1Y56B

Crystal structure of l-proline dehydrogenase from p.horikoshii
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
374
structure length
374
Chain Sequence
LPEKSEIVVIGGGIVGVTIAHELAKRGEEVTVIEKRFIGSGSTFRCGTGIRQQFNDEANVRVMKRSVELWKKYSEEYGFSFKQTGYLFLLYDDEEVKTFKRNIEIQNKFGVPTKLITPEEAKEIVPLLDISEVIAASWNPTDGKADPFEATTAFAVKAKEYGAKLLEYTEVKGFLIENNEIKGVKTNKGIIKTGIVVNATNAWANLINAMAGIKTKIPIEPYKHQAVITQPIKRGTINPMVISFKYGHAYLTQTFHGGIIGGIGYEIGPTYDLTPTYEFLREVSYYFTKIIPALKNLLILRTWAGYYAKTPDSNPAIGRIEELNDYYIAAGFSGHGFMMAPAVGEMVAELITKGKTKLPVEWYDPYRFERGELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein PH1363
publication title Crystal structure of a novel FAD-, FMN-, and ATP-containing L-proline dehydrogenase complex from Pyrococcus horikoshii
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Oxidoreductase
total genus 126
structure length 374
sequence length 374
ec nomenclature ec 1.5.99.8: Transferred entry: 1.5.5.2.
pdb deposition date 2004-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01266 DAO FAD dependent oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.9.10 Alpha Beta 2-Layer Sandwich D-Amino Acid Oxidase; Chain A, domain 2 D-Amino Acid Oxidase, subunit A, domain 2 1y56B02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1y56B01
4TM0A 3GWFA 4YTMA 3UTHA 1CHUA 2O9ZA 1E39A 4O5QA 3UKKA 5FS6A 1LTXR 5JCMA 3B6DA 4FK1A 4Y4LA 1FL2A 1D4EA 4E0VA 4J2WA 4B63A 1IUVA 3AE7A 2V61A 2C76A 3LADA 2GMHA 4OPDA 3SFEA 3PO7A 2VVMA 1XDIA 4H4RA 4ICYA 3EPTA 1NENA 2ACZA 3W4JA 2RGJA 3LZWA 1PBBA 4B68A 4Z44A 4WCTA 1NHQA 3G5RA 2BXRA 4TM4A 4U8NA 3UCLA 1DODA 3UTEA 4JNAA 3SM8A 1FEBA 1LQUA 2WP6A 2XVEA 3NNEA 2WU2A 4EM4A 3F8DA 1ZX9A 2FJDA 1EL7A 1GREA 4HB9A 3F8RA 2R45A 1LV0A 5IQ4A 2EQ8A 1B5QA 2DKHA 3NTAA 4JDRA 4B67A 2ZZCA 1C0LA 3NLCA 4OPCA 4C3XA 1Q1RA 1TDNA 3AEEA 4U8JA 5KOXA 4FX9A 1IJHA 4B69A 3C4NA 4ADWA 3OC4A 2XLSA 3AE8A 1ZOVA 4CBQA 3GDPA 4A6NB 5BVAA 3ZNQA 4JQ9A 5GSNA 3UOZA 2HQMA 4M52A 4GUVA 1GEUA 3VR9A 4B65A 2WETA 1F8RA 4H4UA 4PABA 3NN0X 4A7AA 4EMWA 4OPTA 3LOVA 4YTPA 2A89A 2BCGG 3IHMA 2Q7VA 5U25A 1XPQA 4IA5A 1MOKA 2WBAA 3CNPA 3FBSA 4U8KA 3UOYA 3H4KA 3BI2A 4EQWA 3NTDA 4ECHA 1PJ5A 1KNPA 2OLNA 3COXA 5JCNA 2GEWA 2XFPA 1S2YA 2NVKX 2VQBA 1IUWA 4H2PA 2BA9A 2WDRA 1GRBA 2AQJA 4LA1A 3CNDA 3KLJA 2C73A 2VRLA 5FS8A 2XFNA 1GTHA 2OLOA 1LQTA 2Q0KA 4XWRA 1Q1WA 3GD3A 4D04A 1M64A 2XVJA 1KSSA 2YQUA 3VR8A 4BURA 3BI5A 3UKFA 4J56A 2JBVA 2YG4A 2YLRA 3AB1A 3NK2X 1EL9A 3IF9A 3E1TA 2FJBA 2ZZBA 4Z2TA 4UDPA 2X3NA 5EBKA 3HZLA 1QJDA 3ISHA 4BK1A 4CCRA 3ZDNA 2WOVA 4GRTA 3CGCA 3GRTA 2CDUA 1CC4A 1JNRA 1O94A 2WS3A 3AEBA 2JB3A 1XANA 2WPFA 3LJPA 2R0PA 4KPRA 4U8IA 2E1MA 3AECA 1L0VA 4A65A 1S3BA 2WU5A 4H2NA 2TMDA 3K7MX 4IVOB 4A9WA 1GNDA 3DH9A 4NTCA 1LJ1A 1E1KA 3D8XA 3H8LA 1D4DA 3REDA 2Z5XA 3ICTA 1GTEA 1H6VA 1O5WA 1RSGA 1S2QA 2F5ZA 3AE6A 1E1NA 3KU9A 1NHPA 2YLTA 5L46A 3VRDB 1PXBA 1D5TA 1PBDA 1GERA 1GRHA 5EB5A 1FOHA 2VVLA 4USRA 5IQ1A 3RP6A 4EQSA 2BXSA 1NEKA 2C3DA 3AEGA 5BULA 5GRTA 2ZZ0A 3NRNA 5C2TA 1CJ4A 2GAGB 4YSXA 3ICRA 2Q0LA 1LPFA 1PN0A 4YJHA 3ATRA 2RABA 1OJTA 1IUXA 3ALJA 2GF3A 3WGTA 2BK3A 3DJGX 4NEVA 3I6DA 4J36A 2B9XA 2WEUA 3ALLA 4LIIA 2XVIA 4J33A 4B64A 4C3YA 1PXAA 3M12A 3M0OA 3AYJA 2B9YA 2GRTA 1JNZA 1KDGA 1H86A 2V3AA 4GDPA 2BS2A 4H4YA 5JCKA 4YJGA 1L9CA 3AD8B 