 3VGCB 4MNYA 1O35A 2A1DB 3MO9A 1NO9H 2A4GA 1ANCA 3SNEA 1HXEH 2FEQH 1O5AB 4AFQA 2NU2E 1TONA 3HGPA 4FUJA 4K3JA 1TALA 2ODQA 2Y5FA 4TWYA 1GBIA 3A8CA 1EJMA 2BLOA 2NU1E 1XVMA 3O8RA 1PPCE 2V0BA 5TJXA 3A88A 3QO6A 1YPHC 2RA3A 1WTGH 3HKJB 1CGIE 2ILNA 4OS6A 3BG8A 3W95A 3BEIB 2A45B 4MDSA 4DJZB 1ELCA 4ZKRU 1D4PB 2OC0A 1C2IA 1N8OC 4ZXYH 5J4SA 5E2OA 3RXPA 3RXSA 1EJNA 2R0LA 4UDWH 2B8OH 2EI7A 5EOKA 5C67A 5EW2H 2VJ1A 2SGPE 4GUXA 1NS3A 4B75A 2H9HA 2RDLA 1ETTH 2ZPQA 1OYQA 1RIWC 5E0GA 4GCHG 1N8OB 2I6QA 1AB9C 2ZU2A 3R0FA 2P8OC 3K2UA 1BBRE 5CHAB 1A2CH 2JETB 6CHAC 2ZDMA 5C1YA 3SOSA 1G30B 1NFUA 3SU4A 3KQEA 4YM9A 3V0XA 4A92A 3KIDU 1P2NA 1C5QA 5DO4H 2GT7A 2GDEH 3CP7A 2BY9X 1S6HA 5HM9A 2W7UA 1HAPH 1MUEB 5L30H 4HI3A 3D65E 5FPTA 2TIOA 2GZ9A 3QX5H 1IQKA 2TGTA 1K1NA 1UVOA 1TNIA 2PKAA 4K5ZA 3I29A 1ELAA 1MMJN 5CMXH 3EA9A 1BIOA 1XX9A 3SBKA 3P92A 1P2QA 2ZGHA 1AZZA 2H9EH 4NIWA 3LDXH 4UFDH 5A09A 2ZTZA 3KHVA 4NSYA 3EA8A 3K6YA 3SU5A 1TRNA 3NPSA 3TK5A 3OY5U 1AVWA 1MCVA 3GCHB 3LH3A 3MU4A 7LPRA 3P70B 1H8DH 5C1UA 7GCHF 2FOGA 1P12E 2QYIA 4I8LA 1P2JA 2FLRH 3JZ1B 5EG4A 1DT2A 1O2LA 2G51A 1UHBB 3QUMP 3ELAH 1NY22 2O8TA 1CT0E 1P01A 2RCEA 1OP2A 3UIRA 2BQWB 1P8VC 3FFGA 5DGJA 1AU8A 5PTPA 1DSTA 3LT3A 3UREA 4Y0ZE 3GDVA 1EUFA 1LVOA 3TU7H 1Y5UT 4AGJA 2EI8A 2ZCLP 2VVUA 4NA8A 1RTLA 1GBHA 1VZQH 3SORA 1TPAE 4O3UA 4DGJA 2A2QH 1KLIH 3MO6A 4INLA 4X8SH 4JZFH 1K2I1 1AD8H 2CJIA 2ZF0H 1NT1A 3GYMA 2BZ6H 4MG3A 3C1KA 1K9OE 3QN7A 1P03A 2TRMA 1GJ6A 2P16A 1SFIA 2OUAA 1D3PB 4BXWA 4NA7A 4X1SU 2OD3B 3U69H 1Z1IA 4X1NU 1HDTH 1MU6B 2HGTH 1C4U2 3SU0A 1T8LA 1TQ0B 1C2KA 2AGEX 1HXFH 2GMTC 1ZLRA 1WQVH 1PYTC 3F6UH 1O5DH 3MFJA 3ZZBA 1HAYB 4Z6AH 3RMLH 1ACBE 5G4BA 4DIHH 2CMYA 1C1WH 3PMBB 1FI8A 2SGQE 2P93A 3LJOA 4AG1A 4ISHH 1MH0A 1KXCA 1HJAC 2ZEBA 1MKXK 3LGWA 3LC5A 2RG3A 4AGKA 5HGGA 1T7CA 3TK9A 1HUTH 3VB3A 5JBCS 1RTKA 2ASUB 2FI5E 2VGCC 2HRVA 3SJ9A 3F9FA 1EP5A 3ATMA 2BB4A 2AS9A 1BRCE 1O32A 4I8KA 2OLGA 1DUEA 1ZSKA 2ZHDA 3WY8A 3AW1A 2ZQ1A 1C5TA 1THRH 3ENSB 2FO9A 4X1RU 1O3LA 1J9CH 1IQEA 4D8NA 3RXKA 1SLUB 1JIMA 3A7YA 2DE9A 2QC2A 4ABEA 3EAJA 1P2OA 2AH4X 2TBSA 3GOVB 1OP8A 1Y5AT 3E90B 1ESBA 1DOJA 3ITIA 1WOFA 2XYAA 3U98H 1XKBC 4X1PU 3SO3A 1SGCA 1B5GH 3P8GA 4JYUH 1E0FD 2D26C 4R0IA 1CA0C 1UTKA 1FMGA 1O3JA 1JIRA 3M3TA 3LGIA 4GPGA 4UEHH 2FX6A 4R8TB 1IQJA 4HZHA 4O3TA 5DP3A 1CE5A 2FS9A 4Y7BA 2ZDLA 1P09A 1V2LT 4JZEH 2R0KA 2WYJA 4J1YA 4DIIH 1HV7A 1ZTKA 2Y7ZA 1YGCH 5F8ZA 3BTWE 1VCWA 3PTNA 2QCYA 3MOCA 4IC5A 1QTFA 3UWIA 2WPHS 5T3HA 2A32A 3KQDA 3ZZ5A 1UO6A 4DW2U 3PLBA 4BAQB 4O9VA 3RXEA 2WPIS 2AGGX 4MQAA 1GMHF 5C2ZA 1MBQA 4GVUA 4H6SB 1V2NT 1MU8B 3ZZDA 1ZTJA 1BTYA 5K7RA 1O2UA 4GHTA 1SGPE 1PPFE 1B0EA 1CT4E 3ZZ3A 2XTTB 1GHAG 1JBUH 1ELTA 1QY6A 5F8XA 5B6OA 5E8EH 3ZVEA 1EJAA 3PMJA 1AWHB 2ZDVH 3KNXA 1CVWH 1CT2E 1QB9A 1V2KT 1C5LH 2WV4A 3Q00A 3A87A 1SL3A 1QL7A 3ZVAA 1UTPA 1OSSA 2UWOA 4JYVH 1LKAA 2Z9LA 1O2TA 1CO7E 3LPRA 5LGOA 3RC6A 4CHAB 3E6PH 4AN7A 2A0QB 2P94A 2ODPA 4K69A 1SPJA 2OQ5A 3SUFA 3TJVA 4MLFB 1BOQA 1H9HE 5C1XA 2Z3DA 1TGTA 1K22H 4RKJB 3NK8A 1GCTC 1SGIB 4XSKU 2DE8A 3BV9B 1P02A 1O39A 2PSYA 2J9NA 5FX5A 1ZHRA 2R2MB 1BMNH 2Y6TA 3PV4A 4FU9A 1TE0A 1VR1H 1OWJA 1Q31A 1Z8RA 2VVVA 3LOXA 6GCHF 4GCHF 1WYKA 1F5LA 1S82A 3UQVA 5FBIA 4Y8ZA 1AO5A 5HMAA 3STJA 5BRRE 2PWXA 1D9IA 2ZFFH 4X8TH 1INCA 5A0BA 3SJOA 5DP9A 3SJ8A 2VIDA 3E8LA 1MTNC 4B76A 1FPCH 3SNDA 7GCHG 2BDIA 1GPZA 4Z0KA 3IWMA 3PLKA 1H1BA 3DUXH 3E1XB 1AWFH 3MH5A 1C1NA 2STAE 2BLVA 1GHWH 1ESTA 4NSVA 2CN0H 4JCNA 2FOMB 1W7GH 6ESTA 3SN8A 5ABWA 2FYRA 1KXDA 3P8OA 1MKWH 1ARCA 1MTNB 2F9BH 1ELDE 4FUIA 1BTUA 4AFZA 3SZNA 2FOAA 1FY5A 2QGRA 2YOLA 1W10U 1FPHH 2PUXB 1YCPM 3E0PB 3M7TA 1ABJH 4FXGH 3SI4H 2ZDAH 4IMQA 4DVAU 2ZGCA 1C9PA 1G36A 1L2EA 1ZSJA 5AFZH 2BD5A 2WUBA 1LHCH 1C5NH 1GBKA 4XDEA 8LPRA 4AFUA 1O5FH 1O3DA 2VVCA 4D9QA 4KKDA 2ZTYA 4K8YA 2BQ6B 5DP7A 1GVZA 1KIGH 2ZPRA 2NWNA 2K1QA 1AUJA 1CHOG 1O37A 3T62A 