1Y56B

Crystal structure of l-proline dehydrogenase from p.horikoshii
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
374
structure length
374
Chain Sequence
LPEKSEIVVIGGGIVGVTIAHELAKRGEEVTVIEKRFIGSGSTFRCGTGIRQQFNDEANVRVMKRSVELWKKYSEEYGFSFKQTGYLFLLYDDEEVKTFKRNIEIQNKFGVPTKLITPEEAKEIVPLLDISEVIAASWNPTDGKADPFEATTAFAVKAKEYGAKLLEYTEVKGFLIENNEIKGVKTNKGIIKTGIVVNATNAWANLINAMAGIKTKIPIEPYKHQAVITQPIKRGTINPMVISFKYGHAYLTQTFHGGIIGGIGYEIGPTYDLTPTYEFLREVSYYFTKIIPALKNLLILRTWAGYYAKTPDSNPAIGRIEELNDYYIAAGFSGHGFMMAPAVGEMVAELITKGKTKLPVEWYDPYRFERGELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a novel FAD-, FMN-, and ATP-containing L-proline dehydrogenase complex from Pyrococcus horikoshii
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Oxidoreductase
molecule keywords hypothetical protein PH1363
total genus 126
structure length 374
sequence length 374
ec nomenclature ec 1.5.99.8: Transferred entry: 1.5.5.2.
pdb deposition date 2004-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01266 DAO FAD dependent oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.9.10 Alpha Beta 2-Layer Sandwich D-Amino Acid Oxidase; Chain A, domain 2 D-Amino Acid Oxidase, subunit A, domain 2 1y56B02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1y56B01
1REOA 2A8XA 3JSKA 3ZNNA 1BKWA 4H4WA 2E48A 2BS3A 3KA7A 1TYTA 5CQFA 4U8NA 2NVKX 2BABA 3GYIA 3AEGA 3KKJA 5GSNA 3RNMA 1PBEA 2OALA 4C5OA 4OPLA 1GESA 4AP1A 3PVCA 5C2TA 1S2QA 1GERA 1FCDA 4BK2A 1XPQA 4GDEA 4KX6A 4EMWA 4Z25A 1PXBA 3II4A 4DSGA 2AR8A 1D7LA 4YKFA 1CJCA 4Z2UA 4CNJA 2VRMA 3ICTA 5KVHA 4YJHB 2B9XA 2FBWA 4EMJA 2GQWA 4C74A 2B9YA 1X31B 3AE4A 2R4EA 4Y4NA 3R9UA 3UKHA 1DODA 3I6DA 3W4KA 3FIMB 1DXLA 3COXA 2C3DA 3ICSA 3GRTA 1GETA 3CNDA 1P2EA 3EF6A 1NHRA 5JCIA 2X8HA 1D4EA 2AAQA 4X9NA 1RP0A 1TRBA 1TYPA 3AE7A 2R0PA 3LOVA 3UKPA 1H81A 2Q6UA 4Z2TA 4EIQA 1QJDA 1E39A 2EQ7A 1JNZA 1NG3A 2WPCA 2YM1A 2BXSA 4WX1A 3AE8A 3NIXA 3P4QA 3S5WA 4B68A 3AYJA 4ZN0A 2AQJA 3RP7A 3VRBA 3LADA 2XFNA 3IF9A 1TDKA 2ZZCA 4H4VA 1GRBA 3UTGA 3C4NA 2BK4A 5U1OA 2BA9A 3NNEA 4YSHA 3RP6A 1JEHA 4B65A 4GF7A 1OJTA 1O95A 4H4ZA 4IA5A 3UKQA 4EQXA 4YSXA 4Z43A 1GTEA 3ABVA 4PAAA 2F5ZA 4NEVA 2WQYA 4A6NA 2GRTA 2GMHA 1E1KA 3NKSA 4P9SA 3P4RA 2IVDA 2YG4A 4YXDA 3C4AA 2NPXA 2GVCA 1O5WA 2CVJA 1D7YA 3AE3A 2W0HA 1PS9A 2GEWA 5FMHA 3IHGA 3D8XA 3BHFA 4OPDA 3P9UA 1H86A 1CC6A 3ICRA 3W4IA 3UOXA 3B3RA 2R4JA 3K7QX 4LA1A 1YQ3A 1CF3A 1VG0A 1PHHA 2GAGB 3OZ2A 2B76A 1Q1RA 2WETA 3REDA 4USQA 4KPRA 3VQRA 2GR1A 3SGLA 2GH5A 3DK9A 2XLTA 3ZNQA 4CY8A 2C3CA 3UOZA 4H2NA 1CBOA 5GRTA 1MXTA 3DJDA 1LQTA 2FJEA 4CY6A 1XANA 1S3BA 1RSGA 1YY5A 3OC4A 3CUKA 1F8WA 5M0ZA 1ZX9A 3UKLA 4C3YA 3AECA 1PBFA 1M64A 4J31A 4K5RA 1XHCA 3QFAA 1C0KA 3NH3X 3W4JA 2FJDA 1ONFA 4H50A 2QCUA 2OLOA 3ZNPA 2R0CA 2YWLA 4JNQA 1S3EA 4CCQA 2XFQA 2ZZ0A 2BXRA 2BK5A 1AN9A 3PS9A 2DKHA 1DJNA 4LU6A 1TDNA 1P2HA 3ALLA 3H8IA 2BACA 4TM3A 4U2SA 2JK6A 1BGJA 1LJ1A 1KSSA 1N4WA 2BK3A 4YJFA 2XLUA 2YLRA 3K30A 1BF3A 4NZHA 3P4SA 5U25A 2ZBWA 2JB3A 5C3JA 1OJDA 1C0IA 1F8RA 4QFDA 1K0JA 1ZP0A 1QLBA 2V5ZA 3NYFA 1L9EA 4X9MA 1LVLA 3DGZA 4B69A 2YG5A 3DJEA 1DAOA 4IA6A 5EB4A 1NPXA 4J34A 1CJ4A 3M13A 4EM3A 2XVEA 4XWZA 2WOIA 1VQWA 4GDPA 3AYLA 1D5TA 4H4SA 4CRTA 4D04A 1Q9IA 1IUVA 4C3XA 2YG6A 3UKAA 1K0IA 2XCGA 4B1BA 2C70A 3P1WA 2XDOA 1TDFA 3EANA 3KU9A 3LZWA 3UKFA 4B64A 4U8LA 2Y6QA 3KLJA 1FOHA 1KFYA 2YLTA 4AT2A 5M10A 4C77A 4H2QA 1JNRA 5ER0A 4A99A 4H4TA 2Y6RA 3G5QA 3BI4A 5EB5A 1IJHA 2C66A 2YG7A 2YR5A 4IV9A 3BNUA 1PXCA 1XDIA 5HHFA 3NN6X 2JAEA 1DOEA 2E82A 1BWCA 2B9WA 4FX9A 2PHHA 1CHUA 3IHMA 2XVFA 4TLXA 2XVIA 3QSMA 3FPZA 3CNTA 2V3AA 4UDRA 5BUKA 1YQZA 3BNMA 2ACZA 3QFBA 4RSLA 1S2YA 3RHAA 2TPRA 2GAHB 1BGNA 1E1NA 2BCGG 2R45A 4BK3A 2IVEA 4IVMB 2VRLA 3DA1A 2Q7VA 3DK8A 4GRTA 2EQ6A 4A6NB 4A7AA 3BI5A 1JRXA 3NT6A 5CKUA 1BZLA 4APNA 3H4KA 2YLZA 2GV8A 3I3LA 4HA6A 5KWFA 4WCTA 3NRNA 5FS8A 1EBDA 1LTXR 4YJFB 2RABA 1EL8A 3QSSA 5L46A 1NEKA 2I0ZA 2R9ZA 4Z26A 4E0VA 5IQ1A 2XLRA 1KDGA 3AE9A 5FS6A 1K4QA 2C72A 4BV6A 1EL9A 2Z5YA 4BK1A 3GDNA 3PO7A 4A79A 4TLZA 4ADWA 3NHOX 4JDRA 2ARDA 2OA1A 3NLCA 2YLXA 3E1TA 4AT0A 3AE2A 2R0GA 3B6DA 2WU5A 2RGOA 2V61A 4AOXA 5KOWA 1HYUA 2J3NA 2JKCA 4GUVA 4Y4LA 3GMCA 1FL2A 5U63A 4BJZA 4EMIA 3AEEA 2Q0LA 1MOKA 4YWOA 3QSEA 4AP3A 1H83A 1LQUA 2BS2A 4O5QA 2WPFA 3CGBA 3DH9A 1YKJA 1D4CA 1KF6A 2VVLG 4BJYA 4Z2RA 4H2RA 3CPJG 3GWFA 2GB0A 1E6EA 4YKGA 1IUUA 4PABA 4RG3A 4IVOB 3DMEA 4H4YA 1GOSA 3NK2X 3GDPA 1CC2A 3ATQA 2WPEA 1CC4A 2XFUA 4U8KA 2XYOA 5HYMA 3UP5A 4U8MA 4JY3A 1DNCA 3ZNOA 1GRFA 4ZCDA 2YVFA 1O94A 4CBQA 3QVRA 3ZDNA 2XFPA 4K2XA 3WE0A 2VVMA 2WP6A 3EAOA 1Y0PA 1RYIA 3LB8A 5IQ4A 2A87A 3LXDA 1L0VA 1PN0A 1UKVG 1NHSA 2APGA 2X50A 5IPYA 3QVPA 2O9ZA 4O5UA 2C73A 1GRGA 3F8PA 3FMWA 4U8IA 2C76A 5TR3A 1CJ2A 1Y56B 5JCKA 1ZMDA 2CULA 2WESA 3ISHA 3UTHA 1VRQB 3AB1A 1MO9A 2TMDA 1GV4A 4UDPA 1ZOYA 1E7PA 3LJPA 2A89A 4K22A 1IUTA 1ZOVA 4ICYA 3AWIA 3UTFA 5BULA 1TDEA 3DJJA 3VRDB 3NK0X 2CFYA 4EQSA 3WGTA 1H7XA 3CPHG 1ELIA 3M12A 2BS4A 3AE5A 4UDQA 3ZYXA 1H82A 3Q9TA 5LV9A 1PJ5A 3UCLA 3V76A 1OJAA 3FG2P 4J2WA 4OCGA 2WHDA 1AOGA 3AD9B 2X99A 4B66A 1DJQA 1ZMCA 2JB1A 4I59A 4NEWA 2FJBA 1GT8A 1N4UA 3NTDA 4M52A 4NTEA 4ZCCA 3S61A 1JU2A 3H8LA 3AE1A 3AD7B 1GTHA 3K7TA 2V3BA 4YJGA 4YSYA 3VRAA 3FBSA 2WOVA 3GD3A 3GRSA 2WU2A 3AE6A 3IWAA 1GRHA 2E4GA 1GREA 3NN0X 5KVIA 3T37A 3AXBA 4YJDA 2YM2A 4XXGA 3SQPA 2VVLA 4YTPA 2FJAA 2VQ7A 2WEUA 2DKIA 3AD8B 2E4AA 4TM0A 3ALMA 4Z44A 4Y4MA 2WBAA 4H4UA 4OPCA 2EQ8A 1PBDA 3V3OA 4DGKA 3UP4A 3P4PA 1QO8A 5DBJA 3ITJA 3NGCX 4JNAA 2YLSA 3O0HA 4CNKA 2IIDA 5JCMA 1IUXA 1Y56A 3NG7X 5EOWA 4OPTA 4USRA 2BC0A 3SM8A 4UP3A 3D1CA 2C7GA 2QA2A 4K8DA 4NTCA 5BRTA 1JRYA 3V3NA 3C96A 4YSZA 4B63A 3RP8A 1DOCA 1TDOA 2GR0A 2RGJA 2X8GA 1VG9A 1CL0A 4H4XA 4MJWA 3AEDA 1B5QA 2DU8A 1VDCA 4JQ9A 5KXJA 2GR3A 1PBBA 4U2LA 2B7SA 4D03A 4J57A 2YVJA 3NK1X 2YG3A 4CCRA 1C0LA 1CJ3A 4U8OA 3M0OA 1B8SA 1KNPA 3UOVA 1K0LA 1KNRA 3DK4A 1NHQA 3BI2A 3GMBA 2GF3A 3GWDA 4FDCB 1V59A 3QJ4A 4GR1A 2QA1A 2WP5A 2XLSA 2WDQA 2HQMA 2XVJA 5FS7A 4J56A 1OJCA 1GXFA 1FEBA 1H84A 2X8CA 2GQFA 3DGHA 1W4XA 1Z6LA 3CNJA 3AEBA 1L9DA 2YAUA 5EBKA 1NHPA 