2I0ZA 3AWIA 1YQZA 3AEDA 2XCGA 4H4TA 3UP5A 5LV9A 4JNQA 4B66A 4XWZA 2VVLG 3KD9A 3QFBA 2YR6A 3LXDA 4RG3A 3CIRA 4H7UA 5TR3A 3S61A 5DBJA 4WX1A 3AE9A 3AE2A 4K5SA 4TLZA 2A87A 3FG2P 1M6IA 2WHDA 3DMEA 1QO8A 2JKCA 4H4PA 4TM3A 4ZCDA 4AOXA 1E7PA 4AP3A 1E6EA 2QCUA 3UKPA 3DJJA 3GDNA 1F8WA 1K0IA 1GRAA 2FJEA 2GQFA 2X99A 3ICSA 4IVMB 4CY6A 4DSHA 3GMCA 3GSIA 2CULA 3NT6A 3URHA 3ABVA 4JN9A 5KXJA 3DK9A 1KSUA 4YJFA 1N4VA 3QJ4A 1ZMDA 2GR0A 3UTFA 3AEFA 4AP1A 3QSMA 3BNMA 4J34A 3V3NA 3DJEA 1E1LA 2CVJA 3H8IA 1VG9A 4REKA 1C0PA 3GD4A 4U8LA 3SQPA 4EMIA 1DOEA 3ADAB 2JK6A 1JU2A 1PBCA 1VE9A 1W4XA 2B7SA 5JCLA 1F8SA 1E1MA 3UTGA 5JCIA 4RSLA 3CNJA 3RP8A 4Z24A 1DXLA 1KF6A 2BK5A 4Z2RA 1F6MA 1KNRA 4NZHA 2B7RA 3BHKA 2APGA 2XFQA 4B1BA 5FS7A 2E48A 1ZKQA 3BHFA 2YG3A 4H4QA 1JRXA 3WE0A 3ZYXA 1IUTA 4EQXA 3ZNPA 1AN9A 5HYMA 4X4JA 2R46A 2YR4A 4BK2A 1TRBA 2GMJA 1OJDA 3B3RA 1QLBA 2BABA 2IIDA 2OALA 5CKUA 1NDAA 1GV4A 4YSYA 1EVIA 2YVJA 3G5SA 3UKAA 1IUSA 4J57A 4TM1A 2B76A 3K7TA 4H2RA 4OPIA 1TDKA 4CY8A 3DGZA 1GT8A 3R9UA 2AAQA 4GDEA 4X9NA 3C96A 4MJWA 2BACA 5KWFA 2WQYA 2YLWA 2VQ7A 3O0HA 2PHHA 1ZY8A 5U1OA 2R0GA 4IA6A 3VQRA 2EQ7A 2EQ6A 1S3EA 4OVIA 1DJQA 2XLUA 5FMHA 5U63A 2WPEA 2AR8A 4H4XA 4CNJA 1PHHA 1H7WA 2Y6RA 3UP4A 2A8XA 1DAOA 3DJDA 3NYFA 1N4WA 2R4JA 4DSGA 4BJZA 2BC0A 2XFUA 3L8KA 2NPXA 3CGEA 4YXDA 4A99A 2GAHB 3LZXA 4C5OA 3II4A 1PDHA 4FDCB 3S5WA 3VRAA 2WPCA 2YLZA 4I58A 4D03A 1CC2A 3CTYA 3AD9B 1NG3A 5KVIA 4DNAA 1VDCA 2E4AA 1REOA 1ZMCA 2R4EA 4A79A 5KVHA 4AOSA 3BNUA 4Z2UA 2DKIA 3UOVA 4FK1C 3SFDA 4YJGB 2EQ9A 3KA7A 1EBDA 5IPYA 1BGNA 3AYIA 1BZLA 3KKJA 1DJNA 5C3JA 1JRYA 4YT0A 1ONFA 3NH3X 4H4VA 2WOWA 3QVRA 1MO9A 1GALA 3GYIA 2XLTA 3AE1A 1P2EA 1PS9A 4K22A 1NHRA 2R0CA 4EM3A 1H7XA 4UP3A 1FEAA 2YG7A 1UKVG 3KPFA 1VG0A 2B9WA 4A5LA 1GETA 3NGCX 2YLSA 2WESA 2C67A 5HHFA 2C3CA 1ZDLA 2X50A 4BK3A 2XFOA 1JOAA 4O5UA 2X8GA 1PJ6A 4N9XA 3AE3A 4CCQA 4U2LA 3C4AA 3QSSA 1FECA 1CF3A 3EANA 2E49A 2Q6UA 2XVHA 3GWDA 3RHAA 2IVDA 5J60A 3CPJG 4YJFB 4U8OA 1BF3A 4YKGA 2C66A 1D7LA 4OPGA 1D4CA 1PXCA 1N1PA 3CPHG 1F3PA 3FPZA 2XLPA 5M10A 5FS9A 1Y56A 1CJ3A 3SGLA 2GVCA 2V60A 3Q6JA 4QFDA 1GESA 1GOSA 3M13A 2V5ZA 1SEZA 4CRTA 4JY3A 3PS9A 3CN8A 1D7YA 4U8PA 2OA1A 1HYUA 2X8HA 1ZP0A 4H4ZA 2GR1A 3RNMA 3NHOX 2IVEA 3G5QA 4NTDA 2Z5YA 3NYEA 2JB1A 3NYCA 3BI4A 1B8SA 4RG4A 2DU8A 2H89A 1JRZA 1V59A 1ZOYA 3AE4A 4X9MA 3NN6X 2BYBA 2QAEA 2W0HA 2GH5A 3K7QX 4LU6A 4QFCA 1GSNA 4EIPA 2FJAA 1YKJA 3QVPA 5BRTA 1CJCA 1NHSA 2V3BA 3DA1A 4H2QA 4U2TA 3QFAA 4OCGA 2OAMA 5ER0A 2YG5A 4C74A 1PJ7A 4KX6A 1ELIA 2BC1A 1BKWA 4Z25A 3OZ2A 3NK1X 1GRGA 1Q9IA 1MXTA 3ZNNA 5BUKA 3D1CA 1EL5A 2XYOA 1CJ2A 4NEWA 1KFYA 3NG7X 3W4KA 4YSHA 3P9UA 1BGJA 4YJDA 3NKSA 4HA6A 2YM1A 4OPUA 3V76A 2E82A 4Y4MA 4USQA 3JSKA 4K8DA 4H4WA 4NTEA 3NK0X 1NG4A 1K4QA 4P9SA 1DOBA 3F8PA 4AT0A 1DDOA 1L9DA 1ZK7A 1B37A 2E4GA 4K5RA 4PAAA 1BWCA 5KOWA 2BCPA 3EAOA 2C65A 1PBFA 4UDRA 2UZZA 3AYLA 4CNKA 2C64A 5EOWA 3RP7A 1GRFA 2PYXA 4ZN0A 5CQFA 1TDFA 2C75A 4UDQA 3K30A 1H84A 2CFYA 1H81A 5EB4A 2GR2A 3P1WA 4YJHB 3P4SA 3QSEA 2V6OA 4GF7A 3ALMA 3KVEA 1RYIA 2VOUA 3GMBA 4Z43A 4JY2A 4Z26A 2JAEA 1YQ3A 2YWLA 1GXFA 2VZ2A 2GQWA 3IWAA 5KRQA 3V3OA 1OJCA 2TPRA 1IUUA 2RGOA 1GPEA 1EL8A 2WOIA 4YSZA 1PBEA 4TLXA 3DGHA 2VRMA 4YWOA 2JB2A 4A6NA 1H82A 3GYJA 3IC9A 3ITJA 4I59A 1KIFA 3UKHA 1K0JA 3UKQA 4DGKA 1C0IA 4IV9A 4EIQA 