5JYIA 2D8WA 5F6MA 4LXBH 1EQ9A 2ANYA 1VGCB 2ESTE 2P59A 2PKAB 1DXPA 3LH1A 1O5GH 2VIPA 5FAHA 2BDCA 4ASHA 4CRBA 1SGRE 4MNVA 1MAYA 4JZDH 1SHHB 4WJG2 2BOHB 3FP6E 1AE5A 1BTWA 2B0FA 3A81A 5K0HA 1DY8A 1DLEA 3PB1E 1EAXA 1G3DA 2CGAA 2GCTB 4OS4A 2A2XH 1KSNA 2QF0A 3UUZA 1Y3YA 2VNTA 1JMOH 2B5TB 3B23B 4I8GA 1GG6C 1P0SH 1UK4A 3KQCA 2GGVB 3MH4A 1P2MA 3SJIA 3BG4C 1ZGIA 1C5OH 3S9BA 1RRKA 5F03A 4PROA 3LU9B 4F49A 4TWWA 1YLCA 3I77A 4FU7A 1FLEE 1V2PT 4NZQA 2HALA 1D6RA 3SQHE 1DWCH 3LIWA 1QB1A 4ABGA 2ZFPH 4NIYA 3GY2A 4MPWA 3SGQE 1Z7KA 1FONA 1PQ8A 2NU0E 1SHYA 2WINI 4BTUB 1S6FA 3GY7A 3QK1A 4I8JA 1AQ7A 4E06H 1NFYA 2HNTF 1O2PA 2FWWA 2TGDA 3FP7E 1D3DB 1IQMA 2XBWA 1SG8B 1YLDA 1TRYA 2VIQA 3ODDA 2VINA 4U2WA 2WPMS 2BXUH 3S9AA 1MD8A 3Q3KA 1BDAA 1K28D 1BTHH 1TGCA 3GY8A 3STIA 3K9XB 1ZGVA 4BXSA 1FIZA 1FAKH 1MTUA 2V6NA 1O31A 5GIBA 1GJ7B 1O2MA 5E0HA 4SGAE 2PGBB 5ETXA 4ZH8A 1P2IA 1U6QA 5JB9S 2VWMA 2O8MA 1LQEA 1JXPA 3M7QA 1RTFB 1TIOA 4ZUHA 1XUGA 2O9QA 1F0SA 1O2NA 2P3FH 4ISLA 2FLBH 2GVFA 1O3KA 1SGYE 1YBWA 2OP9A 3HATH 2BY5X 3A8DA 3W94A 4E7NA 4A6LA 1C5RA 1MTVA 2KAIA 2H2ZA 2W5EA 2VIOA 3A7WA 2ZU4A 1Y3XA 2ZTXA 5A0AE 1Y3VA 2BTCE 1GMHG 1FNIA 2ZECA 2QXJA 3GY4A 4DCDA 3H7TA 4FUCA 5AVDA 5I25A 4MTBA 4FUFA 4OS2A 4GSOA 1KYNA 2J94A 3A7VA 1YPLH 4K2YA 1JRTA 1QA7A 3M7UA 4I33A 1LHFH 1AFQB 5EQSA 1PPEE 1MKWK 1YKTA 1GJDB 1MKXH 2IPHA 3ZVDA 4YTAA 2BDGA 1BITA 3QGJA 1A3BH 2G4TA 1VITH 1DS2E 2ZFQH 1KY9A 2GP9B 1BTZA 1BMAA 2QY0B 1QL9A 1RFNA 2GZ7A 1P3CA 1L4ZA 3V7TA 1GBJA 3RXDA 5I46H 8GCHF 2EA3A 3ATLA 3RXFA 1EB2A 2ULLA 2JH5D 1GJ5H 1C1SA 1O2OA 2OINA 1ZMJA 1GHAF 1CGJE 1QQ4A 4WMEA 4ZMAH 3RC5A 3TVJB 2GDDA 5GCHG 4XOJA 2F9OA 3ZVGA 2FOEA 3BTME 1BMLA 1LHGH 2C90B 4GHQA 4B2CA 1FY8E 1DUAA 1BRUP 1Z8JB 2BD7A 1C5VA 1EATA 3TH4H 1Y8TA 6GCHG 1M9UA 2FXRA 1OWEA 3Q77A 4K1SA 3M36A 5EGMA 3UNRA 5T6GA 1HAXB 3EA7A 1GHXH 4XFQA 2A4RA 1BQYA 1ZTLA 3ZYDA 1GJ8B 2ZCHP 1P9UA 2GV6A 1RIWB 4CBOA 2FS8A 2FOHA 3Q76A 1C2MA 1AB9B 1C2JA 4FUBA 1BUIA 2P8OB 1AN1E 3VB4A 2Z9JA 6CHAB 3TGKE 1NN6A 4NFFA 2JH0D 5C20A 1TNJA 1W7XH 2GD4B 2AMQA 1BZXE 2PTCE 3QZRA 2J38A 1UTNA 4Q7YA 1V6DA 5EW1H 2TPIZ 5DP6A 4CRFA 3H5CB 1A61H 3MNXA 4VGCC 4I7YH 4FU8A 2BD9A 2AMPA 1GI8B 1B0FA 1BJUA 4ISNA 2F3CE 2ZZUH 3VEQB 2BDYA 1RGQA 4IN1A 3S7HB 2XBYA 4Y76A 5A8XA 4VGCB 4LZ1H 1N6XA 1H9IE 1YPGH 2FP7B 2STBE 1MCTA 1NROH 1C2EA 3D23A 1TAWA 3E3TA 2BX3A 5EU8A 2G55A 3ZV9A 3RMMH 1ESAA 1ID5H 2OC1A 3LGVA 5FCKA 1XKAC 4FUHA 1TPSA 3A80A 4LOYH 4AYYB 1DSUA 2Z6BD 1AKSB 4BAOB 2J95A 2BVXH 3RXVA 1NTPA 4U30A 2PHBA 5JB8S 3FZDA
chains in the Genus database with same CATH superfamily
1ELGA 2VIVA 1V2RT 1ZPZA 2C8WB 1O2WA 1QZ8A 3H7OA 2QXGA 4I8HA 1V3XA 1QNJA 4ZHLU 1CHOF 4ABAA 1C1OA 1LCYA 3MWIU 2FDAA 4WH8A 2ANMH 2K8IA 2OC8A 1T8MA 5ESBA 8ESTE 1J17T 4MPUA 1D3QB 2G8TA 2ZPSA 2VB0A 3WWBA 3UY9A 2KCOA 3SNCA 3MNSA 1C5XB 2SGEE 3W1EA 4Y10E 1N1LA 1SR5C 1HJ8A 3LKWA 2Q6GA 1F92A 3E16B 1QB6A 4SGBE 1EZSC 1HYLA 1C1UH 3B9FH 1LPKB 1T31A 1TOCB 3FZZA 1O2GH 3HK3B 3ZZAA 1TRMA 1UVPA 3FN8A 4WXIA 5KEDA 1SQAA 1V2ST 1YF4A 1W8BH 1A5IA 1AE8H 4THNH 1A4WH 2Y82A 2GMTB 4K1TA 5E0JA 2ZFTA 1Y59T 1EXFA 1G32B 2OBQA 1O3IA 2ZA5A 3D62A 3HPTB 1OWHA 3UNSA 2XOKD 5GWZA 4MNWA 3LJJA 5AF9H 5C0TA 1K1OA 1HJAB 1SI5H 1A3EH 1TQ7B 2BY7X 3VXEH 3MQKC 3V3MA 1E36B 2XWBI 1O2IA 2F9VA 3EQ0H 3MNBA 3M5OA 1ZMNA 2VGCB 1TNGA 3S9CA 3RU4T 1FV9A 2GKVE 1SLXB 1XUFA 1V2JT 4OS1A 2C8YB 6LPRA 1WU1A 4JK6A 4RN6A 1VCQA 1ZPBA 1YYY1 1DWDH 3TJUA 3DSPA 3SV8A 2AERH 1YCPK 2BY8X 1P05A 2CF9H 2FI4E 4A1XA 1S5SA 4BTTB 2J98A 3ZVBA 3FVFB 4AG2A 1LO6A 3DHKH 3BTFE 1C4V2 2VIWA 5HIZA 1UMAH 1O3EA 1QR3E 3M3SA 3UOPA 3TLOA 1C5WB 1QJ7B 2CF8H 1O2VA 2XXLA 2H5DA 2SGDE 1BMFD 5EQRA 2BYAX 3CS0A 4NWLA 1IHSH 5HM2A 2WZQA 5FBEA 4ABFA 3GYLB 3URCA 4UONA 1L1GA 4X6NA 4B71A 1CA0B 5C5OA 1QCPA 4CRCA 3ZZ6A 1IQNA 1DM4B 1ZHPA 1C2DA 1FIWA 2Y5HA 2ZGBH 2Z3CA 4H4FA 1LVMA 1CSOE 1L4DA 2QXIA 5DP4A 1GL1A 2BD3A 4LK4A 3VB7A 