3AEFA 1GRTA 3CN8A 4X4JA 4FK1A 2JBVA 3CNPA 1KSUA 4H2PA 3SFDA 5KOXA 1IUSA 4REKA 4U8JA 1Q1WA 4HB9A 2OAMA 4QFCA 1NAAA 4AOSA 3GYJA 3ADAB 3EPTA 2BYBA 1E1MA 1L9CA 3NYCA 2E1MA 4OPUA 5JCNA 3NYEA 1JOAA 1ZDLA 2C67A 2VZ2A 1GSNA 1B37A 1COYA 1E1LA 4YJHA 1FECA 5J7XA 2ZZBA 4EQWA 3VR9A 2BCPA 3ALJA 4A65A 4LIIA 1PJ6A 3GD4A 4XWRA 3L8KA 4A9WA 2YLWA 2B7RA 4JN9A 2EQ9A 2WP9A 4U8PA 2V6OA 5BVAA 3CNSA 4YTNA 2YQUA 3LZXA 5JCLA 4B67A 2WDVA 1F3PA 3CGCA 2YVGA 3BHKA 1GEUA 1EL5A 1ZY8A 2Q0KA 3GSIA 1PXAA 1N4VA 2RGHA 3G5SA 3UTEA 3G5RA 4DNAA 2YR4A 3Q6JA 2OLNA 2X3NA 4GCMA 4I58A 2PYXA 1PBCA 2YR6A 4U2TA 3HZLA 4J36A 1DDOA 1NENA 1F6MA 1B4VA 3SFEA 2GMJA 1H7WA 2BC1A 3CTYA 2E5VA 3KD9A 4EIPA 4OPGA 1F8SA 2WOWA 3CGDA 3DJGX 4H4QA 4K5SA 2C64A 2Z5XA 3F8RA 4H7UA 1EL7A 2H88A 4Z24A 4EQRA 2C65A 3ATRA 1IUWA 1LV0A 2C75A 1YQ4A 2VQBA 3NTAA 4RG4A 2WDRA 2QAEA 2CDUA 2H89A 3K7MX 3L1RA 4FK1C 4EM4A 5HXIA 3CGEA 3AEAA 3G3EA 4YTMA 4DSHA 3CIRA 4H4PA 4TM1A 5HY5A 3IC9A 4J33A 1KIFA 1H6VA 4N9XA 1GALA 1SEZA 1GPEA 1PJ7A 5J60A 1LPFA 1OJ9A 2E49A 3CPIG 1DOBA 2XLPA 4NTDA 2VOUA 5KRQA 1FEAA 1ZK7A 2WS3A 3VR8A 4A5LA 3AYIA 2GR2A 1NG4A 4K7ZA 2UZZA 1GRAA 3KPFA 2JB2A 1N1PA 1C0PA 4BURA 1GNDA 1JRZA 1M6IA 3UKKA 3UOYA 4YT0A 2V60A 3KVEA 1NDAA 3F8DA 5FS9A 1PDHA 4H4RA 4OVIA 1VE9A 1D4DA 1ZKQA 2XVHA 3URHA 2R46A 2XFOA 4JY2A 4OPIA 4YJGB 4TM4A 1EVIA 4ECHA
chains in the Genus database with same CATH superfamily
1REOA 2A8XA 3JSKA 3ZNNA 1BKWA 4H4WA 2C4CA 2E48A 2BS3A 3KA7A 1TYTA 5CQFA 4U8NA 2NVKX 2BABA 3GYIA 3AEGA 3KKJA 5GSNA 3RNMA 3T2YA 1PBEA 2OALA 4C5OA 4OPLA 1GESA 4AP1A 3PVCA 5C2TA 1S2QA 1GERA 1FCDA 4BK2A 1XPQA 4GDEA 4KX6A 4EMWA 4Z25A 1PXBA 3II4A 4DSGA 2AR8A 1D7LA 4YKFA 1CJCA 4Z2UA 4CNJA 2VRMA 3ICTA 5KVHA 4YJHB 2B9XA 2FBWA 4EMJA 3CMMA 2GQWA 4C74A 2B9YA 1X31B 3AE4A 2R4EA 4Y4NA 3R9UA 3UKHA 1DODA 3I6DA 3W4KA 3FIMB 1DXLA 3COXA 2C3DA 3ICSA 3GRTA 1GETA 3CNDA 1P2EA 3EF6A 1NHRA 5JCIA 2X8HA 1D4EA 2AAQA 4X9NA 1RP0A 1TRBA 1TYPA 3AE7A 5KMQA 2R0PA 3LOVA 3UKPA 1H81A 2Q6UA 4Z2TA 4EIQA 1QJDA 1E39A 2EQ7A 1JNZA 3T14A 1NG3A 2WPCA 2YM1A 2BXSA 4WX1A 3AE8A 3NIXA 3P4QA 3S5WA 4B68A 3AYJA 4ZN0A 2AQJA 3T31A 3RP7A 3VRBA 3LADA 2XFNA 3IF9A 1TDKA 2ZZCA 4H4VA 1GRBA 3UTGA 3C4NA 2BK4A 5U1OA 2BA9A 3NNEA 4YSHA 3RP6A 1JEHA 4B65A 4GF7A 1OJTA 1O95A 4H4ZA 4IA5A 3UKQA 4EQXA 4YSXA 4Z43A 1GTEA 3ABVA 4PAAA 2F5ZA 4NEVA 2WQYA 4A6NA 2GRTA 2GMHA 1E1KA 3NKSA 4P9SA 3P4RA 2IVDA 2YG4A 4YXDA 3C4AA 3SZFA 2NPXA 2GVCA 1O5WA 2CVJA 1D7YA 3AE3A 2W0HA 1PS9A 2GEWA 5FMHA 3IHGA 3D8XA 3BHFA 4OPDA 3P9UA 1H86A 1CC6A 3ICRA 3W4IA 3UOXA 3B3RA 2R4JA 3K7QX 4LA1A 1YQ3A 1CF3A 1VG0A 1PHHA 2GAGB 3OZ2A 2B76A 1Q1RA 2WETA 3REDA 4USQA 4KPRA 3VQRA 2GR1A 3SGLA 2GH5A 3DK9A 2XLTA 3ZNQA 4CY8A 4GAPA 2C3CA 3UOZA 4H2NA 1CBOA 5GRTA 1MXTA 3DJDA 1LQTA 2FJEA 4CY6A 4GAVA 3SZ0A 1XANA 1S3BA 1RSGA 4G6HA 1YY5A 3OC4A 3CUKA 1F8WA 4NWZA 1ZX9A 5M0ZA 3T2ZA 3UKLA 4C3YA 3AECA 1PBFA 4II3A 1M64A 4J31A 4K5RA 1XHCA 3QFAA 1C0KA 3NH3X 3W4JA 2FJDA 1ONFA 4H50A 2QCUA 2OLOA 2R0CA 3ZNPA 2YWLA 4JNQA 1S3EA 4CCQA 2XFQA 2ZZ0A 2BXRA 2BK5A 1AN9A 3PS9A 2DKHA 1DJNA 4LU6A 1TDNA 3ALLA 1P2HA 3H8IA 2BACA 4TM3A 4U2SA 2JK6A 1BGJA 1LJ1A 1KSSA 1N4WA 4NNJA 2BK3A 4YJFA 2XLUA 2YLRA 3K30A 1BF3A 4NZHA 3P4SA 5U25A 2ZBWA 2JB3A 5C3JA 1OJDA 1C0IA 1F8RA 4QFDA 1K0JA 1ZP0A 1QLBA 2V5ZA 3NYFA 1L9EA 4X9MA 1LVLA 3DGZA 4B69A 2YG5A 3DJEA 1DAOA 4IA6A 5EB4A 1NPXA 4J34A 1CJ4A 3M13A 4EM3A 2XVEA 4XWZA 2WOIA 1VQWA 3HYWA 3AYLA 1D5TA 4GDPA 4H4SA 4CRTA 1Q9IA 4D04A 1IUVA 4C3XA 2YG6A 3UKAA 1K0IA 2XCGA 4B1BA 2C70A 3P1WA 2XDOA 1TDFA 3EANA 3KU9A 3LZWA 3UKFA 4B64A 4U8LA 2Y6QA 3KLJA 1FOHA 1KFYA 5KMSA 2YLTA 4AT2A 5M10A 4C77A 4H2QA 1JNRA 5ER0A 4A99A 4H4TA 2Y6RA 3G5QA 3BI4A 5EB5A 1IJHA 2C66A 2YG7A 2YR5A 4IV9A 3BNUA 1PXCA 1XDIA 5HHFA 3NN6X 2JAEA 1DOEA 2E82A 1BWCA 2B9WA 4FX9A 2PHHA 1CHUA 3IHMA 2XVFA 4TLXA 2XVIA 3QSMA 3FPZA 3CNTA 2V3AA 4G9KA 4UDRA 5BUKA 1YQZA 3BNMA 2ACZA 3QFBA 4RSLA 1S2YA 3RHAA 2TPRA 2GAHB 1BGNA 1E1NA 4G6GA 2BCGG 2R45A 4BK3A 3SY4A 2IVEA 4IVMB 2VRLA 3DA1A 2Q7VA 3DK8A 4GRTA 2EQ6A 4A6NB 4A7AA 3BI5A 1JRXA 3NT6A 5CKUA 1BZLA 4APNA 3H4KA 2YLZA 2GV8A 3I3LA 4HA6A 2BRAA 4WCTA 3NRNA 5FS8A 5KWFA 1EBDA 1LTXR 4YJFB 2RABA 1EL8A 3QSSA 5L46A 1NEKA 2I0ZA 2R9ZA 4Z26A 4E0VA 5IQ1A 2XLRA 1KDGA 3AE9A 5FS6A 1K4QA 2C72A 4BV6A 1EL9A 2Z5YA 3T0KA 4BK1A 3GDNA 3SYIA 3PO7A 4A79A 3GYXA 4TLZA 4ADWA 3NHOX 4JDRA 2ARDA 2OA1A 3NLCA 3E1TA 2YLXA 4AT0A 3AE2A 2R0GA 3B6DA 2WU5A 2RGOA 2V61A 4AOXA 5KOWA 1HYUA 2J3NA 2JKCA 4GUVA 4Y4LA 3GMCA 4BJZA 1FL2A 5U63A 4EMIA 3AEEA 2Q0LA 1MOKA 4YWOA 3QSEA 4AP3A 1H83A 1LQUA 2BS2A 4O5QA 2WPFA 3CGBA 3DH9A 1YKJA 1D4CA 1KF6A 4BJYA 2VVLG 4Z2RA 4H2RA 3CPJG 3GWFA 2GB0A 1E6EA 4YKGA 1IUUA 4PABA 4RG3A 4IVOB 3DMEA 4H4YA 1GOSA 3NK2X 3GDPA 1CC2A 3ATQA 2WPEA 1CC4A 2XFUA 4U8KA 2XYOA 5HYMA 3UP5A 4U8MA 3HYVA 4JY3A 1DNCA 3ZNOA 1GRFA 4ZCDA 2YVFA 1O94A 4CBQA 3QVRA 3ZDNA 2XFPA 4K2XA 3WE0A 2VVMA 2WP6A 3EAOA 1Y0PA 1RYIA 3LB8A 5IQ4A 2A87A 3LXDA 1L0VA 1PN0A 1UKVG 1NHSA 2APGA 2X50A 5IPYA 3QVPA 2O9ZA 3KPKA 4G74A 4O5UA 2C73A 1GRGA 3F8PA 3FMWA 4U8IA 2C76A 5TR3A 1CJ2A 1Y56B 5JCKA 1ZMDA 2CULA 2WESA 3ISHA 3UTHA 1VRQB 3AB1A 1MO9A 2TMDA 1GV4A 4UDPA 1ZOYA 1E7PA 4K22A 2A89A 3LJPA 1IUTA 1ZOVA 4ICYA 3AWIA 3UTFA 5BULA 1TDEA 3DJJA 3VRDB 3NK0X 2CFYA 4EQSA 3WGTA 1H7XA 3CPHG 1ELIA 3M12A 2BS4A 3AE5A 4UDQA 3ZYXA 1H82A 3Q9TA 5LV9A 1PJ5A 3UCLA 3V76A 1OJAA 3FG2P 4J2WA 4OCGA 2WHDA 1AOGA 3AD9B 2X99A 4B66A 1DJQA 1ZMCA 2JB1A 4I59A 4NEWA 2FJBA 1GT8A 1N4UA 3NTDA 4M52A 4NTEA 4ZCCA 3S61A 1JU2A 3H8LA 3AE1A 3AD7B 1GTHA 3K7TA 2V3BA 4YJGA 4YSYA 3VRAA 3FBSA 2WOVA 3GD3A 3GRSA 2WU2A 3AE6A 3IWAA 1GRHA 2E4GA 1GREA 3NN0X 5KVIA 3T37A 3AXBA 4YJDA 2YM2A 4XXGA 3SQPA 2VVLA 4YTPA 2FJAA 2VQ7A 2WEUA 2DKIA 3AD8B 2E4AA 4TM0A 3ALMA 4Z44A 4Y4MA 2WBAA 4H4UA 4OPCA 2EQ8A 1PBDA 3V3OA 4DGKA 3UP4A 3P4PA 1QO8A 5DBJA 3ITJA 3NGCX 4JNAA 2YLSA 3O0HA 4CNKA 2IIDA 5JCMA 1IUXA 1Y56A 3NG7X 5EOWA 4OPTA 4USRA 2BC0A 3SM8A 4UP3A 3D1CA 2C7GA 2QA2A 4K8DA 4NTCA 5BRTA 1JRYA 3V3NA 3C96A 4YSZA 4B63A 3RP8A 1DOCA 2RGJA 1TDOA 2GR0A 2X8GA 1VG9A 1CL0A 4H4XA 4MJWA 3SZWA 3AEDA 1B5QA 2DU8A 1VDCA 4JQ9A 5KXJA 2GR3A 1PBBA 4U2LA 2B7SA 4D03A 4J57A 2YVJA 3NK1X 2YG3A 4CCRA 1C0LA 