3AXBA 3Q9TA 4EQRA 4K7ZA 5J7XA 1Y56B 2YM2A 5M0ZA 1N4UA 4AT2A 1TYPA 1CBOA 4XXGA 3P4RA 4EMJA 2QA1A 1RP0A 2BS3A 1AOGA 3CNTA 3CGBA 1C0KA 1CC6A 2RGHA 1B4VA 3FIMB 1FCDA 2E5VA 1JEHA 2WDVA 2R9ZA 2XDOA 4GR1A 5HXIA 1K0LA 4BV6A 2XVFA 2GB0A 3GRSA 2H88A 1VQWA 3I3LA 3FMWA 4U8MA 1TYTA 4BJYA 2ARDA 2FBWA 2GV8A 3NIXA 3VRBA 3AEAA 5HY5A 1YY5A 3T37A 4APNA 1DNCA 3CNSA 2C7GA 3UOXA 1X31B 1O95A 1Y0PA 1Z6LA 3AE5A 4Y4NA 1DOCA 3G3EA 4YTNA 2C72A 2BK4A 2C70A 3CGDA 2WDQA 4GCMA 1TDOA 1YQ4A 3PVCA 3ZNOA 2GR3A 4H4SA 1NAAA 1OJAA 3EF6A 2X8CA 4J31A 2ZBWA 3DK8A 4ZCCA 2WP9A 3AD7B 4OPLA 3UKLA 1OJ9A 1VRQB 2J3NA 1GRTA 3IHGA 2YVFA 2YVGA 1NPXA 1H83A 3DK4A 4YKFA 2YR5A 4U2SA 3P4QA 1L9EA 1CL0A 2Y6QA 3CUKA 3CPIG 3L1RA 1P2HA 4H50A 4C77A 2BS4A 3LB8A 4K2XA 3ATQA 2YAUA 1COYA 2QA2A 2WP5A 3P4PA 2YLXA 3W4IA 1XHCA 1LVLA 2YG6A 1TDEA 2XLRA
chains in the Genus database with same CATH superfamily
4TM0A 3GWFA 4YTMA 3UTHA 3SZ0A 1CHUA 2O9ZA 1E39A 4O5QA 3UKKA 5FS6A 1LTXR 5JCMA 3SXIA 3B6DA 4FK1A 4Y4LA 1FL2A 1D4EA 4E0VA 4J2WA 4B63A 1IUVA 3AE7A 2V61A 2C76A 3LADA 2GMHA 4OPDA 3SFEA 3PO7A 2VVMA 1XDIA 4H4RA 4ICYA 3EPTA 2RGJA 1NENA 3W4JA 2ACZA 3LZWA 1PBBA 4B68A 4Z44A 4WCTA 1NHQA 3G5RA 2BXRA 4TM4A 4U8NA 3UCLA 1DODA 3UTEA 4JNAA 3SM8A 1FEBA 1LQUA 2WP6A 2XVEA 3NNEA 2WU2A 4EM4A 3F8DA 1ZX9A 2FJDA 1EL7A 1GREA 4HB9A 3F8RA 2R45A 1LV0A 5IQ4A 2EQ8A 2DKHA 1B5QA 3NTAA 4JDRA 4B67A 2ZZCA 1C0LA 3NLCA 4OPCA 4C3XA 1Q1RA 1TDNA 3AEEA 4U8JA 5KOXA 4FX9A 1IJHA 4B69A 3C4NA 4ADWA 3OC4A 2XLSA 3AE8A 1ZOVA 4CBQA 3GDPA 4A6NB 5BVAA 3ZNQA 4JQ9A 5GSNA 3UOZA 2HQMA 4M52A 4GUVA 1GEUA 3VR9A 4B65A 2WETA 1F8RA 4H4UA 4PABA 3NN0X 4A7AA 4EMWA 4OPTA 3LOVA 4II3A 4YTPA 2A89A 2BCGG 3IHMA 2Q7VA 5U25A 1XPQA 3T2YA 4IA5A 1MOKA 2WBAA 3CNPA 3FBSA 4U8KA 3UOYA 3H4KA 3BI2A 4EQWA 3NTDA 4ECHA 1PJ5A 1KNPA 2OLNA 3COXA 5JCNA 2GEWA 2XFPA 1S2YA 2NVKX 2VQBA 1IUWA 4H2PA 2BA9A 2WDRA 1GRBA 2AQJA 4LA1A 3CNDA 3KLJA 2C73A 2VRLA 5FS8A 2XFNA 1GTHA 2OLOA 1LQTA 2Q0KA 4XWRA 1Q1WA 3GD3A 4D04A 1M64A 2XVJA 1KSSA 2YQUA 3HYXA 3VR8A 4BURA 3BI5A 3UKFA 4J56A 2JBVA 2YG4A 2YLRA 3AB1A 3NK2X 1EL9A 3IF9A 3E1TA 3SZWA 2FJBA 2ZZBA 4Z2TA 4UDPA 2X3NA 5EBKA 3HZLA 4BK1A 1QJDA 3ISHA 4CCRA 3ZDNA 2WOVA 4GRTA 3CGCA 3GRTA 2CDUA 1CC4A 1JNRA 1O94A 2WS3A 3AEBA 2JB3A 1XANA 2WPFA 3LJPA 2R0PA 4KPRA 4U8IA 2E1MA 3AECA 1L0VA 4A65A 1S3BA 2WU5A 4H2NA 2TMDA 3K7MX 4IVOB 4EMIA 4A9WA 1GNDA 3DH9A 4NTCA 1LJ1A 1E1KA 3D8XA 3H8LA 1D4DA 3REDA 2Z5XA 3ICTA 1GTEA 1H6VA 1O5WA 1RSGA 1S2QA 2F5ZA 3AE6A 1E1NA 3KU9A 1NHPA 2YLTA 5L46A 3VRDB 1PXBA 1D5TA 1PBDA 1GERA 1GRHA 5EB5A 1FOHA 2VVLA 4USRA 3RP6A 5IQ1A 4EQSA 2BXSA 1NEKA 2C3DA 3AEGA 5BULA 5GRTA 2ZZ0A 3NRNA 5C2TA 1CJ4A 2GAGB 4YSXA 3ICRA 2Q0LA 1LPFA 1PN0A 4YJHA 3ATRA 2RABA 1OJTA 1IUXA 3ALJA 2GF3A 3WGTA 2BK3A 3DJGX 4NEVA 3I6DA 4J36A 3ALLA 2B9XA 2WEUA 3HYWA 4LIIA 2XVIA 4J33A 4B64A 3SZCA 4C3YA 1PXAA 3M12A 3M0OA 3AYJA 2B9YA 2GRTA 1JNZA 1KDGA 1H86A 2V3AA 4GDPA 2BS2A 4H4YA 5JCKA 2BRYA 4YJGA 1L9CA 3AD8B 2I0ZA 3AWIA 1YQZA 3AEDA 2XCGA 4H4TA 3UP5A 5LV9A 4JNQA 4B66A 4XWZA 2VVLG 3KD9A 3QFBA 2YR6A 3LXDA 4RG3A 3CIRA 4H7UA 5TR3A 3S61A 5DBJA 4WX1A 3AE9A 3AE2A 4K5SA 4TLZA 2A87A 3FG2P 1M6IA 2WHDA 3DMEA 1QO8A 2JKCA 4H4PA 4TM3A 4ZCDA 4AOXA 1E7PA 4AP3A 1E6EA 2QCUA 3UKPA 3DJJA 3GDNA 1F8WA 1K0IA 1GRAA 2FJEA 2GQFA 2X99A 3ICSA 4IVMB 4CY6A 4DSHA 3GMCA 3GSIA 2CULA 3NT6A 