1AVGH 1QBNA 1BCUH 1WTHD 2QF4A 1BMMH 3TITA 3SUDA 9ESTA 1LPZB 1GL0E 1DITH 2FMJA 1GGDC 3QDZB 3K6ZA 4NG9H 1MZDA 2FIRH 2A31A 4TPIZ 3TGJE 1GI9B 1DX5M 8GCHG 1H8ED 3FP8E 5A8YA 2ZG0H 4A1VA 1O3CA 1MAXA 1SGTA 1P04A 1F0TA 1IHTH 3VPKA 2VWNA 1GGDB 2EQNA 2F83A 4ZCNA 1GI2A 2XC5A 1O38A 4NZLA 2GTBA 2J34A 2PW8H 1OOKB 2VH0A 1A46H 4B74A 1H9LB 2PP6A 4B6FA 2BOKA 3NRLA 1Y5BT 2CXVA 3MU0A 2AEIH 5DN6D 2F91A 2YNAA 3RXTA 4YESB 2C93B 2ZDNA 3IITA 3RXQA 1MTSA 3T26A 5L2ZH 1IQHA 3SI3H 4ZHAA 4WY3A 2KAIB 1C5ZB 1NZQH 1C5UA 3BIUH 3EDXB 1B7XB 1LVBA 1H4WA 2B9LA 2WPJS 2M5TA 3NXPA 1YC0A 3U9AH 1O3OA 3GISB 1OPHB 1V2UT 1GBMA 1QHRB 4J2YB 1A0HB 5A8ZA 4ABBA 5C3NA 4WF8A 5GDSH 5EQQA 2HPQH 3RXRA 1F5RA 1F7ZA 2Y80A 1SMFE 2QV1A 3SUEA 4Q2KA 1GMCG 5GCHF 3UOUA 1TX7A 5JBBS 2XNDD 1MBMA 3MYWA 3GCTG 2Z94A 1O2QA 3NCLA 1O2JA 4DT4A 8KME2 5FCRA 1SGDE 3HKIB 5IYTA 1NRPH 1P9SA 2AMDA 2H9TH 4ZAEA 1GCTB 2G4UA 1HBTH 2IJOB 4X8VH 4FUEA 1X7AC 2PKSC 1AFEH 3U28C 3ATIA 1AKSA 3BTHE 1P11E 1TBRH 1CA8B 4INHA 3M35A 1HLTH 1QQUA 1IOEA 2FESH 4XD7D 1IQLA 1TYNA 2LNCA 4YOJA 1K21H 2H5CA 3MU5A 2WYGA 3LGYA 1JOUB 1QIXB 4TY6A 1UTJA 1DDJA 3MU1A 3RLWH 1QFKH 5DJ7A 2PR3A 3GDUA 1SGNE 1FXYA 3R3GB 4GAWA 3OYPA 1O3GA 1L1JA 4UFEH 4ABHA 1F5KU 1Z6JH 2FI3E 2GCHG 2JJ1D 2PFEA 1QA0A 1OS8A 2V3MA 1DFPA 1EAUA 2AFQB 2TGPZ 3OEHD 1LHEH 2A5AA 3SU1A 1K1MA 5AHGH 1S84A 1TNLA 1SVPA 3DD2H 4U01A 4OGXA 1Z8GA 2QXHA 2ZP0H 2KZ4A 3GY5A 4INKA 1HRTH 1THPB 3P17H 3D49H 1L1NA 2Z9KA 1C5YB 3VG8A 1GHBF 3F0OA 1ANDA 1FN6A 3ZZ9A 1S6LA 4FUDA 1WV7H 3SGAE 2OQUA 1EZQA 1CBWC 5FHTA 5EXLA 1UTQA 4X6PA 2XC4A 3VB6A 1C5SA 1BHXF 3EE0B 1HAVA 3P8FA 4IGDA 2ZFRH 3PWBA 1UVSH 3ZZ8A 1UVTH 3RXMA 3BF6H 2Q1JA 1BBRH 5A0CA 1Y3WA 2QAAA 2WPKS 3AASA 2FOFA 1GBLA 3M3VA 4KELA 1A1RA 1UTMA 1A0LA 3DSGA 3SV2H 3WWFA 1UK2A 3UR9A 1JWTA 1K1LA 1ARBA 2CK3D 3M5NA 1SB1H 1KMHB 1PPZA 3GCNA 4X2WA 1LMWB 3PMAB 4XBDA 2O8UA 1PJPA 1W14U 4Y7AA 1OWIA 5LPEA 2R9PA 4AORA 1PPHE 2G00A 4CRDA 4MPVA 1ANEA 1KXEA 1T4VH 3BTQE 1DY9A 4FVDA 1G9IE 4ZKNU 1GG6B 2C8XB 1VKYA 3NWUA 5EPYA 3BG4B 4I31A 1DLKB 2GJGA 1D3TB 2A7JA 1V2QT 1E35B 3SNAA 4B2AA 2BXTH 3F0PA 4D76A 3N7OA 1MQ6A 1SKYE 4IN2A 1O5CB 4Y6DA 1QBVH 1C2LA 3UB0A 4WMDA 1O36A 1Z6EA 4X0WU 5LPFA 3TH3H 2HVXA 1GI6A 2OXSA 2J2UA 1VJ9U 1GVLA 2F43B 2XCFA 4BTIB 1UCYH 1OWKA 1EX3A 4MPXA 1C2GA 3ESTA 4CH2B 1YPMH 1ZRKA 1VITG 2FOBA 4AB9A 5JBAS 1QRWA 3A89A 4Y0YE 3RXCA 1GJCB 2RDEA 1FQ3A 2CV3A 1QJ1B 2B7DH 3MI4A 1AHTH 4FUGA 1TA6A 2JDID 2OC7A 2J5UA 3A7TA 4RT1A 2A5IA 4CR5A 3UNQA 1MQ5A 3A8AA 5FL7D 1FY4A 2ZHQH 3BEUA 3TJOA 1C2HA 2W26A 1F0UA 2VWOA 3A8BA 1GI3A 1NRRH 1BRBE 4P00A 1TBQH 4ABIA 1EAWA 4ASUD 3BTKE 5FX6A 1DANH 1ZR0A 1XUHA 2BVSH 3JZ2B 4CBNA 3HK6B 4NIXA 1HJ9A 2VU8E 1BJVA 1PPGE 3OY6U 3QZQA 2JH6D 1FX0B 5T6DA 3CS7A 3PMHB 3DFLA 1E34B 2ZFSA 4E7RG 4OS5A 4X2YA 3V12A 1ZZZA 2ZI2H 1O3BA 2SNWA 4AZ2B 2CHAC 2ZNKH 1EZUC 2KR7A 1O3PB 3RXBA 1LQDB 2G5VA 2ZIQH 1O3NA 1NC6A 1FJSA 4IBLH 1W12U 3BEFB 1ZSLA 2BLQA 4YT6H 1HAZB 4H6TA 1KTTB 2BD8A 2HLCA 4H42U 5LPRA 5TCCA 2CHAB 1OX1A 3ZZCA 1TWXB 3RU4D 4D7FA 2J98B 4MNXA 1RJXB 3TGIE 3F9EA 1O2XA 4BOHA 3U8RH 3MMGA 3VGCC 4MVNA 3I78A 4X2XA 3CNRA 1SGFA 2AIPA 1ZJDA 4HG6A 2BDHA 2I6SA 3SHCH 3TNSA 1GJBB 1NU9A 3GICB 4JK5A 3FAOA 1DWBH 1W0YH 1S0RA 4FVBA 1WQSA 1GCDA 1C1RA 5TCAA 3O8CA 1SGFG 2J92A 3UPEA 2ZHEH 4KGAA 3A7ZA 3GDSA 1SC8U 1ELBA 3AK5A 2OTVA 4I32A 1GBDA 1J8AA 1YCPH 4Y79A 1PYTD 2UUYA 4QT8C 2IPQX 4OGYA 2GZ8A 1EASA 1QBOA 1BBRK 2W7SA 4B1TA 1Z8IB 1BTPA 5CHAC 1W11U 1C1VH 2BDAA 2QN5T 2JETC 1RXPA 4NWKA 3IG6B 1KDQA 4NA9H 1HAGE 1KTSB 1C2FA 2PTNA 1GMCF 3F2FA 3VB5A 1IAUA 1WCZA 4HFPB 2QIQA 3U8OH 1SGQE 3GCTF 3SHAH 2OBOA 2HOBA 1XM1A 2AIQA 2Y5GA 2F4LA 3UAIC 3RXUA 1KXBA 1S0QA 1TB6H 3RXGA 1OKXA 1KLTA 2G81E 2EC9H 1C5MD 3KL6A 2A4OA 2PUQH 1XXFA 3TK6A 3PYHA 4WXVA 1V2WT 2XRCA 3OAAD 1AVXA 1LVYA 4KTUA 1S83A 3RXAA 1QL8A 1WAYB 3ATKA 4B73A 4X8UH 4ISIH 2WV9A 1GBTA 1QRXA 1THSH 2UUJB 1XUJA 1YPJH 1ZYOA 1XUKA 