1CJ3A 4U8OA 3M0OA 1B8SA 1KNPA 3UOVA 1K0LA 1KNRA 3GMBA 1NHQA 3BI2A 3DK4A 2GF3A 3GWDA 4FDCB 1V59A 3QJ4A 4GR1A 2QA1A 2WP5A 2XLSA 2WDQA 2HQMA 2XVJA 5FS7A 4J56A 1OJCA 5KNLA 1GXFA 1FEBA 1H84A 2X8CA 2GQFA 3DGHA 1W4XA 1Z6LA 3CNJA 3AEBA 1L9DA 2YAUA 5EBKA 1NHPA 3AEFA 1GRTA 3CN8A 4X4JA 4FK1A 2JBVA 3CNPA 4H2PA 1KSUA 3SFDA 5KMPA 1IUSA 4REKA 2BRYA 4U8JA 5KOXA 1Q1WA 4HB9A 2OAMA 4QFCA 1NAAA 4AOSA 3GYJA 3ADAB 3EPTA 2BYBA 1E1MA 1L9CA 3NYCA 2E1MA 4OPUA 5JCNA 3NYEA 1JOAA 1ZDLA 2C67A 2VZ2A 1GSNA 1B37A 1COYA 1E1LA 4YJHA 1FECA 5J7XA 2ZZBA 4EQWA 3VR9A 2BCPA 3ALJA 4A65A 4LIIA 1PJ6A 3GD4A 4XWRA 3L8KA 4A9WA 2YLWA 2B7RA 4G73A 4JN9A 2EQ9A 2WP9A 4U8PA 2V6OA 5BVAA 3CNSA 4YTNA 2YQUA 3LZXA 5JCLA 4B67A 2WDVA 1F3PA 3CGCA 3SX6A 2YVGA 3BHKA 1GEUA 1EL5A 1ZY8A 2Q0KA 3GSIA 1PXAA 1N4VA 2RGHA 3G5SA 3UTEA 3G5RA 4DNAA 2YR4A 3Q6JA 2OLNA 2X3NA 4GCMA 4I58A 2PYXA 1PBCA 2YR6A 4U2TA 3HZLA 4J36A 1DDOA 1NENA 1F6MA 1B4VA 3SFEA 2GMJA 1H7WA 2BC1A 3CTYA 2E5VA 4EIPA 3KD9A 4OPGA 3SZCA 1F8SA 2WOWA 3CGDA 3DJGX 4H4QA 4K5SA 2C64A 2Z5XA 3F8RA 4H7UA 1EL7A 2H88A 4II2A 4Z24A 4EQRA 2C65A 3ATRA 1IUWA 1LV0A 2C75A 1YQ4A 2VQBA 3T2KA 3NTAA 4RG4A 2WDRA 2QAEA 2CDUA 2H89A 3K7MX 3L1RA 4FK1C 4EM4A 5HXIA 3CGEA 3AEAA 3G3EA 4YTMA 4DSHA 3CIRA 4H4PA 4TM1A 5HY5A 3IC9A 4J33A 1KIFA 1H6VA 4N9XA 1GALA 1SEZA 1GPEA 1PJ7A 5J60A 1LPFA 1OJ9A 3SXIA 2E49A 3CPIG 3HYXA 1DOBA 2XLPA 4NTDA 2VOUA 5KRQA 1FEAA 1ZK7A 2WS3A 3VR8A 4A5LA 3AYIA 2GR2A 1NG4A 4K7ZA 2UZZA 1GRAA 3KPFA 2JB2A 1N1PA 1C0PA 4BURA 1GNDA 1JRZA 1M6IA 3UKKA 5KMRA 3UOYA 4YT0A 2V60A 3KVEA 1NDAA 3F8DA 5FS9A 1PDHA 4H4RA 4OVIA 1VE9A 1D4DA 1ZKQA 2XVHA 3URHA 2R46A 2XFOA 4JY2A 4OPIA 4YJGB 4TM4A 1EVIA 4ECHA
chains in the Genus database with same CATH topology
1REOA 2A8XA 3JSKA 3ZNNA 1BKWA 4H4WA 2C4CA 2E48A 2BS3A 3KA7A 1TYTA 5CQFA 4U8NA 2NVKX 2BABA 3GYIA 3AEGA 3KKJA 5GSNA 3RNMA 3T2YA 1PBEA 2OALA 4C5OA 4OPLA 1GESA 4AP1A 3PVCA 5C2TA 1S2QA 1GERA 1FCDA 4BK2A 1XPQA 4GDEA 4KX6A 4EMWA 4Z25A 1PXBA 3II4A 4DSGA 2AR8A 1D7LA 4YKFA 1CJCA 4Z2UA 4CNJA 2VRMA 3ICTA 5KVHA 4YJHB 2B9XA 2FBWA 4EMJA 3CMMA 2GQWA 4C74A 2B9YA 1X31B 3AE4A 2R4EA 4Y4NA 3R9UA 3UKHA 1DODA 3I6DA 3W4KA 3FIMB 1DXLA 3COXA 2C3DA 3ICSA 3GRTA 1GETA 3CNDA 1P2EA 3EF6A 1NHRA 5JCIA 2X8HA 1D4EA 2AAQA 4X9NA 1RP0A 1TRBA 1TYPA 3AE7A 5KMQA 2R0PA 3LOVA 3UKPA 1H81A 2Q6UA 4Z2TA 4EIQA 1QJDA 1E39A 2EQ7A 1JNZA 3T14A 1NG3A 2WPCA 2YM1A 2BXSA 4WX1A 3AE8A 3NIXA 3P4QA 3S5WA 4B68A 3AYJA 4ZN0A 2AQJA 3T31A 3RP7A 3VRBA 3LADA 2XFNA 3IF9A 1TDKA 2ZZCA 4H4VA 1GRBA 3UTGA 3C4NA 2BK4A 5U1OA 2BA9A 3NNEA 4YSHA 3RP6A 1JEHA 4B65A 4GF7A 1OJTA 1O95A 4H4ZA 4IA5A 3UKQA 4EQXA 4YSXA 4Z43A 1GTEA 3ABVA 4PAAA 2F5ZA 4NEVA 2WQYA 4A6NA 2GRTA 2GMHA 1E1KA 3NKSA 4P9SA 3P4RA 2IVDA 2YG4A 4YXDA 3C4AA 3SZFA 2NPXA 2GVCA 1O5WA 2CVJA 1D7YA 3AE3A 2W0HA 1PS9A 2GEWA 5FMHA 3IHGA 3D8XA 3BHFA 4OPDA 3P9UA 1H86A 1CC6A 3ICRA 3W4IA 3UOXA 3B3RA 2R4JA 3K7QX 4LA1A 1YQ3A 1CF3A 1VG0A 1PHHA 2GAGB 3OZ2A 2B76A 1Q1RA 2WETA 3REDA 4USQA 4KPRA 3VQRA 2GR1A 3SGLA 2GH5A 3DK9A 2XLTA 3ZNQA 4CY8A 4GAPA 2C3CA 3UOZA 4H2NA 1CBOA 5GRTA 1MXTA 3DJDA 1LQTA 2FJEA 4CY6A 4GAVA 3SZ0A 1XANA 1S3BA 1RSGA 4G6HA 1YY5A 3OC4A 3CUKA 1F8WA 4NWZA 1ZX9A 5M0ZA 3T2ZA 3UKLA 4C3YA 3AECA 1PBFA 4II3A 1M64A 4J31A 4K5RA 1XHCA 3QFAA 1C0KA 3NH3X 3W4JA 2FJDA 1ONFA 4H50A 2QCUA 2OLOA 3ZNPA 2R0CA 2YWLA 4JNQA 1S3EA 4CCQA 2XFQA 2ZZ0A 2BXRA 2BK5A 1AN9A 3PS9A 2DKHA 1DJNA 4LU6A 1TDNA 1P2HA 3ALLA 3H8IA 2BACA 4TM3A 4U2SA 2JK6A 1BGJA 1LJ1A 1KSSA 1N4WA 4NNJA 2BK3A 4YJFA 2XLUA 2YLRA 3K30A 1BF3A 4NZHA 3P4SA 5U25A 2ZBWA 2JB3A 5C3JA 1OJDA 1C0IA 1F8RA 4QFDA 1K0JA 1ZP0A 1QLBA 2V5ZA 3NYFA 1L9EA 4X9MA 1LVLA 3DGZA 4B69A 2YG5A 3DJEA 1DAOA 4IA6A 5EB4A 1NPXA 4J34A 1CJ4A 3M13A 4EM3A 2XVEA 4XWZA 2WOIA 1VQWA 3HYWA 3AYLA 1D5TA 4GDPA 4H4SA 4CRTA 1Q9IA 4D04A 1IUVA 4C3XA 2YG6A 3UKAA 1K0IA 2XCGA 4B1BA 2C70A 3P1WA 2XDOA 1TDFA 3EANA 3KU9A 3LZWA 3UKFA 4B64A 4U8LA 2Y6QA 3KLJA 1FOHA 1KFYA 5KMSA 2YLTA 4AT2A 5M10A 4C77A 4H2QA 1JNRA 5ER0A 4A99A 4H4TA 2Y6RA 3G5QA 3BI4A 5EB5A 1IJHA 2C66A 2YG7A 2YR5A 4IV9A 3BNUA 1PXCA 1XDIA 5HHFA 3NN6X 2JAEA 1DOEA 2E82A 1BWCA 2B9WA 4FX9A 2PHHA 1CHUA 3IHMA 2XVFA 4TLXA 2XVIA 3QSMA 3FPZA 3CNTA 2V3AA 4G9KA 4UDRA 5BUKA 1YQZA 3BNMA 2ACZA 3QFBA 4RSLA 1S2YA 3RHAA 2TPRA 2GAHB 1BGNA 1E1NA 4G6GA 2BCGG 2R45A 4BK3A 3SY4A 2IVEA 4IVMB 2VRLA 3DA1A 2Q7VA 3DK8A 4GRTA 2EQ6A 4A6NB 4A7AA 3BI5A 1JRXA 3NT6A 5CKUA 1BZLA 4APNA 3H4KA 2YLZA 2GV8A 3I3LA 4HA6A 2BRAA 4WCTA 3NRNA 5FS8A 5KWFA 1EBDA 1LTXR 4YJFB 2RABA 1EL8A 3QSSA 5L46A 1NEKA 2I0ZA 2R9ZA 4Z26A 4E0VA 5IQ1A 2XLRA 1KDGA 3AE9A 5FS6A 1K4QA 2C72A 4BV6A 1EL9A 2Z5YA 3T0KA 4BK1A 3GDNA 3SYIA 3PO7A 4A79A 3GYXA 4TLZA 4ADWA 3NHOX 4JDRA 2ARDA 2OA1A 3NLCA 2YLXA 3E1TA 4AT0A 3AE2A 2R0GA 3B6DA 2WU5A 2RGOA 2V61A 4AOXA 5KOWA 1HYUA 2J3NA 2JKCA 4GUVA 4Y4LA 3GMCA 1FL2A 5U63A 4BJZA 4EMIA 3AEEA 2Q0LA 1MOKA 4YWOA 3QSEA 4AP3A 1H83A 1LQUA 2BS2A 4O5QA 2WPFA 3CGBA 3DH9A 1YKJA 1D4CA 1KF6A 2VVLG 4BJYA 4Z2RA 4H2RA 3CPJG 3GWFA 2GB0A 1E6EA 4YKGA 1IUUA 4PABA 4RG3A 4IVOB 3DMEA 4H4YA 1GOSA 3NK2X 3GDPA 1CC2A 3ATQA 2WPEA 1CC4A 2XFUA 4U8KA 2XYOA 5HYMA 3UP5A 4U8MA 3HYVA 4JY3A 1DNCA 3ZNOA 1GRFA 4ZCDA 2YVFA 1O94A 4CBQA 3QVRA 3ZDNA 2XFPA 4K2XA 3WE0A 2VVMA 2WP6A 3EAOA 1Y0PA 1RYIA 3LB8A 5IQ4A 2A87A 3LXDA 1L0VA 1PN0A 1UKVG 1NHSA 2APGA 2X50A 5IPYA 3QVPA 2O9ZA 3KPKA 4G74A 4O5UA 2C73A 1GRGA 3F8PA 3FMWA 4U8IA 2C76A 5TR3A 1CJ2A 1Y56B 5JCKA 1ZMDA 2CULA 2WESA 3ISHA 3UTHA 1VRQB 3AB1A 1MO9A 2TMDA 1GV4A 4UDPA 1ZOYA 1E7PA 3LJPA 2A89A 4K22A 1IUTA 1ZOVA 4ICYA 3AWIA 3UTFA 5BULA 1TDEA 3DJJA 3VRDB 3NK0X 2CFYA 4EQSA 3WGTA 1H7XA 3CPHG 1ELIA 3M12A 2BS4A 3AE5A 4UDQA 3ZYXA 1H82A 3Q9TA 5LV9A 1PJ5A 3UCLA 3V76A 1OJAA 3FG2P 4J2WA 4OCGA 2WHDA 1AOGA 3AD9B 2X99A 4B66A 1DJQA 1ZMCA 2JB1A 4I59A 4NEWA 2FJBA 1GT8A 1N4UA 3NTDA 4M52A 4NTEA 4ZCCA 3S61A 1JU2A 3H8LA 3AE1A 3AD7B 1GTHA 3K7TA 2V3BA 4YJGA 4YSYA 3VRAA 3FBSA 2WOVA 3GD3A 3GRSA 2WU2A 3AE6A 3IWAA 1GRHA 2E4GA 1GREA 3NN0X 5KVIA 3T37A 3AXBA 4YJDA 2YM2A 4XXGA 3SQPA 2VVLA 4YTPA 2FJAA 2VQ7A 2WEUA 2DKIA 3AD8B 2E4AA 4TM0A 3ALMA 4Z44A 4Y4MA 2WBAA 4H4UA 4OPCA 2EQ8A 1PBDA 3V3OA 4DGKA 3UP4A 3P4PA 1QO8A 5DBJA 3ITJA 3NGCX 4JNAA 2YLSA 3O0HA 