3URHA 3ABVA 4JN9A 5KXJA 3DK9A 1KSUA 4YJFA 1N4VA 3QJ4A 1ZMDA 2GR0A 3UTFA 3AEFA 4AP1A 3QSMA 3BNMA 4J34A 3V3NA 3DJEA 1E1LA 2CVJA 3H8IA 1VG9A 4REKA 1C0PA 3GD4A 4U8LA 3SQPA 3SY4A 1DOEA 3ADAB 2JK6A 1JU2A 1PBCA 1VE9A 1W4XA 2B7SA 5JCLA 1F8SA 1E1MA 3UTGA 5JCIA 4RSLA 3CNJA 3RP8A 4Z24A 1DXLA 1KF6A 2BK5A 2BRAA 4Z2RA 1F6MA 1KNRA 4NZHA 2B7RA 3BHKA 2APGA 2XFQA 4B1BA 5FS7A 2E48A 1ZKQA 3BHFA 2YG3A 4H4QA 1JRXA 3WE0A 3ZYXA 1IUTA 4EQXA 3ZNPA 1AN9A 5HYMA 4X4JA 2R46A 2YR4A 4BK2A 1TRBA 2GMJA 1OJDA 3B3RA 1QLBA 2BABA 2IIDA 2OALA 5CKUA 1NDAA 1GV4A 4YSYA 1EVIA 2YVJA 3G5SA 3UKAA 1IUSA 4J57A 4TM1A 4H2RA 2B76A 3K7TA 4OPIA 1TDKA 4CY8A 3DGZA 1GT8A 3R9UA 4NWZA 2AAQA 4GDEA 4X9NA 3C96A 4MJWA 2BACA 5KWFA 2WQYA 2YLWA 2VQ7A 3O0HA 2PHHA 1ZY8A 5U1OA 2R0GA 4IA6A 3VQRA 2EQ7A 2EQ6A 1S3EA 4OVIA 1DJQA 2XLUA 5FMHA 5U63A 2WPEA 2AR8A 4H4XA 4CNJA 1PHHA 1H7WA 2Y6RA 3UP4A 4II2A 2A8XA 1DAOA 3DJDA 3NYFA 1N4WA 4NNJA 2R4JA 4DSGA 4BJZA 2BC0A 2XFUA 3L8KA 5KNLA 2NPXA 3CGEA 4YXDA 4A99A 2GAHB 3LZXA 4C5OA 3II4A 1PDHA 4FDCB 3S5WA 3VRAA 2WPCA 2YLZA 4I58A 4D03A 1CC2A 3CTYA 3AD9B 1NG3A 5KVIA 4DNAA 1VDCA 2E4AA 1REOA 1ZMCA 2R4EA 3T2ZA 4A79A 4AOSA 5KVHA 3BNUA 3T0KA 4Z2UA 2DKIA 3UOVA 4FK1C 3SX6A 3SFDA 4YJGB 2EQ9A 3KA7A 1EBDA 5IPYA 1BGNA 3AYIA 1BZLA 3KKJA 1DJNA 5C3JA 1JRYA 4YT0A 1ONFA 3NH3X 4H4VA 2WOWA 3QVRA 1MO9A 5KMQA 1GALA 3GYIA 2XLTA 3AE1A 1P2EA 1PS9A 4K22A 2R0CA 1NHRA 4EM3A 5KMRA 1H7XA 4UP3A 1FEAA 2YG7A 1UKVG 3KPFA 1VG0A 3T14A 2B9WA 4A5LA 1GETA 3NGCX 2YLSA 2WESA 2C67A 5HHFA 2C3CA 1ZDLA 2X50A 4BK3A 2XFOA 1JOAA 4O5UA 2X8GA 1PJ6A 4N9XA 3AE3A 4CCQA 4U2LA 3C4AA 1FECA 3QSSA 1CF3A 3EANA 2E49A 2Q6UA 2XVHA 3GWDA 3RHAA 2IVDA 3T2KA 3CPJG 4YJFB 4U8OA 5J60A 1BF3A 4YKGA 2C66A 1D7LA 4OPGA 1D4CA 1PXCA 1N1PA 3CPHG 1F3PA 3FPZA 2XLPA 5M10A 3KPKA 5FS9A 1Y56A 1CJ3A 3SGLA 2GVCA 3T31A 2V60A 3Q6JA 4QFDA 1GESA 1GOSA 3M13A 2V5ZA 1SEZA 4CRTA 4JY3A 4GAVA 3PS9A 3CN8A 1D7YA 4U8PA 2OA1A 1HYUA 2X8HA 1ZP0A 4H4ZA 2GR1A 3RNMA 3NHOX 2IVEA 3G5QA 4NTDA 2Z5YA 3NYEA 2C4CA 3NYCA 2JB1A 3BI4A 1B8SA 4RG4A 2DU8A 2H89A 1JRZA 1V59A 1ZOYA 3AE4A 4X9MA 3NN6X 2BYBA 2QAEA 2W0HA 2GH5A 3K7QX 4LU6A 4QFCA 4EIPA 1GSNA 2FJAA 1YKJA 3QVPA 5BRTA 1CJCA 1NHSA 2V3BA 3DA1A 4H2QA 4U2TA 3QFAA 4OCGA 2OAMA 5ER0A 4G9KA 2YG5A 4G74A 1PJ7A 4GAPA 4C74A 4KX6A 1ELIA 2BC1A 1BKWA 4Z25A 3OZ2A 3NK1X 1GRGA 1Q9IA 1MXTA 3ZNNA 5BUKA 3D1CA 1EL5A 2XYOA 1CJ2A 4NEWA 1KFYA 3NG7X 3W4KA 4YSHA 3P9UA 1BGJA 4YJDA 3NKSA 4HA6A 2YM1A 4OPUA 3V76A 2E82A 4Y4MA 4USQA 3JSKA 4K8DA 4H4WA 4NTEA 3NK0X 5KMPA 1NG4A 1K4QA 4P9SA 1DOBA 3F8PA 4AT0A 1DDOA 1L9DA 1ZK7A 1B37A 2E4GA 4K5RA 4PAAA 1BWCA 5KOWA 2BCPA 3EAOA 2C65A 1PBFA 4UDRA 2UZZA 3AYLA 4CNKA 2C64A 5EOWA 3RP7A 1GRFA 3GYXA 2PYXA 4ZN0A 5CQFA 1TDFA 2C75A 4UDQA 3K30A 1H84A 2CFYA 1H81A 5EB4A 2GR2A 3P1WA 4YJHB 3P4SA 3QSEA 2V6OA 4GF7A 3ALMA 3KVEA 1RYIA 2VOUA 3GMBA 4Z43A 4JY2A 4Z26A 2JAEA 1YQ3A 2YWLA 1GXFA 2VZ2A 2GQWA 3IWAA 5KRQA 3V3OA 1OJCA 2TPRA 1IUUA 2RGOA 1GPEA 1EL8A 2WOIA 4YSZA 1PBEA 4TLXA 3SZFA 3DGHA 2VRMA 4YWOA 2JB2A 4A6NA 1H82A 3GYJA 3IC9A 3ITJA 4I59A 1KIFA 3UKHA 1K0JA 3UKQA 4DGKA 1C0IA 4EIQA 4IV9A 3AXBA 3Q9TA 4EQRA 4K7ZA 5J7XA 1Y56B 2YM2A 5M0ZA 1N4UA 4AT2A 1TYPA 1CBOA 4XXGA 3SYIA 3P4RA 4G73A 4EMJA 2QA1A 1RP0A 2BS3A 1AOGA 3CNTA 3HYVA 3CGBA 1C0KA 3CMMA 1CC6A 2RGHA 1B4VA 3FIMB 4G6GA 1FCDA 2E5VA 1JEHA 2WDVA 2R9ZA 