3LC3A 3SU2A 4DURA 1O2HA 3Q3XA 4BAMB 3UR6A 4HGCA 3GCHC 3RU4E 5LH8A 2W6ID 1OYTH 2W3IA 5FXLA 1AIXH 1L0ZA 1SLWB 3OSYA 1RD3B 2JIZD 1UCYK 1FY3A 1GHBG 1O33A 4WH6A 1WSSH 2GCHF 3P6ZB 1P57B 5EJLA 1O30A 4O97A 1GI4A 2R3UA 3OFND 1MD7A 4UFFH 1O2YA 3ZZ4A 1HPGA 1ELFA 4IW4E 3S0NA 1ZRBA 2V3HH 3L33A 4A1TA 1UCYE 5FPSA 4Z1MD 1EKBB 2BQ7B 4KTSA 2UUFB 1HAOH 2VH6A 1WUNH 4NFEA 1AY6H 4BNRA 3LGTA 1D6WA 1GDUA 4X1QU 1JRSA 3QTVH 3P8NA 2YMSD 1GI1A 1ORFA 1W0KD 2IOTA 5BPEA 2A7CA 3DT0H 3ZZ7A 2XNIA 1DPOA 1FUJA 2O8WA 1AI8H 1O2KA 1E37B 2Y7XA 4UD9H 1G3CA 3N7EA 1EOLA 2NU4E 5DSFA 5C5NA 2D1JA 1AZ8A 5DKMA 1YPEH 1BA8B 2JKHA 2ZO3H 1YM0A 2EEKA 3KQBA 1GDQA 3MNCA 3P95A 3T27A 3DFJA 4F55A 1CU1A 2Z9GA 4M7GA 4CRAA 3PLPA 2RA0A 4YZUA 1HAIH 1C5PA 4XE4A 2ZCKP 2XBVA 1C1QA 4TSFD 4CRGA 1NU7B 4UE7H 2IN2A 1OXGA 5EXNA 3A85A 1GDNA 3MTYA 3TH2H 3A7XA 4XBBA 3SV9A 4X2VA 3F68H 1TFXA 3ATWA 1TMBH 3NUMA 3O8BA 1ETSH 3MO3A 3EGKH 1A7SA 3BTEE 1TGNA 2XW9A 2ZHWH 3RC4A 1HAVB 1UW7A 2ALVA 1NFXA 1O5EH 4OM9A 5DP8A 1HCGA 2GX4A 4DT7B 1PQAA 2ZKSA 1XMNB 3AVZA 1C1MA 1LPGB 3BN9A 2Z7FE 3MH7A 1HNEE 3A82A 1C1TA 3SU3A 3VFEA 4ABJA 1NPMA 5AFYH 3RM2H 3SQEE 3ZYEA 1EPTC 2SFAA 3UWJH 1QGFA 1UTLM 2W6JD 2R2WU 1SGEE 2AYWA 4IC6A 4Q7XA 4YOIA 3E91A 1T32A 1SOZA 3UFAA 4M9FA 4ZKOU 1ABIH 1E1RD 1EPTB 1YPKH 1FAXA 1GMDG 3SJKA 1VITF 2ZGJA 2D2DA 1EAIA 2AGIX 7KMEH 3BTGE 2ZHFH 4NIVA 1P10A 9LPRA 5DPAA 3RMNH 1LTOA 2A4QA 1ETRH 3M5LA 1TBZH 2BM2A 4O03A 5EIYA 4D7GA 2TGAA 2VWLA 5DP5A 3MHWU 1YLNA 1GJ4H 1G3EA 2LPRA 1ZHMA 1Q3XA 2P3TB 1Y3UA 2Y81A 1S81A 1EOJA 2W3KA 4JZIA 3OE7D 1KXFA 3SUGA 1TABE 1UJ1A 5DG6A 3NKKA 5EJ1A 2ODYB 2FTLE 3RUOA 2HPPH 5GXPA 2QA9E 1CQQA 5CE1A 5F8TA 7ESTE 1ZOMA 3EYDA 4JZ1A 2Q6DA 1XUIA 1O34A 4Y8XA 1ELVA 1O3HA 1OWDA 5HXFA 2ALPA 4YO9A 1TMTH 2H1UA 4RKOB 1VCPA 2YMSC 4HTCH 1CHGA 3RXLA 3SW2B 3SNBA 1YY3A 3SZEA 4LZ4B 2SGAA 3C27B 1TNKA 3RMOH 2PV9B 1S85A 2ANWA 1N6YA 2G5NA 1E38B 2F9PA 4WVPE 4K1EA 4AYVB 3E0NB 4CREA 1NFWA 2BX4A 2SNVA 1A5HA 2PLXA 3QWCH 3T25A 1FN8A 1GBEA 1K1IA 4X6MA 2Z9IA 2FTMA 2GT8A 2BHGA 4DG4A 3S7KB 4ESTE 5ESTE 4CHAC 1GVKB 1DWEH 3AAUA 1SSXA 1HIAB 1O2RA 4GLYA 1UTOA 3O8DA 4B6EA 1Q2WA 4UFGH 5C17A 1ELEE 1E79D 1A0JA 2L6OA 4ZXXH 1GBCA 1V2MT 3A84A 1T8OA 3BTTE 4IS5A 4K60A 1MZAA 5GJ4B 1O3FA 4JYTA 4AB8A 1W2KH 2XC0A 3KN2A 1BTXA 1LKBA 1P3EA 5EPNA 5L2YH 1LHDH 3RM0H 3GCOA 2BMGB 4NCYA 3QGNB 1NM6A 1W3CA 1RS0A 1UHBA 1GBFA 2FPZA 3OTJE 2FM2A 3TIUA 1WDIA 1W13U 2KX4A 4OS7A 5GPIB 2PKSB 5T6FA 3OX7U 2FX4A 2SGFE 1AGJA 1SBWA 2O8LA 3A83A 5EODA 1PQ5A 3BIVH 1KLJH 1YP9A 2GV7A 2C3SA 1C9TA 3N7DA 1TMUH 2BZAA 4Q80A 2WSSD 1SOTA 3UTUH 5H4IB 3AW0A 1DICA 4BANB 2PSXA 4TPYA 4A7IB 2ZU1A 3A86A 3EE7A 1G2LA 2LP6A 2BDBA 2UWPA 1GJAB 4E05H 1IQIA 1XVOA 3RXOA 1MTWA 3GY6A 3M61U 2A5KA 3RDZA 4CH8B 3PO1C 3SU6A 1HB0B 4F4OC 1QJ6B 3BSQA 2XBXA 1KDQB 1UVUH 3KF2A 3MU8A 1SLVB 2FZZA 1DVAH 3DA9B 1ZPCA 2ZDKA 1TX8A 1OP0A 1GBBA 1T4UH 5T1VA 3TJNA 3ZVCA 1O3MA 1TPOA 3PTBA 3PO1B 2ZC9H 2OCVB 3SGBE 3T5FH 3PROA 3U1JB 1G2MA 2PGQB 2UUKB 5JPMH 1C4Y2 1VGCC 1TA2A 2ANKH 4RSPA 5EXMA 4KP0A 3VXFH 1SQTA 4TYDA 1TPPA 3KGPA 1EZXC 1DE7H 1CBWB 1GWAA 2V3OH 2WV5A 4FOUC 1IQFA 1XXDA 1AMHA 3RLYH 1AUTC 4BAHB 2F9UA 5HKKD 1K1PA 4U32A 2GCTC 1CGHA 3FKSD 2ZU3A 3F9GA 5IDKA 1EB1H 2Q6FA 1SQOA 2R3YA 4Y71A 3U1IB 1BHXB 4KTCA 4XRNA 3RXIA 5HYOA 3M37A 2HWLB 3F9HA 1EPTA 1QRZA 4DY7B 1C1PA 4AOQA 1LDTT 2NU3E 3F2HA 2LELA 4K8BA 2EI6A 2WUCA 1T8NA 3G01A 2C4FH 2H6MA 2A7HA 2F9NA 4A5TS 5C0UA 5KECA 1W0ZU 5JBTA 1ZMLA 5JDUB 4ZHMU 2WPLS 2V7QD 3ZV8A 3UQOA 1K1JA 3OU0A 2ZU5A 2BD2A 1ANBA 4ISOA 1ZJKA 1O2ZA 1HFDA 3ZVFA 3QTOH 4XBCA 2HNTE 1O0DH 1UK3A 1FY1A 3MH6A 5DK1A 1G3BA 3M5MA 2YNBA 3HGNA 4X6OA 5J4QA 2BVRH 1QURH 3URDA 2FYQA 4NGAH 1TGBA 1NESE 3GY3A 4JMYA 2XWAA 3KEEA 3RXHA 3CENA 3V13A 3RXJA 2QE7D 3F1SB 2P3UB 4WMFA 1J15A 1K0HA 3T28A 2BD4A 1G37A 3RP2A 2XCNA 1F2SE 3L3TA 1Z71A 4DOQA 5E2PA 2QF3A 3T29A 1GJ9B 4ACAA 3PV5A 4CR9A 1HAHH 4ABDA 4IMZA 3K65B 