4CNKA 2IIDA 5JCMA 1IUXA 1Y56A 3NG7X 5EOWA 4OPTA 4USRA 2BC0A 3SM8A 4UP3A 3D1CA 2C7GA 2QA2A 4K8DA 4NTCA 5BRTA 1JRYA 3V3NA 3C96A 4YSZA 4B63A 3RP8A 1DOCA 1TDOA 2GR0A 2RGJA 2X8GA 1VG9A 1CL0A 4H4XA 4MJWA 3SZWA 3AEDA 1B5QA 2DU8A 1VDCA 4JQ9A 5KXJA 2GR3A 1PBBA 4U2LA 2B7SA 4D03A 4J57A 2YVJA 3NK1X 2YG3A 4CCRA 1C0LA 1CJ3A 4U8OA 3M0OA 1B8SA 1KNPA 3UOVA 1K0LA 1KNRA 3DK4A 1NHQA 3BI2A 3GMBA 2GF3A 3GWDA 4FDCB 1V59A 3QJ4A 4GR1A 2QA1A 2WP5A 2XLSA 2WDQA 2HQMA 2XVJA 5FS7A 4J56A 1OJCA 5KNLA 1GXFA 1FEBA 1H84A 2X8CA 2GQFA 3DGHA 1W4XA 1Z6LA 3CNJA 3AEBA 1L9DA 2YAUA 5EBKA 1NHPA 3AEFA 1GRTA 3CN8A 4X4JA 4FK1A 2JBVA 3CNPA 1KSUA 4H2PA 3SFDA 5KMPA 1IUSA 4REKA 2BRYA 4U8JA 5KOXA 1Q1WA 4HB9A 2OAMA 4QFCA 1NAAA 4AOSA 3GYJA 3ADAB 3EPTA 2BYBA 1E1MA 1L9CA 3NYCA 2E1MA 4OPUA 5JCNA 3NYEA 1JOAA 1ZDLA 2C67A 2VZ2A 1GSNA 1B37A 1COYA 1E1LA 4YJHA 1FECA 5J7XA 2ZZBA 4EQWA 3VR9A 2BCPA 3ALJA 4A65A 4LIIA 1PJ6A 3GD4A 4XWRA 3L8KA 4A9WA 2YLWA 2B7RA 4G73A 4JN9A 2EQ9A 2WP9A 4U8PA 2V6OA 5BVAA 3CNSA 4YTNA 2YQUA 3LZXA 5JCLA 4B67A 2WDVA 1F3PA 3CGCA 3SX6A 2YVGA 3BHKA 1GEUA 1EL5A 1ZY8A 2Q0KA 3GSIA 1PXAA 1N4VA 2RGHA 3G5SA 3UTEA 3G5RA 4DNAA 2YR4A 3Q6JA 2OLNA 2X3NA 4GCMA 4I58A 2PYXA 1PBCA 2YR6A 4U2TA 3HZLA 4J36A 1DDOA 1NENA 1F6MA 1B4VA 3SFEA 2GMJA 1H7WA 2BC1A 3CTYA 2E5VA 3KD9A 3SZCA 4OPGA 4EIPA 1F8SA 2WOWA 3CGDA 3DJGX 4H4QA 4K5SA 2C64A 2Z5XA 3F8RA 4H7UA 1EL7A 2H88A 4II2A 4Z24A 4EQRA 2C65A 3ATRA 1IUWA 1LV0A 2C75A 1YQ4A 2VQBA 3T2KA 3NTAA 4RG4A 2WDRA 2QAEA 2CDUA 2H89A 3K7MX 3L1RA 4FK1C 4EM4A 5HXIA 3CGEA 3AEAA 3G3EA 4YTMA 4DSHA 3CIRA 4H4PA 4TM1A 5HY5A 3IC9A 4J33A 1KIFA 1H6VA 4N9XA 1GALA 1SEZA 1GPEA 1PJ7A 5J60A 1LPFA 1OJ9A 3SXIA 2E49A 3CPIG 3HYXA 1DOBA 2XLPA 4NTDA 2VOUA 5KRQA 1FEAA 1ZK7A 2WS3A 3VR8A 4A5LA 3AYIA 2GR2A 1NG4A 4K7ZA 2UZZA 1GRAA 3KPFA 2JB2A 1N1PA 1C0PA 4BURA 1GNDA 1JRZA 1M6IA 3UKKA 5KMRA 3UOYA 4YT0A 2V60A 3KVEA 1NDAA 3F8DA 5FS9A 1PDHA 4H4RA 4OVIA 1VE9A 1D4DA 1ZKQA 2XVHA 3URHA 2R46A 2XFOA 4JY2A 4OPIA 4YJGB 4TM4A 1EVIA 4ECHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1REO A;  2A8X A;  3JSK A;  3ZNN A;  1BKW A;  4H4W A;  2E48 A;  2BS3 A;  3KA7 A;  1TYT A;  5CQF A;  4U8N A;  2NVK X;  2BAB A;  3GYI A;  3AEG A;  3KKJ A;  5GSN A;  3RNM A;  1PBE A;  2OAL A;  4C5O A;  4OPL A;  1GES A;  4AP1 A;  3PVC A;  5C2T A;  1S2Q A;  1GER A;  1FCD A;  4BK2 A;  1XPQ A;  4GDE A;  4KX6 A;  4EMW A;  4Z25 A;  1PXB A;  3II4 A;  4DSG A;  2AR8 A;  1D7L A;  4YKF A;  1CJC A;  4Z2U A;  4CNJ A;  2VRM A;  3ICT A;  5KVH A;  4YJH B;  2B9X A;  2FBW A;  4EMJ A;  2GQW A;  4C74 A;  2B9Y A;  1X31 B;  3AE4 A;  2R4E A;  4Y4N A;  3R9U A;  3UKH A;  1DOD A;  3I6D A;  3W4K A;  3FIM B;  1DXL A;  3COX A;  2C3D A;  3ICS A;  3GRT A;  1GET A;  3CND A;  1P2E A;  3EF6 A;  1NHR A;  5JCI A;  2X8H A;  1D4E A;  2AAQ A;  4X9N A;  1RP0 A;  1TRB A;  1TYP A;  3AE7 A;  2R0P A;  3LOV A;  3UKP A;  1H81 A;  2Q6U A;  4Z2T A;  4EIQ A;  1QJD A;  1E39 A;  2EQ7 A;  1JNZ A;  1NG3 A;  2WPC A;  2YM1 A;  2BXS A;  4WX1 A;  3AE8 A;  3NIX A;  3P4Q A;  3S5W A;  4B68 A;  3AYJ A;  4ZN0 A;  2AQJ A;  3RP7 A;  3VRB A;  3LAD A;  2XFN A;  3IF9 A;  1TDK A;  2ZZC A;  4H4V A;  1GRB A;  3UTG A;  3C4N A;  2BK4 A;  5U1O A;  2BA9 A;  3NNE A;  4YSH A;  3RP6 A;  1JEH A;  4B65 A;  4GF7 A;  1OJT A;  1O95 A;  4H4Z A;  4IA5 A;  3UKQ A;  4EQX A;  4YSX A;  4Z43 A;  1GTE A;  3ABV A;  4PAA A;  2F5Z A;  4NEV A;  2WQY A;  4A6N A;  2GRT A;  2GMH A;  1E1K A;  3NKS A;  4P9S A;  3P4R A;  2IVD A;  2YG4 A;  4YXD A;  3C4A A;  2NPX A;  2GVC A;  1O5W A;  2CVJ A;  1D7Y A;  3AE3 A;  2W0H A;  1PS9 A;  2GEW A;  5FMH A;  3IHG A;  3D8X A;  3BHF A;  4OPD A;  3P9U A;  1H86 A;  1CC6 A;  3ICR A;  3W4I A;  3UOX A;  3B3R A;  2R4J A;  3K7Q X;  4LA1 A;  1YQ3 A;  1CF3 A;  1VG0 A;  1PHH A;  2GAG B;  3OZ2 A;  2B76 A;  1Q1R A;  2WET A;  3RED A;  4USQ A;  4KPR A;  3VQR A;  2GR1 A;  3SGL A;  2GH5 A;  3DK9 A;  2XLT A;  3ZNQ A;  4CY8 A;  2C3C A;  3UOZ A;  4H2N A;  1CBO A;  5GRT A;  1MXT A;  3DJD A;  1LQT A;  2FJE A;  4CY6 A;  1XAN A;  1S3B A;  1RSG A;  1YY5 A;  3OC4 A;  3CUK A;  1F8W A;  5M0Z A;  1ZX9 A;  3UKL A;  4C3Y A;  3AEC A;  1PBF A;  1M64 A;  4J31 A;  4K5R A;  1XHC A;  3QFA A;  1C0K A;  3NH3 X;  3W4J A;  2FJD A;  1ONF A;  4H50 A;  2QCU A;  2OLO A;  3ZNP A;  2R0C A;  2YWL A;  4JNQ A;  1S3E A;  4CCQ A;  2XFQ A;  2ZZ0 A;  2BXR A;  2BK5 A;  1AN9 A;  3PS9 A;  2DKH A;  1DJN A;  4LU6 A;  1TDN A;  1P2H A;  3ALL A;  3H8I A;  2BAC A;  4TM3 A;  4U2S A;  2JK6 A;  1BGJ A;  1LJ1 A;  1KSS A;  1N4W A;  2BK3 A;  4YJF A;  2XLU A;  2YLR A;  3K30 A;  1BF3 A;  4NZH A;  3P4S A;  5U25 A;  2ZBW A;  2JB3 A;  5C3J A;  1OJD A;  1C0I A;  1F8R A;  4QFD A;  1K0J A;  1ZP0 A;  1QLB A;  2V5Z A;  3NYF A;  1L9E A;  4X9M A;  1LVL A;  3DGZ A;  4B69 A;  2YG5 A;  3DJE A;  1DAO A;  4IA6 A;  5EB4 A;  1NPX A;  4J34 A;  1CJ4 A;  3M13 A;  4EM3 A;  2XVE A;  4XWZ A;  2WOI A;  1VQW A;  4GDP A;  3AYL A;  1D5T A;  4H4S A;  4CRT A;  4D04 A;  1Q9I A;  1IUV A;  4C3X A;  2YG6 A;  3UKA A;  1K0I A;  2XCG A;  4B1B A;  2C70 A;  3P1W A;  2XDO A;  1TDF A;  3EAN A;  3KU9 A;  3LZW A;  3UKF A;  4B64 A;  4U8L A;  2Y6Q A;  3KLJ A;  1FOH A;  1KFY A;  2YLT A;  4AT2 A;  5M10 A;  4C77 A;  4H2Q A;  1JNR A;  5ER0 A;  4A99 A;  4H4T A;  2Y6R A;  3G5Q A;  3BI4 A;  5EB5 A;  1IJH A;  2C66 A;  2YG7 A;  2YR5 A;  4IV9 A;  3BNU A;  1PXC A;  1XDI A;  5HHF A;  3NN6 X;  2JAE A;  1DOE A;  2E82 A;  1BWC A;  2B9W A;  4FX9 A;  2PHH A;  1CHU A;  3IHM A;  2XVF A;  4TLX A;  2XVI A;  3QSM A;  3FPZ A;  3CNT A;  2V3A A;  4UDR A;  5BUK A;  1YQZ A;  3BNM A;  2ACZ A;  3QFB A;  4RSL A;  1S2Y A;  3RHA A;  2TPR A;  2GAH B;  1BGN A;  1E1N A;  2BCG G;  2R45 A;  4BK3 A;  2IVE A;  4IVM B;  2VRL A;  3DA1 A;  2Q7V A;  3DK8 A;  4GRT A;  2EQ6 A;  4A6N B;  4A7A A;  3BI5 A;  1JRX A;  3NT6 A;  5CKU A;  1BZL A;  4APN A;  3H4K A;  2YLZ A;  2GV8 A;  3I3L A;  4HA6 A;  5KWF A;  4WCT A;  3NRN A;  5FS8 A;  1EBD A;  1LTX R;  4YJF B;  2RAB A;  1EL8 A;  3QSS A;  5L46 A;  1NEK A;  2I0Z A;  2R9Z A;  4Z26 A;  4E0V A;  5IQ1 A;  2XLR A;  1KDG A;  3AE9 A;  5FS6 A;  1K4Q A;  2C72 A;  4BV6 A;  1EL9 A;  2Z5Y