2XDOA 4GR1A 5HXIA 1K0LA 4BV6A 2XVFA 2GB0A 3GRSA 2H88A 1VQWA 3I3LA 3FMWA 4U8MA 1TYTA 4BJYA 2ARDA 2FBWA 2GV8A 3NIXA 5KMSA 3VRBA 3AEAA 5HY5A 1YY5A 3T37A 4APNA 4G6HA 1DNCA 3CNSA 2C7GA 3UOXA 1X31B 1O95A 1Y0PA 1Z6LA 3AE5A 4Y4NA 1DOCA 3G3EA 4YTNA 2C72A 2BK4A 2C70A 3CGDA 2WDQA 4GCMA 1TDOA 1YQ4A 3PVCA 3ZNOA 2GR3A 4H4SA 1NAAA 1OJAA 3EF6A 2X8CA 4J31A 2ZBWA 3DK8A 4ZCCA 2WP9A 3AD7B 4OPLA 3UKLA 1OJ9A 1VRQB 2J3NA 3IHGA 1GRTA 2YVFA 2YVGA 1NPXA 1H83A 3DK4A 4YKFA 2YR5A 4U2SA 3P4QA 1L9EA 1CL0A 2Y6QA 3CUKA 3CPIG 3L1RA 1P2HA 4H50A 4C77A 2BS4A 3LB8A 4K2XA 3ATQA 2YAUA 1COYA 2QA2A 2WP5A 3P4PA 2YLXA 3W4IA 1XHCA 1LVLA 2YG6A 1TDEA 2XLRA
chains in the Genus database with same CATH topology
4TM0A 3GWFA 4YTMA 3UTHA 3SZ0A 1CHUA 2O9ZA 1E39A 4O5QA 3UKKA 5FS6A 1LTXR 5JCMA 3SXIA 3B6DA 4FK1A 4Y4LA 1FL2A 1D4EA 4E0VA 4J2WA 4B63A 1IUVA 3AE7A 2V61A 2C76A 3LADA 2GMHA 4OPDA 3SFEA 3PO7A 2VVMA 1XDIA 4H4RA 4ICYA 3EPTA 1NENA 2ACZA 3W4JA 2RGJA 3LZWA 1PBBA 4B68A 4Z44A 4WCTA 1NHQA 3G5RA 2BXRA 4TM4A 4U8NA 3UCLA 1DODA 3UTEA 4JNAA 3SM8A 1FEBA 1LQUA 2WP6A 2XVEA 3NNEA 2WU2A 4EM4A 3F8DA 1ZX9A 2FJDA 1EL7A 1GREA 4HB9A 3F8RA 2R45A 1LV0A 5IQ4A 2EQ8A 1B5QA 2DKHA 3NTAA 4JDRA 4B67A 2ZZCA 1C0LA 3NLCA 4OPCA 4C3XA 1Q1RA 1TDNA 3AEEA 4U8JA 5KOXA 4FX9A 1IJHA 4B69A 3C4NA 4ADWA 3OC4A 2XLSA 3AE8A 1ZOVA 4CBQA 3GDPA 4A6NB 5BVAA 3ZNQA 4JQ9A 5GSNA 3UOZA 2HQMA 4M52A 4GUVA 1GEUA 3VR9A 4B65A 2WETA 1F8RA 4H4UA 4PABA 3NN0X 4A7AA 4EMWA 4OPTA 3LOVA 4II3A 4YTPA 2A89A 2BCGG 3IHMA 2Q7VA 5U25A 1XPQA 3T2YA 4IA5A 1MOKA 2WBAA 3CNPA 3FBSA 4U8KA 3UOYA 3H4KA 3BI2A 4EQWA 3NTDA 4ECHA 1PJ5A 1KNPA 2OLNA 3COXA 5JCNA 2GEWA 2XFPA 1S2YA 2NVKX 2VQBA 1IUWA 4H2PA 2BA9A 2WDRA 1GRBA 2AQJA 4LA1A 3CNDA 3KLJA 2C73A 2VRLA 5FS8A 2XFNA 1GTHA 2OLOA 1LQTA 2Q0KA 4XWRA 1Q1WA 3GD3A 4D04A 1M64A 2XVJA 1KSSA 2YQUA 3HYXA 3VR8A 4BURA 3BI5A 3UKFA 4J56A 2JBVA 2YG4A 2YLRA 3AB1A 3NK2X 1EL9A 3IF9A 3E1TA 3SZWA 2FJBA 2ZZBA 4Z2TA 4UDPA 2X3NA 5EBKA 3HZLA 1QJDA 3ISHA 4BK1A 4CCRA 3ZDNA 2WOVA 4GRTA 3CGCA 3GRTA 2CDUA 1CC4A 1JNRA 1O94A 2WS3A 3AEBA 2JB3A 1XANA 2WPFA 3LJPA 2R0PA 4KPRA 4U8IA 2E1MA 3AECA 1L0VA 4A65A 1S3BA 2WU5A 4H2NA 2TMDA 3K7MX 4IVOB 4EMIA 4A9WA 1GNDA 3DH9A 4NTCA 1LJ1A 1E1KA 3D8XA 3H8LA 1D4DA 3REDA 2Z5XA 3ICTA 1GTEA 1H6VA 1O5WA 1RSGA 1S2QA 2F5ZA 3AE6A 1E1NA 3KU9A 1NHPA 2YLTA 5L46A 3VRDB 1PXBA 1D5TA 1PBDA 1GERA 1GRHA 5EB5A 1FOHA 2VVLA 4USRA 5IQ1A 3RP6A 4EQSA 2BXSA 1NEKA 2C3DA 3AEGA 5BULA 5GRTA 2ZZ0A 3NRNA 5C2TA 1CJ4A 2GAGB 4YSXA 3ICRA 2Q0LA 1LPFA 1PN0A 4YJHA 3ATRA 2RABA 1OJTA 1IUXA 3ALJA 2GF3A 3WGTA 2BK3A 3DJGX 4NEVA 3I6DA 4J36A 2B9XA 2WEUA 3ALLA 3HYWA 4LIIA 2XVIA 4J33A 4B64A 3SZCA 4C3YA 1PXAA 3M12A 3M0OA 3AYJA 2B9YA 2GRTA 1JNZA 1KDGA 1H86A 2V3AA 4GDPA 2BS2A 4H4YA 5JCKA 2BRYA 4YJGA 1L9CA 3AD8B 2I0ZA 3AWIA 1YQZA 3AEDA 2XCGA 4H4TA 3UP5A 5LV9A 4JNQA 4B66A 4XWZA 2VVLG 3KD9A 3QFBA 2YR6A 3LXDA 4RG3A 3CIRA 4H7UA 5TR3A 3S61A 5DBJA 4WX1A 3AE9A 3AE2A 4K5SA 4TLZA 2A87A 3FG2P 1M6IA 2WHDA 3DMEA 1QO8A 2JKCA 4H4PA 4TM3A 4ZCDA 4AOXA 1E7PA 4AP3A 1E6EA 2QCUA 3UKPA 3DJJA 3GDNA 1F8WA 1K0IA 1GRAA 2FJEA 2GQFA 2X99A 3ICSA 4IVMB 4CY6A 4DSHA 3GMCA 3GSIA 2CULA 3NT6A 3URHA 3ABVA 4JN9A 5KXJA 3DK9A 1KSUA 4YJFA 1N4VA 3QJ4A 1ZMDA 2GR0A 3UTFA 3AEFA 4AP1A 3QSMA 3BNMA 4J34A 3V3NA 3DJEA 1E1LA 2CVJA 3H8IA 1VG9A 4REKA 1C0PA 3GD4A 4U8LA 3SQPA 3SY4A 