1GHYH 2ZWLH 2C8ZB 2Z3EA 2ZGXH 1DXWA 2J4IA 2HNTC 2ZQ2A 3TPIZ 4WWYA 1PFXC 4TY7A 1PPBH 3LONA 3NZIA 1NRQH 1TLDA 3PWCA 1KXAA 1J16A 1BRAA 4YOGA 3TNTA 1O3AA 1BB0B 1GHZA 1GMDF 4BAKB 1Z1JA 4ZKSU 1GBAA 2JJ2D 2FODA 4D9RA 1BT7A 2G52A 4YLQH 4AFSA 3T2NA 1GHVH 1NRNH 4YT7H 5FPYA 1V2TT 1A5GH 3U8TH 2THFB 2KCPA 1GI5A 1F0RA 1V2VT 3S69A 1J14A 1O2SA 4YLUA 1H8IH 4Y8YA 1TGSZ 2V35A 1GI7B 4B2BA 1SFQB 3B8JA 2RFKC 1HGTH 1IQGA 3QLPH 5L6NH 3KYFA 1EP6A 1HIAA 3PM3A 1VJAU 1W0JD 3AAVA 2BLWA 2UWLA 3BTDE 1V2OT 3KCGH 3SV6A 3L6PA 2BY6X 3Q3YA 4ZROA 1WBGB 1FZZA 1AFQC 1O5BB 4Y11E 1YPHE 4AX9H 1GI0A 1PQ7A 3FANA 1TNHA 3SV7A 5A2MH 5CDFE 4Q7ZA 1TX6A 2FOCA 2DUCA 1MABB 5SGAE 1FDPA 1TOMH 3ODFA 2AHME 3KQ5A 1P06A 1P2KA 1NRSH 2P95A 3LGUA 1NBMD 3VGCB 4MNYA 1O35A 2A1DB 3MO9A 1NO9H 2A4GA 1ANCA 3SNEA 1HXEH 2FEQH 1O5AB 3OTPA 4AFQA 2NU2E 1TONA 3HGPA 4FUJA 4K3JA 1TALA 2ODQA 2Y5FA 4TWYA 1GBIA 3A8CA 1EJMA 2BLOA 2NU1E 1XVMA 3O8RA 1PPCE 2V0BA 5TJXA 3A88A 3QO6A 1YPHC 2IJD1 2RA3A 1WTGH 3HKJB 1CGIE 2ILNA 4OS6A 3BG8A 3W95A 3BEIB 2A45B 3F2GA 4MDSA 4DJZB 1ELCA 4ZKRU 1D4PB 2OC0A 1C2IA 1N8OC 4ZXYH 5J4SA 5E2OA 3RXPA 3RXSA 1EFRD 1EJNA 2R0LA 4UDWH 2B8OH 2EI7A 5EOKA 5C67A 5EW2H 2VJ1A 2SGPE 4GUXA 1NS3A 4B75A 2H9HA 2RDLA 1ETTH 2ZPQA 1OYQA 1RIWC 5E0GA 4GCHG 1N8OB 2I6QA 1AB9C 2ZU2A 3R0FA 2HVYB 2P8OC 3K2UA 1BBRE 5CHAB 1A2CH 2JETB 6CHAC 5EJZA 2ZDMA 5C1YA 3SOSA 1G30B 1NFUA 4Q63A 3SU4A 3KQEA 4YM9A 3V0XA 4A92A 3KIDU 1P2NA 1C5QA 5DO4H 2GT7A 2GDEH 3CP7A 2BY9X 1S6HA 5HM9A 2W7UA 1HAPH 1MUEB 5L30H 4HI3A 3D65E 5FPTA 2TIOA 2GZ9A 3QX5H 1IQKA 2TGTA 1K1NA 1UVOA 3DCLA 1TNIA 2PKAA 4K5ZA 3I29A 1ELAA 1MMJN 5CMXH 3EA9A 1BIOA 1XX9A 3SBKA 3P92A 1P2QA 2ZGHA 1AZZA 4Q4LA 2H9EH 4NIWA 3LDXH 4UFDH 5A09A 2ZTZA 3KHVA 4NSYA 3EA8A 3K6YA 3SU5A 1TRNA 3NPSA 3TK5A 3OY5U 1AVWA 1MCVA 3GCHB 3LH3A 3MU4A 7LPRA 3P70B 1H8DH 5C1UA 5KGOA 7GCHF 2FOGA 1P12E 2QYIA 4I8LA 1P2JA 2FLRH 1WXRA 3JZ1B 5EG4A 1DT2A 1O2LA 2G51A 1UHBB 3QUMP 3ELAH 1NY22 2O8TA 1CT0E 1P01A 2RCEA 1OP2A 3UIRA 2BQWB 1P8VC 3FFGA 5DGJA 1AU8A 5PTPA 1DSTA 3LT3A 3UREA 4Y0ZE 3GDVA 1EUFA 1LVOA 2K0QA 3TU7H 1Y5UT 4AGJA 2EI8A 2ZCLP 2VVUA 4NA8A 1RTLA 1GBHA 1VZQH 3SORA 1TPAE 4O3UA 4DGJA 2A2QH 1KLIH 3MO6A 4INLA 4X8SH 4JZFH 1K2I1 1AD8H 2OK5A 2CJIA 2ZF0H 1NT1A 3GYMA 2BZ6H 4MG3A 3C1KA 1K9OE 3QN7A 1P03A 2TRMA 3FO8D 1GJ6A 2P16A 1SFIA 2OUAA 1D3PB 4BXWA 4NA7A 4X1SU 2OD3B 3U69H 2L74A 1Z1IA 4X1NU 1HDTH 1MU6B 2HGTH 1C4U2 3SU0A 1T8LA 1TQ0B 1C2KA 2AGEX 1HXFH 2GMTC 1ZLRA 1WQVH 1PYTC 3F6UH 1O5DH 3MFJA 3ZZBA 1HAYB 4Z6AH 3RMLH 1ACBE 5G4BA 4DIHH 2CMYA 1C1WH 3PMBB 1FI8A 2SGQE 2P93A 3LJOA 4AG1A 4ISHH 1MH0A 1KXCA 1HJAC 2ZEBA 1MKXK 3LGWA 3LC5A 2RG3A 4AGKA 2J97A 3SYJA 5HGGA 1T7CA 3TK9A 1HUTH 3VB3A 5JBCS 2QF5A 1RTKA 2ASUB 2FI5E 2VGCC 2HRVA 3DSOA 3SJ9A 3F9FA 2EY4C 1EP5A 3ATMA 2BB4A 2AS9A 1BRCE 1O32A 4I8KA 2OLGA 1DUEA 1ZSKA 2ZHDA 3WY8A 3AW1A 3FOAA 2ZQ1A 1C5TA 1THRH 3ENSB 2FO9A 4X1RU 1O3LA 1J9CH 1IQEA 4D8NA 3RXKA 1SLUB 5GNDA 1JIMA 3A7YA 2DE9A 2QC2A 4ABEA 3EAJA 1P2OA 2AH4X 2TBSA 3GOVB 1OP8A 1Y5AT 3E90B 1ESBA 1DOJA 3ITIA 1WOFA 2XYAA 3U98H 1XKBC 4X1PU 3SO3A 1SGCA 1B5GH 3P8GA 4JYUH 1E0FD 2D26C 4R0IA 1CA0C 1UTKA 1FMGA 1O3JA 1JIRA 3M3TA 3LGIA 4GPGA 4UEHH 2FX6A 4R8TB 1IQJA 4HZHA 4O3TA 5DP3A 1CE5A 2FS9A 4Y7BA 2WHXA 2ZDLA 1P09A 1V2LT 4JZEH 2R0KA 2WYJA 4J1YA 5B6LA 4DIIH 1HV7A 1ZTKA 2Y7ZA 1YGCH 5F8ZA 3BTWE 1VCWA 3PTNA 2QCYA 3MOCA 4IC5A 1QTFA 3UWIA 2WPHS 5T3HA 2A32A 3KQDA 3ZZ5A 1UO6A 4DW2U 3PLBA 4BAQB 4O9VA 3RXEA 2WPIS 2AGGX 2WPDD 4MQAA 1GMHF 5C2ZA 2YMSB 1MBQA 4GVUA 4H6SB 1V2NT 1MU8B 3ZZDA 1ZTJA 1BTYA 5K7RA 1O2UA 4GHTA 1SGPE 1PPFE 1B0EA 1CT4E 3ZZ3A 1SQRA 2XTTB 1GHAG 1JBUH 1ELTA 1QY6A 5F8XA 5B6OA 5E8EH 3ZVEA 1EJAA 3PMJA 1AWHB 2ZDVH 3KNXA 1CVWH 1CT2E 1QB9A 1V2KT 1C5LH 2WV4A 4RT0A 3Q00A 3A87A 1SL3A 1QL7A 1OHHD 3ZVAA 1UTPA 1OSSA 2UWOA 4JYVH 1LKAA 2Z9LA 1O2TA 1CO7E 3LPRA 5LGOA 3RC6A 4CHAB 2M2AA 3E6PH 4AN7A 2A0QB 2P94A 2ODPA 4K69A 