A;  4BK1 A;  3GDN A;  3PO7 A;  4A79 A;  4TLZ A;  4ADW A;  3NHO X;  4JDR A;  2ARD A;  2OA1 A;  3NLC A;  2YLX A;  3E1T A;  4AT0 A;  3AE2 A;  2R0G A;  3B6D A;  2WU5 A;  2RGO A;  2V61 A;  4AOX A;  5KOW A;  1HYU A;  2J3N A;  2JKC A;  4GUV A;  4Y4L A;  3GMC A;  1FL2 A;  5U63 A;  4BJZ A;  4EMI A;  3AEE A;  2Q0L A;  1MOK A;  4YWO A;  3QSE A;  4AP3 A;  1H83 A;  1LQU A;  2BS2 A;  4O5Q A;  2WPF A;  3CGB A;  3DH9 A;  1YKJ A;  1D4C A;  1KF6 A;  2VVL G;  4BJY A;  4Z2R A;  4H2R A;  3CPJ G;  3GWF A;  2GB0 A;  1E6E A;  4YKG A;  1IUU A;  4PAB A;  4RG3 A;  4IVO B;  3DME A;  4H4Y A;  1GOS A;  3NK2 X;  3GDP A;  1CC2 A;  3ATQ A;  2WPE A;  1CC4 A;  2XFU A;  4U8K A;  2XYO A;  5HYM A;  3UP5 A;  4U8M A;  4JY3 A;  1DNC A;  3ZNO A;  1GRF A;  4ZCD A;  2YVF A;  1O94 A;  4CBQ A;  3QVR A;  3ZDN A;  2XFP A;  4K2X A;  3WE0 A;  2VVM A;  2WP6 A;  3EAO A;  1Y0P A;  1RYI A;  3LB8 A;  5IQ4 A;  2A87 A;  3LXD A;  1L0V A;  1PN0 A;  1UKV G;  1NHS A;  2APG A;  2X50 A;  5IPY A;  3QVP A;  2O9Z A;  4O5U A;  2C73 A;  1GRG A;  3F8P A;  3FMW A;  4U8I A;  2C76 A;  5TR3 A;  1CJ2 A;  1Y56 B;  5JCK A;  1ZMD A;  2CUL A;  2WES A;  3ISH A;  3UTH A;  1VRQ B;  3AB1 A;  1MO9 A;  2TMD A;  1GV4 A;  4UDP A;  1ZOY A;  1E7P A;  3LJP A;  2A89 A;  4K22 A;  1IUT A;  1ZOV A;  4ICY A;  3AWI A;  3UTF A;  5BUL A;  1TDE A;  3DJJ A;  3VRD B;  3NK0 X;  2CFY A;  4EQS A;  3WGT A;  1H7X A;  3CPH G;  1ELI A;  3M12 A;  2BS4 A;  3AE5 A;  4UDQ A;  3ZYX A;  1H82 A;  3Q9T A;  5LV9 A;  1PJ5 A;  3UCL A;  3V76 A;  1OJA A;  3FG2 P;  4J2W A;  4OCG A;  2WHD A;  1AOG A;  3AD9 B;  2X99 A;  4B66 A;  1DJQ A;  1ZMC A;  2JB1 A;  4I59 A;  4NEW A;  2FJB A;  1GT8 A;  1N4U A;  3NTD A;  4M52 A;  4NTE A;  4ZCC A;  3S61 A;  1JU2 A;  3H8L A;  3AE1 A;  3AD7 B;  1GTH A;  3K7T A;  2V3B A;  4YJG A;  4YSY A;  3VRA A;  3FBS A;  2WOV A;  3GD3 A;  3GRS A;  2WU2 A;  3AE6 A;  3IWA A;  1GRH A;  2E4G A;  1GRE A;  3NN0 X;  5KVI A;  3T37 A;  3AXB A;  4YJD A;  2YM2 A;  4XXG A;  3SQP A;  2VVL A;  4YTP A;  2FJA A;  2VQ7 A;  2WEU A;  2DKI A;  3AD8 B;  2E4A A;  4TM0 A;  3ALM A;  4Z44 A;  4Y4M A;  2WBA A;  4H4U A;  4OPC A;  2EQ8 A;  1PBD A;  3V3O A;  4DGK A;  3UP4 A;  3P4P A;  1QO8 A;  5DBJ A;  3ITJ A;  3NGC X;  4JNA A;  2YLS A;  3O0H A;  4CNK A;  2IID A;  5JCM A;  1IUX A;  1Y56 A;  3NG7 X;  5EOW A;  4OPT A;  4USR A;  2BC0 A;  3SM8 A;  4UP3 A;  3D1C A;  2C7G A;  2QA2 A;  4K8D A;  4NTC A;  5BRT A;  1JRY A;  3V3N A;  3C96 A;  4YSZ A;  4B63 A;  3RP8 A;  1DOC A;  1TDO A;  2GR0 A;  2RGJ A;  2X8G A;  1VG9 A;  1CL0 A;  4H4X A;  4MJW A;  3AED A;  1B5Q A;  2DU8 A;  1VDC A;  4JQ9 A;  5KXJ A;  2GR3 A;  1PBB A;  4U2L A;  2B7S A;  4D03 A;  4J57 A;  2YVJ A;  3NK1 X;  2YG3 A;  4CCR A;  1C0L A;  1CJ3 A;  4U8O A;  3M0O A;  1B8S A;  1KNP A;  3UOV A;  1K0L A;  1KNR A;  3DK4 A;  1NHQ A;  3BI2 A;  3GMB A;  2GF3 A;  3GWD A;  4FDC B;  1V59 A;  3QJ4 A;  4GR1 A;  2QA1 A;  2WP5 A;  2XLS A;  2WDQ A;  2HQM A;  2XVJ A;  5FS7 A;  4J56 A;  1OJC A;  1GXF A;  1FEB A;  1H84 A;  2X8C A;  2GQF A;  3DGH A;  1W4X A;  1Z6L A;  3CNJ A;  3AEB A;  1L9D A;  2YAU A;  5EBK A;  1NHP A;  3AEF A;  1GRT A;  3CN8 A;  4X4J A;  4FK1 A;  2JBV A;  3CNP A;  1KSU A;  4H2P A;  3SFD A;  5KOX A;  1IUS A;  4REK A;  4U8J A;  1Q1W A;  4HB9 A;  2OAM A;  4QFC A;  1NAA A;  4AOS A;  3GYJ A;  3ADA B;  3EPT A;  2BYB A;  1E1M A;  1L9C A;  3NYC A;  2E1M A;  4OPU A;  5JCN A;  3NYE A;  1JOA A;  1ZDL A;  2C67 A;  2VZ2 A;  1GSN A;  1B37 A;  1COY A;  1E1L A;  4YJH A;  1FEC A;  5J7X A;  2ZZB A;  4EQW A;  3VR9 A;  2BCP A;  3ALJ A;  4A65 A;  4LII A;  1PJ6 A;  3GD4 A;  4XWR A;  3L8K A;  4A9W A;  2YLW A;  2B7R A;  4JN9 A;  2EQ9 A;  2WP9 A;  4U8P A;  2V6O A;  5BVA A;  3CNS A;  4YTN A;  2YQU A;  3LZX A;  5JCL A;  4B67 A;  2WDV A;  1F3P A;  3CGC A;  2YVG A;  3BHK A;  1GEU A;  1EL5 A;  1ZY8 A;  2Q0K A;  3GSI A;  1PXA A;  1N4V A;  2RGH A;  3G5S A;  3UTE A;  3G5R A;  4DNA A;  2YR4 A;  3Q6J A;  2OLN A;  2X3N A;  4GCM A;  4I58 A;  2PYX A;  1PBC A;  2YR6 A;  4U2T A;  3HZL A;  4J36 A;  1DDO A;  1NEN A;  1F6M A;  1B4V A;  3SFE A;  2GMJ A;  1H7W A;  2BC1 A;  3CTY A;  2E5V A;  3KD9 A;  4EIP A;  4OPG A;  1F8S A;  2WOW A;  3CGD A;  3DJG X;  4H4Q A;  4K5S A;  2C64 A;  2Z5X A;  3F8R A;  4H7U A;  1EL7 A;  2H88 A;  4Z24 A;  4EQR A;  2C65 A;  3ATR A;  1IUW A;  1LV0 A;  2C75 A;  1YQ4 A;  2VQB A;  3NTA A;  4RG4 A;  2WDR A;  2QAE A;  2CDU A;  2H89 A;  3K7M X;  3L1R A;  4FK1 C;  4EM4 A;  5HXI A;  3CGE A;  3AEA A;  3G3E A;  4YTM A;  4DSH A;  3CIR A;  4H4P A;  4TM1 A;  5HY5 A;  3IC9 A;  4J33 A;  1KIF A;  1H6V A;  4N9X A;  1GAL A;  1SEZ A;  1GPE A;  1PJ7 A;  5J60 A;  1LPF A;  1OJ9 A;  2E49 A;  3CPI G;  1DOB A;  2XLP A;  4NTD A;  2VOU A;  5KRQ A;  1FEA A;  1ZK7 A;  2WS3 A;  3VR8 A;  4A5L A;  3AYI A;  2GR2 A;  1NG4 A;  4K7Z A;  2UZZ A;  1GRA A;  3KPF A;  2JB2 A;  1N1P A;  1C0P A;  4BUR A;  1GND A;  1JRZ A;  1M6I A;  3UKK A;  3UOY A;  4YT0 A;  2V60 A;  3KVE A;  1NDA A;  3F8D A;  5FS9 A;  1PDH A;  4H4R A;  4OVI A;  1VE9 A;  1D4D A;  1ZKQ A;  2XVH A;  3URH A;  2R46 A;  2XFO A;  4JY2 A;  4OPI A;  4YJG B;  4TM4 A;  1EVI A;  4ECH A; 
#chains in the Genus database with same CATH topology
 1REO A;  2A8X A;  3JSK A;  3ZNN A;  1BKW A;  4H4W A;  2C4C A;  2E48 A;  2BS3 A;  3KA7 A;  1TYT A;  5CQF A;  4U8N A;  2NVK X;  2BAB A;  3GYI A;  3AEG A;  3KKJ A;  5GSN A;  3RNM A;  3T2Y A;  1PBE A;  2OAL A;  4C5O A;  4OPL A;  1GES A;  4AP1 A;  3PVC A;  5C2T A;  1S2Q A;  1GER A;  1FCD A;  4BK2 A;  1XPQ A;  4GDE A;  4KX6 A;  4EMW A;  4Z25 A;  1PXB A;  3II4 A;  4DSG A;  2AR8 A;  1D7L A;  4YKF A;  1CJC A;  4Z2U A;  4CNJ A;  2VRM A;  3ICT A;  5KVH A;  4YJH B;  2B9X A;  2FBW A;  4EMJ A;  3CMM A;  2GQW A;  4C74 A;  2B9Y A;  1X31 B;  3AE4 A;  2R4E A;  4Y4N A;  3R9U A;  3UKH A;  1DOD A;  3I6D A;  3W4K A;  3FIM B;  1DXL A;  3COX A;  2C3D A;  3ICS A;  3GRT A;  1GET A;  3CND A;  1P2E A;  3EF6 A;  1NHR A;  5JCI A;  2X8H A;  1D4E A;  2AAQ A;  4X9N A;  1RP0 A;  1TRB A;  1TYP A;  3AE7 A;  5KMQ A;  2R0P A;  3LOV A;  3UKP A;  1H81 A;  2Q6U A;  4Z2T A;  4EIQ A;  1QJD A;  1E39 A;  