1DOEA 3ADAB 2JK6A 1JU2A 1PBCA 1VE9A 1W4XA 2B7SA 5JCLA 1F8SA 1E1MA 3UTGA 5JCIA 4RSLA 3CNJA 3RP8A 4Z24A 1DXLA 1KF6A 2BK5A 2BRAA 4Z2RA 1F6MA 1KNRA 4NZHA 2B7RA 3BHKA 2APGA 2XFQA 4B1BA 5FS7A 2E48A 1ZKQA 3BHFA 2YG3A 4H4QA 1JRXA 3WE0A 3ZYXA 1IUTA 4EQXA 3ZNPA 1AN9A 5HYMA 4X4JA 2R46A 2YR4A 4BK2A 1TRBA 2GMJA 1OJDA 3B3RA 1QLBA 2BABA 2IIDA 2OALA 5CKUA 1NDAA 1GV4A 4YSYA 1EVIA 2YVJA 3G5SA 3UKAA 1IUSA 4J57A 4TM1A 2B76A 3K7TA 4H2RA 4OPIA 1TDKA 4CY8A 3DGZA 1GT8A 3R9UA 4NWZA 2AAQA 4GDEA 4X9NA 3C96A 4MJWA 2BACA 5KWFA 2WQYA 2YLWA 2VQ7A 3O0HA 2PHHA 1ZY8A 5U1OA 2R0GA 4IA6A 3VQRA 2EQ7A 2EQ6A 1S3EA 4OVIA 1DJQA 2XLUA 5FMHA 5U63A 2WPEA 2AR8A 4H4XA 4CNJA 1PHHA 1H7WA 2Y6RA 3UP4A 4II2A 2A8XA 1DAOA 3DJDA 3NYFA 1N4WA 4NNJA 2R4JA 4DSGA 4BJZA 2BC0A 2XFUA 3L8KA 5KNLA 2NPXA 3CGEA 4YXDA 4A99A 2GAHB 3LZXA 4C5OA 3II4A 1PDHA 4FDCB 3S5WA 3VRAA 2WPCA 2YLZA 4I58A 4D03A 1CC2A 3CTYA 3AD9B 1NG3A 5KVIA 4DNAA 1VDCA 2E4AA 1REOA 1ZMCA 2R4EA 3T2ZA 4A79A 4AOSA 5KVHA 3BNUA 3T0KA 4Z2UA 2DKIA 3UOVA 4FK1C 3SX6A 3SFDA 4YJGB 2EQ9A 3KA7A 1EBDA 5IPYA 1BGNA 3AYIA 1BZLA 3KKJA 1DJNA 5C3JA 1JRYA 4YT0A 1ONFA 3NH3X 4H4VA 2WOWA 3QVRA 1MO9A 5KMQA 1GALA 3GYIA 2XLTA 3AE1A 1P2EA 1PS9A 4K22A 1NHRA 2R0CA 4EM3A 5KMRA 1H7XA 4UP3A 1FEAA 2YG7A 1UKVG 3KPFA 1VG0A 3T14A 2B9WA 4A5LA 1GETA 3NGCX 2YLSA 2WESA 2C67A 5HHFA 2C3CA 1ZDLA 2X50A 4BK3A 2XFOA 1JOAA 4O5UA 2X8GA 1PJ6A 4N9XA 3AE3A 4CCQA 4U2LA 3C4AA 3QSSA 1FECA 1CF3A 3EANA 2E49A 2Q6UA 2XVHA 3GWDA 3RHAA 2IVDA 3T2KA 3CPJG 4YJFB 4U8OA 5J60A 1BF3A 4YKGA 2C66A 1D7LA 4OPGA 1D4CA 1PXCA 1N1PA 3CPHG 1F3PA 3FPZA 2XLPA 5M10A 3KPKA 5FS9A 1Y56A 1CJ3A 3SGLA 2GVCA 3T31A 2V60A 3Q6JA 4QFDA 1GESA 1GOSA 3M13A 2V5ZA 1SEZA 4CRTA 4JY3A 4GAVA 3PS9A 3CN8A 1D7YA 4U8PA 2OA1A 1HYUA 2X8HA 1ZP0A 4H4ZA 2GR1A 3RNMA 3NHOX 2IVEA 3G5QA 4NTDA 2Z5YA 3NYEA 2C4CA 3NYCA 2JB1A 3BI4A 1B8SA 4RG4A 2DU8A 2H89A 1JRZA 1V59A 1ZOYA 3AE4A 4X9MA 3NN6X 2BYBA 2QAEA 2W0HA 2GH5A 3K7QX 4LU6A 4QFCA 1GSNA 4EIPA 2FJAA 1YKJA 3QVPA 5BRTA 1CJCA 1NHSA 2V3BA 3DA1A 4H2QA 4U2TA 3QFAA 4OCGA 2OAMA 5ER0A 4G9KA 2YG5A 4G74A 1PJ7A 4GAPA 4C74A 4KX6A 1ELIA 2BC1A 1BKWA 4Z25A 3OZ2A 3NK1X 1GRGA 1Q9IA 1MXTA 3ZNNA 5BUKA 3D1CA 1EL5A 2XYOA 1CJ2A 4NEWA 1KFYA 3NG7X 3W4KA 4YSHA 3P9UA 1BGJA 4YJDA 3NKSA 4HA6A 2YM1A 4OPUA 3V76A 2E82A 4Y4MA 4USQA 3JSKA 4K8DA 4H4WA 4NTEA 3NK0X 5KMPA 1NG4A 1K4QA 4P9SA 1DOBA 3F8PA 4AT0A 1DDOA 1L9DA 1ZK7A 1B37A 2E4GA 4K5RA 4PAAA 1BWCA 5KOWA 2BCPA 3EAOA 2C65A 1PBFA 4UDRA 2UZZA 3AYLA 4CNKA 2C64A 5EOWA 3RP7A 1GRFA 3GYXA 2PYXA 4ZN0A 5CQFA 1TDFA 2C75A 4UDQA 3K30A 1H84A 2CFYA 1H81A 5EB4A 2GR2A 3P1WA 4YJHB 3P4SA 3QSEA 2V6OA 4GF7A 3ALMA 3KVEA 1RYIA 2VOUA 3GMBA 4Z43A 4JY2A 4Z26A 2JAEA 1YQ3A 2YWLA 1GXFA 2VZ2A 2GQWA 3IWAA 5KRQA 3V3OA 1OJCA 2TPRA 1IUUA 2RGOA 1GPEA 1EL8A 2WOIA 4YSZA 1PBEA 4TLXA 3SZFA 3DGHA 2VRMA 4YWOA 2JB2A 4A6NA 1H82A 3GYJA 3IC9A 3ITJA 4I59A 1KIFA 3UKHA 1K0JA 3UKQA 4DGKA 1C0IA 4IV9A 4EIQA 3AXBA 3Q9TA 4EQRA 4K7ZA 5J7XA 1Y56B 2YM2A 5M0ZA 1N4UA 4AT2A 1TYPA 1CBOA 4XXGA 3SYIA 3P4RA 4G73A 4EMJA 2QA1A 1RP0A 2BS3A 1AOGA 3CNTA 3HYVA 3CGBA 1C0KA 3CMMA 1CC6A 2RGHA 1B4VA 3FIMB 4G6GA 1FCDA 2E5VA 1JEHA 2WDVA 2R9ZA 2XDOA 4GR1A 5HXIA 1K0LA 4BV6A 2XVFA 2GB0A 3GRSA 2H88A 1VQWA 3I3LA 3FMWA 4U8MA 1TYTA 4BJYA 2ARDA 2FBWA 2GV8A 3NIXA 5KMSA 3VRBA 3AEAA 5HY5A 1YY5A 3T37A 4APNA 4G6HA 1DNCA 3CNSA 2C7GA 