1SPJA 2OQ5A 3SUFA 3TJVA 4MLFB 1BOQA 1H9HE 5C1XA 2Z3DA 1TGTA 1K22H 4RKJB 3NK8A 1GCTC 1SGIB 4XSKU 2DE8A 3BV9B 1P02A 3KYGA 1O39A 2PSYA 2J9NA 5FX5A 1ZHRA 2R2MB 1BMNH 2Y6TA 3PV4A 4FU9A 1TE0A 1VR1H 2VBCA 1OWJA 1Q31A 1Z8RA 2VVVA 3LOXA 6GCHF 4GCHF 5C94A 1WYKA 3PRDA 1F5LA 1S82A 3UQVA 5FBIA 4Y8ZA 1AO5A 5HMAA 3STJA 5BRRE 2PWXA 1D9IA 2ZFFH 4X8TH 1INCA 5A0BA 3SJOA 5DP9A 3SJ8A 2VIDA 3E8LA 1MTNC 4B76A 1FPCH 2KCYA 3SNDA 2BDIA 7GCHG 1GPZA 5HIYA 4Z0KA 3IWMA 3PLKA 1H1BA 3DUXH 3E1XB 1AWFH 3MH5A 1C1NA 2STAE 2BLVA 1GHWH 1ESTA 4NSVA 2CN0H 4JCNA 2FOMB 1W7GH 6ESTA 3H09A 3SN8A 2FYRA 5ABWA 1KXDA 3P8OA 1MKWH 1ARCA 1MTNB 2F9BH 1ELDE 4FUIA 1BTUA 4AC9A 4AFZA 3SZNA 2FOAA 1FY5A 2QGRA 2YOLA 1W10U 1FPHH 2PUXB 1YCPM 3E0PB 3M7TA 1ABJH 4FXGH 3SI4H 2ZDAH 4IMQA 4DVAU 2ZGCA 1C9PA 1G36A 1L2EA 1ZSJA 5AFZH 2BD5A 2WUBA 1LHCH 1C5NH 1GBKA 4XDEA 8LPRA 4AFUA 1O5FH 1O3DA 2VVCA 4D9QA 4KKDA 2ZTYA 4K8YA 2BQ6B 5DP7A 1GVZA 1KIGH 2ZPRA 2NWNA 1AUJA 1CHOG 1O37A 2K1QA 3T62A 5JYIA 2D8WA 5F6MA 4LXBH 5IK2D 1EQ9A 2ANYA 4I86A 1VGCB 2ESTE 2P59A 2PKAB 1DXPA 3LH1A 1O5GH 2VIPA 3ZIAD 5FAHA 2BDCA 4ASHA 4CRBA 1SGRE 4MNVA 1MAYA 4JZDH 1SHHB 4WJG2 2KFWA 2BOHB 3FP6E 1AE5A 1BTWA 2B0FA 3PRBA 3A81A 5K0HA 1DY8A 1DLEA 3PB1E 4FETA 1EAXA 1G3DA 2CGAA 2GCTB 4OS4A 2A2XH 1KSNA 3F3BA 2QF0A 3UUZA 1Y3YA 2VNTA 1JMOH 2B5TB 3B23B 4I8GA 5F53A 1GG6C 1P0SH 1UK4A 3KQCA 2GGVB 3MH4A 1P2MA 3SJIA 3BG4C 1ZGIA 1C5OH 3S9BA 1RRKA 5F03A 4PROA 3LU9B 4F49A 4TWWA 1YLCA 3I77A 4FU7A 1FLEE 1V2PT 4NZQA 2HALA 1D6RA 3SQHE 1DWCH 3LIWA 1QB1A 4ABGA 2ZFPH 4NIYA 3GY2A 4MPWA 3SGQE 3OEED 1Z7KA 4ACBA 1FONA 1PQ8A 2NU0E 1SHYA 2WINI 4BTUB 1S6FA 3GY7A 3QK1A 4I8JA 1AQ7A 4E06H 1NFYA 2HNTF 3PV2A 1O2PA 2FWWA 2TGDA 3FP7E 1D3DB 1IQMA 2XBWA 1SG8B 1YLDA 1TRYA 2VIQA 3ODDA 2VINA 4U2WA 2WPMS 2BXUH 3S9AA 1MD8A 3Q3KA 1BDAA 3N99A 1K28D 1BTHH 1TGCA 3GY8A 3STIA 3K9XB 1ZGVA 4BXSA 3WW7A 2HLDD 1FIZA 1FAKH 1MTUA 2V6NA 1O31A 5GIBA 1GJ7B 1O2MA 5E0HA 4SGAE 2PGBB 5ETXA 4ZH8A 1P2IA 1U6QA 5JB9S 2VWMA 2KCAA 2O8MA 1LQEA 1JXPA 3M7QA 1RTFB 1TIOA 4ZUHA 1XUGA 2O9QA 1F0SA 1O2NA 2P3FH 4ISLA 5CHBA 2FLBH 2GVFA 1O3KA 1SGYE 1YBWA 2OP9A 3HATH 2BY5X 3A8DA 3W94A 4E7NA 4A6LA 1C5RA 1MTVA 2KAIA 2H2ZA 2W5EA 2VIOA 3A7WA 2ZU4A 1Y3XA 2ZTXA 5A0AE 1Y3VA 2BTCE 1GMHG 1FNIA 2ZECA 2QXJA 3GY4A 4DCDA 3H7TA 4FUCA 5AVDA 4F48B 5I25A 4MTBA 4FUFA 4OS2A 4GSOA 1KYNA 2J94A 3A7VA 1YPLH 4K2YA 1JRTA 1QA7A 3M7UA 4I33A 1LHFH 1AFQB 5EQSA 1PPEE 1MKWK 1YKTA 1GJDB 1MKXH 2IPHA 3ZVDA 4YTAA 2BDGA 1BITA 3QGJA 1A3BH 2G4TA 1VITH 1DS2E 2ZFQH 1KY9A 2GP9B 1BTZA 1BMAA 2QY0B 1QL9A 1RFNA 2GZ7A 1P3CA 1L4ZA 3V7TA 1GBJA 3RXDA 5I46H 8GCHF 2EA3A 3ATLA 1YWUA 1EB2A 2ULLA 4P02A 3RXFA 2JH5D 1GJ5H 1C1SA 1O2OA 1COWD 2OINA 1ZMJA 1GHAF 1CGJE 1QQ4A 4YXWD 4WMEA 1E1QD 4ZMAH 3RC5A 3TVJB 2GDDA 5GCHG 4XOJA 2F9OA 3ZVGA 2FOEA 3BTME 1BMLA 1LHGH 2C90B 4GHQA 4B2CA 1FY8E 1DUAA 1BRUP 1Z8JB 2BD7A 1C5VA 1EATA 3TH4H 1Y8TA 6GCHG 1M9UA 2FXRA 1OWEA 3Q77A 4K1SA 3M36A 5EGMA 3UNRA 5T6GA 1HAXB 3EA7A 1GHXH 2KM0A 4XFQA 2A4RA 1BQYA 1ZTLA 3ZYDA 1GJ8B 2ZCHP 1P9UA 2GV6A 1RIWB 4CBOA 2FS8A 2FOHA 3Q76A 1C2MA 1AB9B 1C2JA 4FUBA 1BUIA 2P8OB 1AN1E 3VB4A 2Z9JA 6CHAB 3TGKE 1NN6A 4NFFA 2JH0D 5C20A 4TT3D 1TNJA 1W7XH 4RI0A 2GD4B 2AMQA 1BZXE 2PTCE 3QZRA 2J38A 1UTNA 4Q7YA 1V6DA 5EW1H 2TPIZ 5DP6A 4CRFA 3GS9A 3H5CB 1A61H 3MNXA 4VGCC 4I7YH 4FU8A 2BD9A 2AMPA 1GI8B 1B0FA 1BJUA 4ISNA 2F3CE 2ZZUH 3VEQB 2BDYA 1RGQA 4IN1A 3S7HB 2XBYA 4Y76A 5A8XA 4VGCB 4LZ1H 1N6XA 1H9IE 1NBME 1YPGH 2FP7B 2STBE 1MCTA 1NROH 1C2EA 3D23A 1TAWA 3E3TA 2BX3A 5EU8A 2G55A 3ZV9A 3RMMH 1ESAA 1ID5H 2OC1A 3LGVA 5FCKA 1XKAC 4FUHA 1TPSA 3A80A 4LOYH 4AYYB 1DSUA 2Z6BD 1AKSB 4BAOB 2J95A 1H8HD 2BVXH 3RXVA 1NTPA 4U30A 2PHBA 5JB8S 3FZDA
chains in the Genus database with same CATH topology