2EQ7 A;  1JNZ A;  3T14 A;  1NG3 A;  2WPC A;  2YM1 A;  2BXS A;  4WX1 A;  3AE8 A;  3NIX A;  3P4Q A;  3S5W A;  4B68 A;  3AYJ A;  4ZN0 A;  2AQJ A;  3T31 A;  3RP7 A;  3VRB A;  3LAD A;  2XFN A;  3IF9 A;  1TDK A;  2ZZC A;  4H4V A;  1GRB A;  3UTG A;  3C4N A;  2BK4 A;  5U1O A;  2BA9 A;  3NNE A;  4YSH A;  3RP6 A;  1JEH A;  4B65 A;  4GF7 A;  1OJT A;  1O95 A;  4H4Z A;  4IA5 A;  3UKQ A;  4EQX A;  4YSX A;  4Z43 A;  1GTE A;  3ABV A;  4PAA A;  2F5Z A;  4NEV A;  2WQY A;  4A6N A;  2GRT A;  2GMH A;  1E1K A;  3NKS A;  4P9S A;  3P4R A;  2IVD A;  2YG4 A;  4YXD A;  3C4A A;  3SZF A;  2NPX A;  2GVC A;  1O5W A;  2CVJ A;  1D7Y A;  3AE3 A;  2W0H A;  1PS9 A;  2GEW A;  5FMH A;  3IHG A;  3D8X A;  3BHF A;  4OPD A;  3P9U A;  1H86 A;  1CC6 A;  3ICR A;  3W4I A;  3UOX A;  3B3R A;  2R4J A;  3K7Q X;  4LA1 A;  1YQ3 A;  1CF3 A;  1VG0 A;  1PHH A;  2GAG B;  3OZ2 A;  2B76 A;  1Q1R A;  2WET A;  3RED A;  4USQ A;  4KPR A;  3VQR A;  2GR1 A;  3SGL A;  2GH5 A;  3DK9 A;  2XLT A;  3ZNQ A;  4CY8 A;  4GAP A;  2C3C A;  3UOZ A;  4H2N A;  1CBO A;  5GRT A;  1MXT A;  3DJD A;  1LQT A;  2FJE A;  4CY6 A;  4GAV A;  3SZ0 A;  1XAN A;  1S3B A;  1RSG A;  4G6H A;  1YY5 A;  3OC4 A;  3CUK A;  1F8W A;  4NWZ A;  1ZX9 A;  5M0Z A;  3T2Z A;  3UKL A;  4C3Y A;  3AEC A;  1PBF A;  4II3 A;  1M64 A;  4J31 A;  4K5R A;  1XHC A;  3QFA A;  1C0K A;  3NH3 X;  3W4J A;  2FJD A;  1ONF A;  4H50 A;  2QCU A;  2OLO A;  2R0C A;  3ZNP A;  2YWL A;  4JNQ A;  1S3E A;  4CCQ A;  2XFQ A;  2ZZ0 A;  2BXR A;  2BK5 A;  1AN9 A;  3PS9 A;  2DKH A;  1DJN A;  4LU6 A;  1TDN A;  3ALL A;  1P2H A;  3H8I A;  2BAC A;  4TM3 A;  4U2S A;  2JK6 A;  1BGJ A;  1LJ1 A;  1KSS A;  1N4W A;  4NNJ A;  2BK3 A;  4YJF A;  2XLU A;  2YLR A;  3K30 A;  1BF3 A;  4NZH A;  3P4S A;  5U25 A;  2ZBW A;  2JB3 A;  5C3J A;  1OJD A;  1C0I A;  1F8R A;  4QFD A;  1K0J A;  1ZP0 A;  1QLB A;  2V5Z A;  3NYF A;  1L9E A;  4X9M A;  1LVL A;  3DGZ A;  4B69 A;  2YG5 A;  3DJE A;  1DAO A;  4IA6 A;  5EB4 A;  1NPX A;  4J34 A;  1CJ4 A;  3M13 A;  4EM3 A;  2XVE A;  4XWZ A;  2WOI A;  1VQW A;  3HYW A;  3AYL A;  1D5T A;  4GDP A;  4H4S A;  4CRT A;  1Q9I A;  4D04 A;  1IUV A;  4C3X A;  2YG6 A;  3UKA A;  1K0I A;  2XCG A;  4B1B A;  2C70 A;  3P1W A;  2XDO A;  1TDF A;  3EAN A;  3KU9 A;  3LZW A;  3UKF A;  4B64 A;  4U8L A;  2Y6Q A;  3KLJ A;  1FOH A;  1KFY A;  5KMS A;  2YLT A;  4AT2 A;  5M10 A;  4C77 A;  4H2Q A;  1JNR A;  5ER0 A;  4A99 A;  4H4T A;  2Y6R A;  3G5Q A;  3BI4 A;  5EB5 A;  1IJH A;  2C66 A;  2YG7 A;  2YR5 A;  4IV9 A;  3BNU A;  1PXC A;  1XDI A;  5HHF A;  3NN6 X;  2JAE A;  1DOE A;  2E82 A;  1BWC A;  2B9W A;  4FX9 A;  2PHH A;  1CHU A;  3IHM A;  2XVF A;  4TLX A;  2XVI A;  3QSM A;  3FPZ A;  3CNT A;  2V3A A;  4G9K A;  4UDR A;  5BUK A;  1YQZ A;  3BNM A;  2ACZ A;  3QFB A;  4RSL A;  1S2Y A;  3RHA A;  2TPR A;  2GAH B;  1BGN A;  1E1N A;  4G6G A;  2BCG G;  2R45 A;  4BK3 A;  3SY4 A;  2IVE A;  4IVM B;  2VRL A;  3DA1 A;  2Q7V A;  3DK8 A;  4GRT A;  2EQ6 A;  4A6N B;  4A7A A;  3BI5 A;  1JRX A;  3NT6 A;  5CKU A;  1BZL A;  4APN A;  3H4K A;  2YLZ A;  2GV8 A;  3I3L A;  4HA6 A;  2BRA A;  4WCT A;  3NRN A;  5FS8 A;  5KWF A;  1EBD A;  1LTX R;  4YJF B;  2RAB A;  1EL8 A;  3QSS A;  5L46 A;  1NEK A;  2I0Z A;  2R9Z A;  4Z26 A;  4E0V A;  5IQ1 A;  2XLR A;  1KDG A;  3AE9 A;  5FS6 A;  1K4Q A;  2C72 A;  4BV6 A;  1EL9 A;  2Z5Y A;  3T0K A;  4BK1 A;  3GDN A;  3SYI A;  3PO7 A;  4A79 A;  3GYX A;  4TLZ A;  4ADW A;  3NHO X;  4JDR A;  2ARD A;  2OA1 A;  3NLC A;  3E1T A;  2YLX A;  4AT0 A;  3AE2 A;  2R0G A;  3B6D A;  2WU5 A;  2RGO A;  2V61 A;  4AOX A;  5KOW A;  1HYU A;  2J3N A;  2JKC A;  4GUV A;  4Y4L A;  3GMC A;  4BJZ A;  1FL2 A;  5U63 A;  4EMI A;  3AEE A;  2Q0L A;  1MOK A;  4YWO A;  3QSE A;  4AP3 A;  1H83 A;  1LQU A;  2BS2 A;  4O5Q A;  2WPF A;  3CGB A;  3DH9 A;  1YKJ A;  1D4C A;  1KF6 A;  4BJY A;  2VVL G;  4Z2R A;  4H2R A;  3CPJ G;  3GWF A;  2GB0 A;  1E6E A;  4YKG A;  1IUU A;  4PAB A;  4RG3 A;  4IVO B;  3DME A;  4H4Y A;  1GOS A;  3NK2 X;  3GDP A;  1CC2 A;  3ATQ A;  2WPE A;  1CC4 A;  2XFU A;  4U8K A;  2XYO A;  5HYM A;  3UP5 A;  4U8M A;  3HYV A;  4JY3 A;  1DNC A;  3ZNO A;  1GRF A;  4ZCD A;  2YVF A;  1O94 A;  4CBQ A;  3QVR A;  3ZDN A;  2XFP A;  4K2X A;  3WE0 A;  2VVM A;  2WP6 A;  3EAO A;  1Y0P A;  1RYI A;  3LB8 A;  5IQ4 A;  2A87 A;  3LXD A;  1L0V A;  1PN0 A;  1UKV G;  1NHS A;  2APG A;  2X50 A;  5IPY A;  3QVP A;  2O9Z A;  3KPK A;  4G74 A;  4O5U A;  2C73 A;  1GRG A;  3F8P A;  3FMW A;  4U8I A;  2C76 A;  5TR3 A;  1CJ2 A;  1Y56 B;  5JCK A;  1ZMD A;  2CUL A;  2WES A;  3ISH A;  3UTH A;  1VRQ B;  3AB1 A;  1MO9 A;  2TMD A;  1GV4 A;  4UDP A;  1ZOY A;  1E7P A;  4K22 A;  2A89 A;  3LJP A;  1IUT A;  1ZOV A;  4ICY A;  3AWI A;  3UTF A;  5BUL A;  1TDE A;  3DJJ A;  3VRD B;  3NK0 X;  2CFY A;  4EQS A;  3WGT A;  1H7X A;  3CPH G;  1ELI A;  3M12 A;  2BS4 A;  3AE5 A;  4UDQ A;  3ZYX A;  1H82 A;  3Q9T A;  5LV9 A;  1PJ5 A;  3UCL A;  3V76 A;  1OJA A;  3FG2 P;  4J2W A;  4OCG A;  2WHD A;  1AOG A;  3AD9 B;  2X99 A;  4B66 A;  1DJQ A;  1ZMC A;  2JB1 A;  4I59 A;  4NEW A;  2FJB A;  1GT8 A;  1N4U A;  3NTD A;  4M52 A;  4NTE A;  4ZCC A;  3S61 A;  1JU2 A;  3H8L A;  3AE1 A;  3AD7 B;  1GTH A;  3K7T A;  2V3B A;  4YJG A;  4YSY A;  3VRA A;  3FBS A;  2WOV A;  3GD3 A;  3GRS A;  2WU2 A;  3AE6 A;  3IWA A;  1GRH A;  2E4G A;  1GRE A;  3NN0 X;  5KVI A;  3T37 A;  3AXB A;  4YJD A;  2YM2 A;  4XXG A;  3SQP A;  2VVL A;  4YTP A;  2FJA A;  2VQ7 A;  2WEU A;  2DKI A;  3AD8 B;  2E4A A;  4TM0 A;  3ALM A;  4Z44 A;  4Y4M A;  2WBA A;  4H4U A;  4OPC A;  2EQ8 A;  1PBD A;  3V3O A;  4DGK A;  3UP4 A;  3P4P A;  1QO8 A;  5DBJ A;  3ITJ A;  3NGC X;  4JNA A;  2YLS A;  3O0H A;  4CNK A;  2IID A;  5JCM A;  1IUX A;  1Y56 A;  3NG7 X;  5EOW A;  4OPT A;  4USR A;  2BC0 A;  3SM8 A;  4UP3 A;  3D1C A;  2C7G A;  2QA2 A;  4K8D A;  4NTC A;  5BRT A;  1JRY A;  3V3N A;  3C96 A;  4YSZ A;  4B63 A;  3RP8 A;  1DOC A;  2RGJ A;  1TDO A;  2GR0 A;  2X8G A;  1VG9 A;  1CL0 A;  4H4X A;  4MJW A;  3SZW A;  3AED A;  1B5Q A;  2DU8 A;  1VDC A;  4JQ9 A;  5KXJ A;  2GR3 A;  1PBB A;  4U2L A;  2B7S A;  4D03 A;  4J57 A;  2YVJ A;  