3UOXA 1X31B 1O95A 1Y0PA 1Z6LA 3AE5A 4Y4NA 1DOCA 3G3EA 4YTNA 2C72A 2BK4A 2C70A 3CGDA 2WDQA 4GCMA 1TDOA 1YQ4A 3PVCA 3ZNOA 2GR3A 4H4SA 1NAAA 1OJAA 3EF6A 2X8CA 4J31A 2ZBWA 3DK8A 4ZCCA 2WP9A 3AD7B 4OPLA 3UKLA 1OJ9A 1VRQB 2J3NA 1GRTA 3IHGA 2YVFA 2YVGA 1NPXA 1H83A 3DK4A 4YKFA 2YR5A 4U2SA 3P4QA 1L9EA 1CL0A 2Y6QA 3CUKA 3CPIG 3L1RA 1P2HA 4H50A 4C77A 2BS4A 3LB8A 4K2XA 3ATQA 2YAUA 1COYA 2QA2A 2WP5A 3P4PA 2YLXA 3W4IA 1XHCA 1LVLA 2YG6A 1TDEA 2XLRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TM0 A;  3GWF A;  4YTM A;  3UTH A;  1CHU A;  2O9Z A;  1E39 A;  4O5Q A;  3UKK A;  5FS6 A;  1LTX R;  5JCM A;  3B6D A;  4FK1 A;  4Y4L A;  1FL2 A;  1D4E A;  4E0V A;  4J2W A;  4B63 A;  1IUV A;  3AE7 A;  2V61 A;  2C76 A;  3LAD A;  2GMH A;  4OPD A;  3SFE A;  3PO7 A;  2VVM A;  1XDI A;  4H4R A;  4ICY A;  3EPT A;  1NEN A;  2ACZ A;  3W4J A;  2RGJ A;  3LZW A;  1PBB A;  4B68 A;  4Z44 A;  4WCT A;  1NHQ A;  3G5R A;  2BXR A;  4TM4 A;  4U8N A;  3UCL A;  1DOD A;  3UTE A;  4JNA A;  3SM8 A;  1FEB A;  1LQU A;  2WP6 A;  2XVE A;  3NNE A;  2WU2 A;  4EM4 A;  3F8D A;  1ZX9 A;  2FJD A;  1EL7 A;  1GRE A;  4HB9 A;  3F8R A;  2R45 A;  1LV0 A;  5IQ4 A;  2EQ8 A;  1B5Q A;  2DKH A;  3NTA A;  4JDR A;  4B67 A;  2ZZC A;  1C0L A;  3NLC A;  4OPC A;  4C3X A;  1Q1R A;  1TDN A;  3AEE A;  4U8J A;  5KOX A;  4FX9 A;  1IJH A;  4B69 A;  3C4N A;  4ADW A;  3OC4 A;  2XLS A;  3AE8 A;  1ZOV A;  4CBQ A;  3GDP A;  4A6N B;  5BVA A;  3ZNQ A;  4JQ9 A;  5GSN A;  3UOZ A;  2HQM A;  4M52 A;  4GUV A;  1GEU A;  3VR9 A;  4B65 A;  2WET A;  1F8R A;  4H4U A;  4PAB A;  3NN0 X;  4A7A A;  4EMW A;  4OPT A;  3LOV A;  4YTP A;  2A89 A;  2BCG G;  3IHM A;  2Q7V A;  5U25 A;  1XPQ A;  4IA5 A;  1MOK A;  2WBA A;  3CNP A;  3FBS A;  4U8K A;  3UOY A;  3H4K A;  3BI2 A;  4EQW A;  3NTD A;  4ECH A;  1PJ5 A;  1KNP A;  2OLN A;  3COX A;  5JCN A;  2GEW A;  2XFP A;  1S2Y A;  2NVK X;  2VQB A;  1IUW A;  4H2P A;  2BA9 A;  2WDR A;  1GRB A;  2AQJ A;  4LA1 A;  3CND A;  3KLJ A;  2C73 A;  2VRL A;  5FS8 A;  2XFN A;  1GTH A;  2OLO A;  1LQT A;  2Q0K A;  4XWR A;  1Q1W A;  3GD3 A;  4D04 A;  1M64 A;  2XVJ A;  1KSS A;  2YQU A;  3VR8 A;  4BUR A;  3BI5 A;  3UKF A;  4J56 A;  2JBV A;  2YG4 A;  2YLR A;  3AB1 A;  3NK2 X;  1EL9 A;  3IF9 A;  3E1T A;  2FJB A;  2ZZB A;  4Z2T A;  4UDP A;  2X3N A;  5EBK A;  3HZL A;  1QJD A;  3ISH A;  4BK1 A;  4CCR A;  3ZDN A;  2WOV A;  4GRT A;  3CGC A;  3GRT A;  2CDU A;  1CC4 A;  1JNR A;  1O94 A;  2WS3 A;  3AEB A;  2JB3 A;  1XAN A;  2WPF A;  3LJP A;  2R0P A;  4KPR A;  4U8I A;  2E1M A;  3AEC A;  1L0V A;  4A65 A;  1S3B A;  2WU5 A;  4H2N A;  2TMD A;  3K7M X;  4IVO B;  4A9W A;  1GND A;  3DH9 A;  4NTC A;  1LJ1 A;  1E1K A;  3D8X A;  3H8L A;  1D4D A;  3RED A;  2Z5X A;  3ICT A;  1GTE A;  1H6V A;  1O5W A;  1RSG A;  1S2Q A;  2F5Z A;  3AE6 A;  1E1N A;  3KU9 A;  1NHP A;  2YLT A;  5L46 A;  3VRD B;  1PXB A;  1D5T A;  1PBD A;  1GER A;  1GRH A;  5EB5 A;  1FOH A;  2VVL A;  4USR A;  5IQ1 A;  3RP6 A;  4EQS A;  2BXS A;  1NEK A;  2C3D A;  3AEG A;  5BUL A;  5GRT A;  2ZZ0 A;  3NRN A;  5C2T A;  1CJ4 A;  2GAG B;  4YSX A;  3ICR A;  2Q0L A;  1LPF A;  1PN0 A;  4YJH A;  3ATR A;  2RAB A;  1OJT A;  1IUX A;  3ALJ A;  2GF3 A;  3WGT A;  2BK3 A;  3DJG X;  4NEV A;  3I6D A;  4J36 A;  2B9X A;  2WEU A;  3ALL A;  4LII A;  2XVI A;  4J33 A;  