1ELGA 2VIVA 1V2RT 1ZPZA 2C8WB 1O2WA 3H7OA 2QXGA 4I8HA 1V3XA 1QNJA 4ZHLU 1CHOF 4ABAA 1C1OA 1LCYA 3MWIU 2FDAA 4WH8A 2ANMH 2OC8A 1T8MA 5ESBA 8ESTE 1J17T 4MPUA 1D3QB 2G8TA 2ZPSA 2VB0A 3UY9A 3SNCA 3MNSA 1C5XB 2SGEE 4Y10E 1N1LA 1SR5C 1HJ8A 3LKWA 2Q6GA 1F92A 3E16B 1QB6A 4SGBE 1EZSC 1HYLA 1C1UH 3B9FH 1LPKB 1T31A 1TOCB 3FZZA 1O2GH 3HK3B 3ZZAA 1TRMA 1UVPA 4WXIA 1SQAA 1V2ST 1YF4A 1W8BH 1A5IA 1AE8H 4THNH 1A4WH 2Y82A 2GMTB 4K1TA 5E0JA 2ZFTA 1Y59T 1EXFA 1G32B 2OBQA 1O3IA 2ZA5A 3D62A 3HPTB 1OWHA 3UNSA 5GWZA 4MNWA 3LJJA 5AF9H 1K1OA 1HJAB 1SI5H 1A3EH 1TQ7B 2BY7X 3VXEH 3V3MA 1E36B 2XWBI 1O2IA 2F9VA 3EQ0H 3MNBA 3M5OA 1ZMNA 2VGCB 1TNGA 3S9CA 3RU4T 1FV9A 2GKVE 1SLXB 1XUFA 1V2JT 4OS1A 2C8YB 6LPRA 1WU1A 4JK6A 4RN6A 1VCQA 1ZPBA 1YYY1 1DWDH 3TJUA 3SV8A 2AERH 1YCPK 2BY8X 1P05A 2CF9H 2FI4E 4A1XA 1S5SA 4BTTB 3ZVBA 3FVFB 4AG2A 1LO6A 3DHKH 3BTFE 1C4V2 2VIWA 1UMAH 1O3EA 1QR3E 3M3SA 3UOPA 3TLOA 1C5WB 1QJ7B 2CF8H 1O2VA 2XXLA 2H5DA 2SGDE 5EQRA 2BYAX 3CS0A 4NWLA 1IHSH 5HM2A 5FBEA 4ABFA 3GYLB 3URCA 4UONA 1L1GA 4X6NA 4B71A 1CA0B 5C5OA 1QCPA 4CRCA 3ZZ6A 1IQNA 1DM4B 1ZHPA 1C2DA 1FIWA 2Y5HA 2ZGBH 2Z3CA 4H4FA 1LVMA 1CSOE 1L4DA 2QXIA 5DP4A 1GL1A 2BD3A 4LK4A 3VB7A 1AVGH 1QBNA 1BCUH 1WTHD 1BMMH 3TITA 3SUDA 9ESTA 1LPZB 1GL0E 1DITH 2FMJA 1GGDC 3QDZB 3K6ZA 4NG9H 1MZDA 2FIRH 2A31A 4TPIZ 3TGJE 1GI9B 1DX5M 8GCHG 3FP8E 5A8YA 2ZG0H 4A1VA 1O3CA 1MAXA 1SGTA 1P04A 1F0TA 1IHTH 3VPKA 2VWNA 1GGDB 2F83A 1GI2A 2XC5A 1O38A 4NZLA 2GTBA 2J34A 2PW8H 1OOKB 2VH0A 1A46H 4B74A 1H9LB 2BOKA 1Y5BT 2CXVA 3MU0A 2AEIH 2F91A 2YNAA 3RXTA 4YESB 2C93B 2ZDNA 3IITA 3RXQA 1MTSA 3T26A 5L2ZH 1IQHA 3SI3H 4ZHAA 4WY3A 2KAIB 1C5ZB 1NZQH 1C5UA 3BIUH 3EDXB 1B7XB 1LVBA 1H4WA 2B9LA 2WPJS 2M5TA 3NXPA 1YC0A 3U9AH 1O3OA 3GISB 1OPHB 1V2UT 1GBMA 1QHRB 4J2YB 1A0HB 5A8ZA 4ABBA 5C3NA 4WF8A 5GDSH 5EQQA 2HPQH 3RXRA 1F5RA 1F7ZA 2Y80A 1SMFE 2QV1A 3SUEA 4Q2KA 1GMCG 5GCHF 3UOUA 1TX7A 5JBBS 1MBMA 3MYWA 3GCTG 2Z94A 1O2QA 3NCLA 1O2JA 8KME2 5FCRA 1SGDE 3HKIB 5IYTA 1NRPH 1P9SA 2AMDA 2H9TH 4ZAEA 1GCTB 2G4UA 1HBTH 2IJOB 4X8VH 4FUEA 1X7AC 2PKSC 1AFEH 3ATIA 1AKSA 3BTHE 1P11E 1TBRH 1CA8B 4INHA 3M35A 1HLTH 1QQUA 1IOEA 2FESH 1IQLA 1TYNA 2LNCA 4YOJA 1K21H 2H5CA 3MU5A 2WYGA 3LGYA 1JOUB 1QIXB 4TY6A 1UTJA 1DDJA 3MU1A 3RLWH 1QFKH 5DJ7A 2PR3A 3GDUA 1SGNE 1FXYA 3R3GB 4GAWA 3OYPA 1O3GA 1L1JA 4UFEH 4ABHA 1F5KU 1Z6JH 2FI3E 2GCHG 2PFEA 1QA0A 1OS8A 1DFPA 1EAUA 2AFQB 2TGPZ 1LHEH 2A5AA 3SU1A 1K1MA 5AHGH 1S84A 1TNLA 1SVPA 3DD2H 4U01A 4OGXA 1Z8GA 2QXHA 2ZP0H 3GY5A 4INKA 1HRTH 1THPB 3P17H 3D49H 1L1NA 2Z9KA 1C5YB 1GHBF 1ANDA 1FN6A 3ZZ9A 4FUDA 1WV7H 3SGAE 2OQUA 1EZQA 1CBWC 5FHTA 5EXLA 1UTQA 4X6PA 2XC4A 3VB6A 1C5SA 1BHXF 3EE0B 1HAVA 3P8FA 4IGDA 2ZFRH 3PWBA 1UVSH 3ZZ8A 1UVTH 3RXMA 3BF6H 2Q1JA 1BBRH 5A0CA 1Y3WA 2QAAA 2WPKS 3AASA 2FOFA 1GBLA 3M3VA 4KELA 1A1RA 1UTMA 1A0LA 3SV2H 1UK2A 3UR9A 1JWTA 1K1LA 1ARBA 3M5NA 1SB1H 1PPZA 3GCNA 4X2WA 1LMWB 3PMAB 4XBDA 2O8UA 1PJPA 1W14U 4Y7AA 1OWIA 5LPEA 2R9PA 4AORA 1PPHE 2G00A 4CRDA 4MPVA 1ANEA 1KXEA 1T4VH 3BTQE 1DY9A 4FVDA 1G9IE 4ZKNU 1GG6B 2C8XB 5EPYA 3NWUA 3BG4B 4I31A 1DLKB 1D3TB 2A7JA 1V2QT 1E35B 3SNAA 4B2AA 2BXTH 4D76A 3N7OA 1MQ6A 4IN2A 1O5CB 4Y6DA 1QBVH 1C2LA 4WMDA 1O36A 1Z6EA 4X0WU 5LPFA 3TH3H 2HVXA 1GI6A 2OXSA 2J2UA 1VJ9U 1GVLA 2XCFA 4BTIB 1UCYH 1OWKA 1EX3A 4MPXA 1C2GA 3ESTA 4CH2B 1YPMH 1ZRKA 1VITG 2FOBA 4AB9A 5JBAS 1QRWA 3A89A 4Y0YE 3RXCA 1GJCB 1FQ3A 2CV3A 1QJ1B 2B7DH 3MI4A 1AHTH 4FUGA 1TA6A 2OC7A 3A7TA 4CR5A 2A5IA 3UNQA 1MQ5A 3A8AA 1FY4A 2ZHQH 3BEUA 3TJOA 1C2HA 2W26A 1F0UA 2VWOA 3A8BA 1GI3A 1NRRH 1BRBE 1TBQH 4ABIA 1EAWA 3BTKE 5FX6A 1DANH 1ZR0A 1XUHA 2BVSH 3JZ2B 4CBNA 3HK6B 4NIXA 1HJ9A 2VU8E 1BJVA 1PPGE 3OY6U 3QZQA 2JH6D 5T6DA 3CS7A 3PMHB 3DFLA 1E34B 2ZFSA 4E7RG 4OS5A 4X2YA 3V12A 1ZZZA 2ZI2H 1O3BA 2SNWA 4AZ2B 2CHAC 2ZNKH 1EZUC 1O3PB 3RXBA 1LQDB 2G5VA 2ZIQH 1O3NA 1NC6A 1FJSA 4IBLH 1W12U 3BEFB 1ZSLA 2BLQA 4YT6H 1HAZB 4H6TA 1KTTB 2BD8A 2HLCA 4H42U 5LPRA 5TCCA 2CHAB 1OX1A 3ZZCA 1TWXB 3RU4D 4D7FA 4MNXA 1RJXB 3TGIE 3F9EA 1O2XA 4BOHA 3U8RH 3MMGA 3VGCC 