3NK1 X;  2YG3 A;  4CCR A;  1C0L A;  1CJ3 A;  4U8O A;  3M0O A;  1B8S A;  1KNP A;  3UOV A;  1K0L A;  1KNR A;  3GMB A;  1NHQ A;  3BI2 A;  3DK4 A;  2GF3 A;  3GWD A;  4FDC B;  1V59 A;  3QJ4 A;  4GR1 A;  2QA1 A;  2WP5 A;  2XLS A;  2WDQ A;  2HQM A;  2XVJ A;  5FS7 A;  4J56 A;  1OJC A;  5KNL A;  1GXF A;  1FEB A;  1H84 A;  2X8C A;  2GQF A;  3DGH A;  1W4X A;  1Z6L A;  3CNJ A;  3AEB A;  1L9D A;  2YAU A;  5EBK A;  1NHP A;  3AEF A;  1GRT A;  3CN8 A;  4X4J A;  4FK1 A;  2JBV A;  3CNP A;  4H2P A;  1KSU A;  3SFD A;  5KMP A;  1IUS A;  4REK A;  2BRY A;  4U8J A;  5KOX A;  1Q1W A;  4HB9 A;  2OAM A;  4QFC A;  1NAA A;  4AOS A;  3GYJ A;  3ADA B;  3EPT A;  2BYB A;  1E1M A;  1L9C A;  3NYC A;  2E1M A;  4OPU A;  5JCN A;  3NYE A;  1JOA A;  1ZDL A;  2C67 A;  2VZ2 A;  1GSN A;  1B37 A;  1COY A;  1E1L A;  4YJH A;  1FEC A;  5J7X A;  2ZZB A;  4EQW A;  3VR9 A;  2BCP A;  3ALJ A;  4A65 A;  4LII A;  1PJ6 A;  3GD4 A;  4XWR A;  3L8K A;  4A9W A;  2YLW A;  2B7R A;  4G73 A;  4JN9 A;  2EQ9 A;  2WP9 A;  4U8P A;  2V6O A;  5BVA A;  3CNS A;  4YTN A;  2YQU A;  3LZX A;  5JCL A;  4B67 A;  2WDV A;  1F3P A;  3CGC A;  3SX6 A;  2YVG A;  3BHK A;  1GEU A;  1EL5 A;  1ZY8 A;  2Q0K A;  3GSI A;  1PXA A;  1N4V A;  2RGH A;  3G5S A;  3UTE A;  3G5R A;  4DNA A;  2YR4 A;  3Q6J A;  2OLN A;  2X3N A;  4GCM A;  4I58 A;  2PYX A;  1PBC A;  2YR6 A;  4U2T A;  3HZL A;  4J36 A;  1DDO A;  1NEN A;  1F6M A;  1B4V A;  3SFE A;  2GMJ A;  1H7W A;  2BC1 A;  3CTY A;  2E5V A;  4EIP A;  3KD9 A;  4OPG A;  3SZC A;  1F8S A;  2WOW A;  3CGD A;  3DJG X;  4H4Q A;  4K5S A;  2C64 A;  2Z5X A;  3F8R A;  4H7U A;  1EL7 A;  2H88 A;  4II2 A;  4Z24 A;  4EQR A;  2C65 A;  3ATR A;  1IUW A;  1LV0 A;  2C75 A;  1YQ4 A;  2VQB A;  3T2K A;  3NTA A;  4RG4 A;  2WDR A;  2QAE A;  2CDU A;  2H89 A;  3K7M X;  3L1R A;  4FK1 C;  4EM4 A;  5HXI A;  3CGE A;  3AEA A;  3G3E A;  4YTM A;  4DSH A;  3CIR A;  4H4P A;  4TM1 A;  5HY5 A;  3IC9 A;  4J33 A;  1KIF A;  1H6V A;  4N9X A;  1GAL A;  1SEZ A;  1GPE A;  1PJ7 A;  5J60 A;  1LPF A;  1OJ9 A;  3SXI A;  2E49 A;  3CPI G;  3HYX A;  1DOB A;  2XLP A;  4NTD A;  2VOU A;  5KRQ A;  1FEA A;  1ZK7 A;  2WS3 A;  3VR8 A;  4A5L A;  3AYI A;  2GR2 A;  1NG4 A;  4K7Z A;  2UZZ A;  1GRA A;  3KPF A;  2JB2 A;  1N1P A;  1C0P A;  4BUR A;  1GND A;  1JRZ A;  1M6I A;  3UKK A;  5KMR A;  3UOY A;  4YT0 A;  2V60 A;  3KVE A;  1NDA A;  3F8D A;  5FS9 A;  1PDH A;  4H4R A;  4OVI A;  1VE9 A;  1D4D A;  1ZKQ A;  2XVH A;  3URH A;  2R46 A;  2XFO A;  4JY2 A;  4OPI A;  4YJG B;  4TM4 A;  1EVI A;  4ECH A; 
#chains in the Genus database with same CATH homology
 1REO A;  2A8X A;  3JSK A;  3ZNN A;  1BKW A;  4H4W A;  2C4C A;  2E48 A;  2BS3 A;  3KA7 A;  1TYT A;  5CQF A;  4U8N A;  2NVK X;  2BAB A;  3GYI A;  3AEG A;  3KKJ A;  5GSN A;  3RNM A;  3T2Y A;  1PBE A;  2OAL A;  4C5O A;  4OPL A;  1GES A;  4AP1 A;  3PVC A;  5C2T A;  1S2Q A;  1GER A;  1FCD A;  4BK2 A;  1XPQ A;  4GDE A;  4KX6 A;  4EMW A;  4Z25 A;  1PXB A;  3II4 A;  4DSG A;  2AR8 A;  1D7L A;  4YKF A;  1CJC A;  4Z2U A;  4CNJ A;  2VRM A;  3ICT A;  5KVH A;  4YJH B;  2B9X A;  2FBW A;  4EMJ A;  3CMM A;  2GQW A;  4C74 A;  2B9Y A;  1X31 B;  3AE4 A;  2R4E A;  4Y4N A;  3R9U A;  3UKH A;  1DOD A;  3I6D A;  3W4K A;  3FIM B;  1DXL A;  3COX A;  2C3D A;  3ICS A;  3GRT A;  1GET A;  3CND A;  1P2E A;  3EF6 A;  1NHR A;  5JCI A;  2X8H A;  1D4E A;  2AAQ A;  4X9N A;  1RP0 A;  1TRB A;  1TYP A;  3AE7 A;  5KMQ A;  2R0P A;  3LOV A;  3UKP A;  1H81 A;  2Q6U A;  4Z2T A;  4EIQ A;  1QJD A;  1E39 A;  2EQ7 A;  1JNZ A;  3T14 A;  1NG3 A;  2WPC A;  2YM1 A;  2BXS A;  4WX1 A;  3AE8 A;  3NIX A;  3P4Q A;  3S5W A;  4B68 A;  3AYJ A;  4ZN0 A;  2AQJ A;  3T31 A;  3RP7 A;  3VRB A;  3LAD A;  2XFN A;  3IF9 A;  1TDK A;  2ZZC A;  4H4V A;  1GRB A;  3UTG A;  3C4N A;  2BK4 A;  5U1O A;  2BA9 A;  3NNE A;  4YSH A;  3RP6 A;  1JEH A;  4B65 A;  4GF7 A;  1OJT A;  1O95 A;  4H4Z A;  4IA5 A;  3UKQ A;  4EQX A;  4YSX A;  4Z43 A;  1GTE A;  3ABV A;  4PAA A;  2F5Z A;  4NEV A;  2WQY A;  4A6N A;  2GRT A;  2GMH A;  1E1K A;  3NKS A;  4P9S A;  3P4R A;  2IVD A;  2YG4 A;  4YXD A;  3C4A A;  3SZF A;  2NPX A;  2GVC A;  1O5W A;  2CVJ A;  1D7Y A;  3AE3 A;  2W0H A;  1PS9 A;  2GEW A;  5FMH A;  3IHG A;  3D8X A;  3BHF A;  4OPD A;  3P9U A;  1H86 A;  1CC6 A;  3ICR A;  3W4I A;  3UOX A;  3B3R A;  2R4J A;  3K7Q X;  4LA1 A;  1YQ3 A;  1CF3 A;  1VG0 A;  1PHH A;  2GAG B;  3OZ2 A;  2B76 A;  1Q1R A;  2WET A;  3RED A;  4USQ A;  4KPR A;  3VQR A;  2GR1 A;  3SGL A;  2GH5 A;  3DK9 A;  2XLT A;  3ZNQ A;  4CY8 A;  4GAP A;  2C3C A;  3UOZ A;  4H2N A;  1CBO A;  5GRT A;  1MXT A;  3DJD A;  1LQT A;  2FJE A;  4CY6 A;  4GAV A;  3SZ0 A;  1XAN A;  1S3B A;  1RSG A;  4G6H A;  1YY5 A;  3OC4 A;  3CUK A;  1F8W A;  4NWZ A;  1ZX9 A;  5M0Z A;  3T2Z A;  3UKL A;  4C3Y A;  3AEC A;  1PBF A;  4II3 A;  1M64 A;  4J31 A;  4K5R A;  1XHC A;  3QFA A;  1C0K A;  3NH3 X;  3W4J A;  2FJD A;  1ONF A;  4H50 A;  2QCU A;  2OLO A;  3ZNP A;  2R0C A;  2YWL A;  4JNQ A;  1S3E A;  4CCQ A;  2XFQ A;  2ZZ0 A;  2BXR A;  2BK5 A;  1AN9 A;  3PS9 A;  2DKH A;  1DJN A;  4LU6 A;  1TDN A;  1P2H A;  3ALL A;  3H8I A;  2BAC A;  4TM3 A;  4U2S A;  2JK6 A;  1BGJ A;  1LJ1 A;  1KSS A;  1N4W A;  4NNJ A;  2BK3 A;  4YJF A;  2XLU A;  2YLR A;  3K30 A;  1BF3 A;  4NZH A;  3P4S A;  5U25 A;  2ZBW A;  2JB3 A;  5C3J A;  1OJD A;  1C0I A;  1F8R A;  4QFD A;  1K0J A;  1ZP0 A;  1QLB A;  2V5Z A;  3NYF A;  1L9E A;  4X9M A;  1LVL A;  3DGZ A;  4B69 A;  2YG5 A;  3DJE A;  1DAO A;  4IA6 A;  5EB4 A;  1NPX A;  4J34 A;  1CJ4 A;  3M13 A;  4EM3 A;  2XVE A;  4XWZ A;  2WOI A;  1VQW A;  3HYW A;  3AYL A;  1D5T A;  4GDP A;  4H4S A;  4CRT A;  1Q9I A;  4D04 A;  1IUV A;  4C3X A;  2YG6 A;  3UKA A;  1K0I A;  2XCG A;  4B1B A;  2C70 A;  3P1W A;  2XDO A;  1TDF A;  3EAN A;  3KU9 A;  3LZW A;  3UKF A;  4B64 A;  4U8L A;  2Y6Q A;  3KLJ A;  1FOH A;  1KFY A;  5KMS A;  2YLT A;  4AT2 A;  5M10 A;  4C77 A;  4H2Q A;  1JNR A;  5ER0 A;  4A99 A;  4H4T A;  2Y6R A;  3G5Q A;  3BI4 A;  5EB5 A;  1IJH A;  2C66 A;  2YG7 A;  2YR5 A;  4IV9 A;  3BNU A;  1PXC A;  1XDI A;  5HHF A;  3NN6 X;  2JAE A;  1DOE A;  2E82 A;  1BWC