4MVNA 3I78A 4X2XA 1SGFA 2AIPA 1ZJDA 2BDHA 2I6SA 3SHCH 3TNSA 1GJBB 1NU9A 3GICB 4JK5A 3FAOA 1DWBH 1W0YH 1S0RA 4FVBA 1WQSA 1GCDA 1C1RA 5TCAA 3O8CA 1SGFG 2J92A 3UPEA 2ZHEH 4KGAA 3A7ZA 3GDSA 1SC8U 1ELBA 2OTVA 4I32A 1GBDA 1J8AA 1YCPH 4Y79A 1PYTD 2UUYA 4QT8C 4OGYA 2GZ8A 1EASA 1QBOA 1BBRK 2W7SA 4B1TA 1Z8IB 1BTPA 5CHAC 1W11U 1C1VH 2BDAA 2QN5T 2JETC 1RXPA 4NWKA 3IG6B 1KDQA 4NA9H 1HAGE 1KTSB 1C2FA 2PTNA 1GMCF 3VB5A 1IAUA 1WCZA 4HFPB 2QIQA 3U8OH 1SGQE 3GCTF 3SHAH 2OBOA 2HOBA 1XM1A 2AIQA 2Y5GA 3RXUA 1KXBA 1S0QA 1TB6H 3RXGA 1OKXA 1KLTA 2G81E 2EC9H 1C5MD 3KL6A 2A4OA 2PUQH 1XXFA 3TK6A 3PYHA 4WXVA 1V2WT 2XRCA 1AVXA 1LVYA 4KTUA 1S83A 3RXAA 1QL8A 1WAYB 3ATKA 4B73A 4X8UH 4ISIH 1GBTA 1QRXA 1THSH 2UUJB 1XUJA 1YPJH 1ZYOA 1XUKA 3LC3A 3SU2A 4DURA 1O2HA 3Q3XA 4BAMB 3UR6A 4HGCA 3GCHC 3RU4E 5LH8A 1OYTH 2W3IA 5FXLA 1AIXH 1L0ZA 1SLWB 3OSYA 1RD3B 1UCYK 1FY3A 1GHBG 1O33A 4WH6A 1WSSH 2GCHF 3P6ZB 1P57B 1O30A 4O97A 1GI4A 2R3UA 1MD7A 4UFFH 1O2YA 3ZZ4A 1HPGA 1ELFA 4IW4E 3S0NA 1ZRBA 2V3HH 3L33A 4A1TA 1UCYE 5FPSA 1EKBB 2BQ7B 4KTSA 2UUFB 1HAOH 2VH6A 1WUNH 4NFEA 1AY6H 4BNRA 3LGTA 1D6WA 1GDUA 4X1QU 1JRSA 3QTVH 3P8NA 1GI1A 1ORFA 2IOTA 5BPEA 2A7CA 3DT0H 3ZZ7A 2XNIA 1DPOA 1FUJA 2O8WA 1AI8H 1O2KA 1E37B 2Y7XA 4UD9H 1G3CA 1EOLA 2NU4E 5C5NA 2D1JA 1AZ8A 5DKMA 1YPEH 1BA8B 2JKHA 2ZO3H 1YM0A 2EEKA 3KQBA 1GDQA 3MNCA 3P95A 3T27A 3DFJA 1CU1A 2Z9GA 4M7GA 4CRAA 3PLPA 2RA0A 4YZUA 1HAIH 1C5PA 4XE4A 2ZCKP 2XBVA 1C1QA 4CRGA 1NU7B 4UE7H 2IN2A 1OXGA 5EXNA 3A85A 1GDNA 3MTYA 3TH2H 3A7XA 4XBBA 3SV9A 4X2VA 3F68H 1TFXA 3ATWA 1TMBH 3NUMA 3O8BA 1ETSH 3MO3A 3EGKH 1A7SA 3BTEE 1TGNA 2XW9A 2ZHWH 3RC4A 1HAVB 2ALVA 1NFXA 1O5EH 5DP8A 1HCGA 2GX4A 4DT7B 1PQAA 2ZKSA 1XMNB 3AVZA 1C1MA 1LPGB 3BN9A 2Z7FE 3MH7A 1HNEE 3A82A 1C1TA 3SU3A 3VFEA 4ABJA 1NPMA 5AFYH 3RM2H 3SQEE 3ZYEA 1EPTC 2SFAA 3UWJH 1QGFA 1UTLM 2R2WU 1SGEE 2AYWA 4IC6A 4Q7XA 4YOIA 3E91A 1T32A 1SOZA 3UFAA 4ZKOU 1ABIH 1EPTB 1YPKH 1FAXA 1GMDG 3SJKA 1VITF 2ZGJA 2D2DA 1EAIA 2AGIX 7KMEH 3BTGE 2ZHFH 4NIVA 1P10A 9LPRA 5DPAA 3RMNH 1LTOA 2A4QA 1ETRH 3M5LA 1TBZH 2BM2A 4O03A 4D7GA 2TGAA 2VWLA 5DP5A 3MHWU 1GJ4H 1G3EA 2LPRA 1ZHMA 1Q3XA 2P3TB 1Y3UA 2Y81A 1S81A 1EOJA 2W3KA 4JZIA 1KXFA 3SUGA 1TABE 1UJ1A 5DG6A 3NKKA 2ODYB 2FTLE 3RUOA 2HPPH 5GXPA 2QA9E 1CQQA 5CE1A 5F8TA 7ESTE 1ZOMA 3EYDA 4JZ1A 2Q6DA 1XUIA 1O34A 4Y8XA 1ELVA 1O3HA 1OWDA 5HXFA 2ALPA 4YO9A 1TMTH 2H1UA 4RKOB 1VCPA 4HTCH 1CHGA 3RXLA 3SW2B 3SNBA 4LZ4B 2SGAA 3C27B 1TNKA 3RMOH 2PV9B 1S85A 2ANWA 1N6YA 2G5NA 1E38B 2F9PA 4WVPE 4K1EA 4AYVB 3E0NB 4CREA 1NFWA 2BX4A 2SNVA 1A5HA 2PLXA 3QWCH 3T25A 1FN8A 1GBEA 1K1IA 4X6MA 2Z9IA 2FTMA 2GT8A 2BHGA 4DG4A 3S7KB 4ESTE 5ESTE 4CHAC 1GVKB 1DWEH 3AAUA 1SSXA 1HIAB 1O2RA 4GLYA 1UTOA 3O8DA 1Q2WA 4UFGH 1ELEE 1A0JA 4ZXXH 1GBCA 1V2MT 3A84A 1T8OA 3BTTE 4IS5A 4K60A 1MZAA 5GJ4B 1O3FA 4JYTA 4AB8A 1W2KH 2XC0A 3KN2A 1BTXA 1LKBA 1P3EA 5EPNA 5L2YH 1LHDH 3RM0H 3GCOA 2BMGB 4NCYA 3QGNB 1NM6A 1W3CA 1RS0A 1UHBA 1GBFA 2FPZA 3OTJE 2FM2A 3TIUA 1W13U 4OS7A 5GPIB 2PKSB 5T6FA 3OX7U 2FX4A 2SGFE 1AGJA 1SBWA 2O8LA 3A83A 5EODA 1PQ5A 3BIVH 1KLJH 1YP9A 2GV7A 2C3SA 1C9TA 1TMUH 2BZAA 4Q80A 1SOTA 3UTUH 5H4IB 3AW0A 1DICA 4BANB 2PSXA 4TPYA 4A7IB 2ZU1A 3A86A 1G2LA 2BDBA 2UWPA 1GJAB 4E05H 1IQIA 1XVOA 3RXOA 1MTWA 3GY6A 3M61U 2A5KA 3RDZA 4CH8B 3PO1C 3SU6A 1HB0B 4F4OC 1QJ6B 3BSQA 2XBXA 1KDQB 1UVUH 3KF2A 3MU8A 1SLVB 2FZZA 1DVAH 3DA9B 1ZPCA 2ZDKA 1TX8A 1OP0A 1GBBA 1T4UH 3TJNA 3ZVCA 1O3MA 1TPOA 3PTBA 3PO1B 2ZC9H 2OCVB 3SGBE 3T5FH 3PROA 3U1JB 1G2MA 2PGQB 2UUKB 5JPMH 1C4Y2 1VGCC 1TA2A 2ANKH 4RSPA 5EXMA 4KP0A 3VXFH 1SQTA 4TYDA 1TPPA 3KGPA 1EZXC 1DE7H 1CBWB 1GWAA 2V3OH 2WV5A 1IQFA 1XXDA 1AMHA 3RLYH 1AUTC 4BAHB 2F9UA 1K1PA 4U32A 2GCTC 1CGHA 2ZU3A 3F9GA 5IDKA 1EB1H 2Q6FA 1SQOA 2R3YA 4Y71A 3U1IB 1BHXB 4KTCA 3RXIA 5HYOA 3M37A 2HWLB 3F9HA 1EPTA 1QRZA 4DY7B 1C1PA 4AOQA 1LDTT 2NU3E 4K8BA 2EI6A 2WUCA 1T8NA 3G01A 2C4FH 2H6MA <