A;  2B9W A;  4FX9 A;  2PHH A;  1CHU A;  3IHM A;  2XVF A;  4TLX A;  2XVI A;  3QSM A;  3FPZ A;  3CNT A;  2V3A A;  4G9K A;  4UDR A;  5BUK A;  1YQZ A;  3BNM A;  2ACZ A;  3QFB A;  4RSL A;  1S2Y A;  3RHA A;  2TPR A;  2GAH B;  1BGN A;  1E1N A;  4G6G A;  2BCG G;  2R45 A;  4BK3 A;  3SY4 A;  2IVE A;  4IVM B;  2VRL A;  3DA1 A;  2Q7V A;  3DK8 A;  4GRT A;  2EQ6 A;  4A6N B;  4A7A A;  3BI5 A;  1JRX A;  3NT6 A;  5CKU A;  1BZL A;  4APN A;  3H4K A;  2YLZ A;  2GV8 A;  3I3L A;  4HA6 A;  2BRA A;  4WCT A;  3NRN A;  5FS8 A;  5KWF A;  1EBD A;  1LTX R;  4YJF B;  2RAB A;  1EL8 A;  3QSS A;  5L46 A;  1NEK A;  2I0Z A;  2R9Z A;  4Z26 A;  4E0V A;  5IQ1 A;  2XLR A;  1KDG A;  3AE9 A;  5FS6 A;  1K4Q A;  2C72 A;  4BV6 A;  1EL9 A;  2Z5Y A;  3T0K A;  4BK1 A;  3GDN A;  3SYI A;  3PO7 A;  4A79 A;  3GYX A;  4TLZ A;  4ADW A;  3NHO X;  4JDR A;  2ARD A;  2OA1 A;  3NLC A;  2YLX A;  3E1T A;  4AT0 A;  3AE2 A;  2R0G A;  3B6D A;  2WU5 A;  2RGO A;  2V61 A;  4AOX A;  5KOW A;  1HYU A;  2J3N A;  2JKC A;  4GUV A;  4Y4L A;  3GMC A;  1FL2 A;  5U63 A;  4BJZ A;  4EMI A;  3AEE A;  2Q0L A;  1MOK A;  4YWO A;  3QSE A;  4AP3 A;  1H83 A;  1LQU A;  2BS2 A;  4O5Q A;  2WPF A;  3CGB A;  3DH9 A;  1YKJ A;  1D4C A;  1KF6 A;  2VVL G;  4BJY A;  4Z2R A;  4H2R A;  3CPJ G;  3GWF A;  2GB0 A;  1E6E A;  4YKG A;  1IUU A;  4PAB A;  4RG3 A;  4IVO B;  3DME A;  4H4Y A;  1GOS A;  3NK2 X;  3GDP A;  1CC2 A;  3ATQ A;  2WPE A;  1CC4 A;  2XFU A;  4U8K A;  2XYO A;  5HYM A;  3UP5 A;  4U8M A;  3HYV A;  4JY3 A;  1DNC A;  3ZNO A;  1GRF A;  4ZCD A;  2YVF A;  1O94 A;  4CBQ A;  3QVR A;  3ZDN A;  2XFP A;  4K2X A;  3WE0 A;  2VVM A;  2WP6 A;  3EAO A;  1Y0P A;  1RYI A;  3LB8 A;  5IQ4 A;  2A87 A;  3LXD A;  1L0V A;  1PN0 A;  1UKV G;  1NHS A;  2APG A;  2X50 A;  5IPY A;  3QVP A;  2O9Z A;  3KPK A;  4G74 A;  4O5U A;  2C73 A;  1GRG A;  3F8P A;  3FMW A;  4U8I A;  2C76 A;  5TR3 A;  1CJ2 A;  1Y56 B;  5JCK A;  1ZMD A;  2CUL A;  2WES A;  3ISH A;  3UTH A;  1VRQ B;  3AB1 A;  1MO9 A;  2TMD A;  1GV4 A;  4UDP A;  1ZOY A;  1E7P A;  3LJP A;  2A89 A;  4K22 A;  1IUT A;  1ZOV A;  4ICY A;  3AWI A;  3UTF A;  5BUL A;  1TDE A;  3DJJ A;  3VRD B;  3NK0 X;  2CFY A;  4EQS A;  3WGT A;  1H7X A;  3CPH G;  1ELI A;  3M12 A;  2BS4 A;  3AE5 A;  4UDQ A;  3ZYX A;  1H82 A;  3Q9T A;  5LV9 A;  1PJ5 A;  3UCL A;  3V76 A;  1OJA A;  3FG2 P;  4J2W A;  4OCG A;  2WHD A;  1AOG A;  3AD9 B;  2X99 A;  4B66 A;  1DJQ A;  1ZMC A;  2JB1 A;  4I59 A;  4NEW A;  2FJB A;  1GT8 A;  1N4U A;  3NTD A;  4M52 A;  4NTE A;  4ZCC A;  3S61 A;  1JU2 A;  3H8L A;  3AE1 A;  3AD7 B;  1GTH A;  3K7T A;  2V3B A;  4YJG A;  4YSY A;  3VRA A;  3FBS A;  2WOV A;  3GD3 A;  3GRS A;  2WU2 A;  3AE6 A;  3IWA A;  1GRH A;  2E4G A;  1GRE A;  3NN0 X;  5KVI A;  3T37 A;  3AXB A;  4YJD A;  2YM2 A;  4XXG A;  3SQP A;  2VVL A;  4YTP A;  2FJA A;  2VQ7 A;  2WEU A;  2DKI A;  3AD8 B;  2E4A A;  4TM0 A;  3ALM A;  4Z44 A;  4Y4M A;  2WBA A;  4H4U A;  4OPC A;  2EQ8 A;  1PBD A;  3V3O A;  4DGK A;  3UP4 A;  3P4P A;  1QO8 A;  5DBJ A;  3ITJ A;  3NGC X;  4JNA A;  2YLS A;  3O0H A;  4CNK A;  2IID A;  5JCM A;  1IUX A;  1Y56 A;  3NG7 X;  5EOW A;  4OPT A;  4USR A;  2BC0 A;  3SM8 A;  4UP3 A;  3D1C A;  2C7G A;  2QA2 A;  4K8D A;  4NTC A;  5BRT A;  1JRY A;  3V3N A;  3C96 A;  4YSZ A;  4B63 A;  3RP8 A;  1DOC A;  1TDO A;  2GR0 A;  2RGJ A;  2X8G A;  1VG9 A;  1CL0 A;  4H4X A;  4MJW A;  3SZW A;  3AED A;  1B5Q A;  2DU8 A;  1VDC A;  4JQ9 A;  5KXJ A;  2GR3 A;  1PBB A;  4U2L A;  2B7S A;  4D03 A;  4J57 A;  2YVJ A;  3NK1 X;  2YG3 A;  4CCR A;  1C0L A;  1CJ3 A;  4U8O A;  3M0O A;  1B8S A;  1KNP A;  3UOV A;  1K0L A;  1KNR A;  3DK4 A;  1NHQ A;  3BI2 A;  3GMB A;  2GF3 A;  3GWD A;  4FDC B;  1V59 A;  3QJ4 A;  4GR1 A;  2QA1 A;  2WP5 A;  2XLS A;  2WDQ A;  2HQM A;  2XVJ A;  5FS7 A;  4J56 A;  1OJC A;  5KNL A;  1GXF A;  1FEB A;  1H84 A;  2X8C A;  2GQF A;  3DGH A;  1W4X A;  1Z6L A;  3CNJ A;  3AEB A;  1L9D A;  2YAU A;  5EBK A;  1NHP A;  3AEF A;  1GRT A;  3CN8 A;  4X4J A;  4FK1 A;  2JBV A;  3CNP A;  1KSU A;  4H2P A;  3SFD A;  5KMP A;  1IUS A;  4REK A;  2BRY A;  4U8J A;  5KOX A;  1Q1W A;  4HB9 A;  2OAM A;  4QFC A;  1NAA A;  4AOS A;  3GYJ A;  3ADA B;  3EPT A;  2BYB A;  1E1M A;  1L9C A;  3NYC A;  2E1M A;  4OPU A;  5JCN A;  3NYE A;  1JOA A;  1ZDL A;  2C67 A;  2VZ2 A;  1GSN A;  1B37 A;  1COY A;  1E1L A;  4YJH A;  1FEC A;  5J7X A;  2ZZB A;  4EQW A;  3VR9 A;  2BCP A;  3ALJ A;  4A65 A;  4LII A;  1PJ6 A;  3GD4 A;  4XWR A;  3L8K A;  4A9W A;  2YLW A;  2B7R A;  4G73 A;  4JN9 A;  2EQ9 A;  2WP9 A;  4U8P A;  2V6O A;  5BVA A;  3CNS A;  4YTN A;  2YQU A;  3LZX A;  5JCL A;  4B67 A;  2WDV A;  1F3P A;  3CGC A;  3SX6 A;  2YVG A;  3BHK A;  1GEU A;  1EL5 A;  1ZY8 A;  2Q0K A;  3GSI A;  1PXA A;  1N4V A;  2RGH A;  3G5S A;  3UTE A;  3G5R A;  4DNA A;  2YR4 A;  3Q6J A;  2OLN A;  2X3N A;  4GCM A;  4I58 A;  2PYX A;  1PBC A;  2YR6 A;  4U2T A;  3HZL A;  4J36 A;  1DDO A;  1NEN A;  1F6M A;  1B4V A;  3SFE A;  2GMJ A;  1H7W A;  2BC1 A;  3CTY A;  2E5V A;  3KD9 A;  3SZC A;  4OPG A;  4EIP A;  1F8S A;  2WOW A;  3CGD A;  3DJG X;  4H4Q A;  4K5S A;  2C64 A;  2Z5X A;  3F8R A;  4H7U A;  1EL7 A;  2H88 A;  4II2 A;  4Z24 A;  4EQR A;  2C65 A;  3ATR A;  1IUW A;  1LV0 A;  2C75 A;  1YQ4 A;  2VQB A;  3T2K A;  3NTA A;  4RG4 A;  2WDR A;  2QAE A;  2CDU A;  2H89 A;  3K7M X;  3L1R A;  4FK1 C;  4EM4 A;  5HXI A;  3CGE A;  3AEA A;  3G3E A;  4YTM A;  4DSH A;  3CIR A;  4H4P A;  4TM1 A;  5HY5 A;  3IC9 A;  4J33 A;  1KIF A;  1H6V A;  4N9X A;  1GAL A;  1SEZ A;  1GPE A;  1PJ7 A;  5J60 A;  1LPF A;  1OJ9 A;  3SXI A;  2E49 A;  3CPI G;  3HYX A;  1DOB A;  2XLP A;  4NTD A;  2VOU A;  5KRQ A;  1FEA A;  1ZK7 A;  2WS3 A;  3VR8 A;  4A5L A;  3AYI A;  2GR2 A;  1NG4 A;  4K7Z A;  2UZZ A;  1GRA A;  3KPF A;  2JB2 A;  1N1P A;  1C0P A;  4BUR A;  1GND A;  1JRZ A;  1M6I A;  3UKK A;  5KMR A;  3UOY A;  4YT0 A;  2V60 A;  3KVE A;  1NDA A;  3F8D A;  5FS9 A;  1PDH A;  4H4R A;  4OVI A;  1VE9 A;  1D4D A;  1ZKQ A;  2XVH A;  3URH A;  2R46 A;  2XFO A;  4JY2 A;  4OPI A;  4YJG B;  4TM4 A;  1EVI A;  4ECH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...