4B64 A;  4C3Y A;  1PXA A;  3M12 A;  3M0O A;  3AYJ A;  2B9Y A;  2GRT A;  1JNZ A;  1KDG A;  1H86 A;  2V3A A;  4GDP A;  2BS2 A;  4H4Y A;  5JCK A;  4YJG A;  1L9C A;  3AD8 B;  2I0Z A;  3AWI A;  1YQZ A;  3AED A;  2XCG A;  4H4T A;  3UP5 A;  5LV9 A;  4JNQ A;  4B66 A;  4XWZ A;  2VVL G;  3KD9 A;  3QFB A;  2YR6 A;  3LXD A;  4RG3 A;  3CIR A;  4H7U A;  5TR3 A;  3S61 A;  5DBJ A;  4WX1 A;  3AE9 A;  3AE2 A;  4K5S A;  4TLZ A;  2A87 A;  3FG2 P;  1M6I A;  2WHD A;  3DME A;  1QO8 A;  2JKC A;  4H4P A;  4TM3 A;  4ZCD A;  4AOX A;  1E7P A;  4AP3 A;  1E6E A;  2QCU A;  3UKP A;  3DJJ A;  3GDN A;  1F8W A;  1K0I A;  1GRA A;  2FJE A;  2GQF A;  2X99 A;  3ICS A;  4IVM B;  4CY6 A;  4DSH A;  3GMC A;  3GSI A;  2CUL A;  3NT6 A;  3URH A;  3ABV A;  4JN9 A;  5KXJ A;  3DK9 A;  1KSU A;  4YJF A;  1N4V A;  3QJ4 A;  1ZMD A;  2GR0 A;  3UTF A;  3AEF A;  4AP1 A;  3QSM A;  3BNM A;  4J34 A;  3V3N A;  3DJE A;  1E1L A;  2CVJ A;  3H8I A;  1VG9 A;  4REK A;  1C0P A;  3GD4 A;  4U8L A;  3SQP A;  4EMI A;  1DOE A;  3ADA B;  2JK6 A;  1JU2 A;  1PBC A;  1VE9 A;  1W4X A;  2B7S A;  5JCL A;  1F8S A;  1E1M A;  3UTG A;  5JCI A;  4RSL A;  3CNJ A;  3RP8 A;  4Z24 A;  1DXL A;  1KF6 A;  2BK5 A;  4Z2R A;  1F6M A;  1KNR A;  4NZH A;  2B7R A;  3BHK A;  2APG A;  2XFQ A;  4B1B A;  5FS7 A;  2E48 A;  1ZKQ A;  3BHF A;  2YG3 A;  4H4Q A;  1JRX A;  3WE0 A;  3ZYX A;  1IUT A;  4EQX A;  3ZNP A;  1AN9 A;  5HYM A;  4X4J A;  2R46 A;  2YR4 A;  4BK2 A;  1TRB A;  2GMJ A;  1OJD A;  3B3R A;  1QLB A;  2BAB A;  2IID A;  2OAL A;  5CKU A;  1NDA A;  1GV4 A;  4YSY A;  1EVI A;  2YVJ A;  3G5S A;  3UKA A;  1IUS A;  4J57 A;  4TM1 A;  2B76 A;  3K7T A;  4H2R A;  4OPI A;  1TDK A;  4CY8 A;  3DGZ A;  1GT8 A;  3R9U A;  2AAQ A;  4GDE A;  4X9N A;  3C96 A;  4MJW A;  2BAC A;  5KWF A;  2WQY A;  2YLW A;  2VQ7 A;  3O0H A;  2PHH A;  1ZY8 A;  5U1O A;  2R0G A;  4IA6 A;  3VQR A;  2EQ7 A;  2EQ6 A;  1S3E A;  4OVI A;  1DJQ A;  2XLU A;  5FMH A;  5U63 A;  2WPE A;  2AR8 A;  4H4X A;  4CNJ A;  1PHH A;  1H7W A;  2Y6R A;  3UP4 A;  2A8X A;  1DAO A;  3DJD A;  3NYF A;  1N4W A;  2R4J A;  4DSG A;  4BJZ A;  2BC0 A;  2XFU A;  3L8K A;  2NPX A;  3CGE A;  4YXD A;  4A99 A;  2GAH B;  3LZX A;  4C5O A;  3II4 A;  1PDH A;  4FDC B;  3S5W A;  3VRA A;  2WPC A;  2YLZ A;  4I58 A;  4D03 A;  1CC2 A;  3CTY A;  3AD9 B;  1NG3 A;  5KVI A;  4DNA A;  1VDC A;  2E4A A;  1REO A;  1ZMC A;  2R4E A;  4A79 A;  5KVH A;  4AOS A;  3BNU A;  4Z2U A;  2DKI A;  3UOV A;  4FK1 C;  3SFD A;  4YJG B;  2EQ9 A;  3KA7 A;  1EBD A;  5IPY A;  1BGN A;  3AYI A;  1BZL A;  3KKJ A;  1DJN A;  5C3J A;  1JRY A;  4YT0 A;  1ONF A;  3NH3 X;  4H4V A;  2WOW A;  3QVR A;  1MO9 A;  1GAL A;  3GYI A;  2XLT A;  3AE1 A;  1P2E A;  1PS9 A;  4K22 A;  1NHR A;  2R0C A;  4EM3 A;  1H7X A;  4UP3 A;  1FEA A;  2YG7 A;  1UKV G;  3KPF A;  1VG0 A;  2B9W A;  4A5L A;  1GET A;  3NGC X;  2YLS A;  2WES A;  2C67 A;  5HHF A;  2C3C A;  1ZDL A;  2X50 A;  4BK3 A;  2XFO A;  1JOA A;  4O5U A;  2X8G A;  1PJ6 A;  4N9X A;  3AE3 A;  4CCQ A;  4U2L A;  3C4A A;  3QSS A;  1FEC A;  1CF3 A;  3EAN A;  2E49 A;  2Q6U A;  2XVH A;  3GWD A;  3RHA A;  2IVD A;  5J60 A;  3CPJ G;  4YJF B;  4U8O A;  1BF3 A;  4YKG A;  2C66 A;  1D7L A;  4OPG A;  1D4C A;  1PXC A;  1N1P A;  3CPH G;  1F3P A;  3FPZ A;  2XLP A;  5M10 A;  5FS9 A;  1Y56 A;  1CJ3 A;  3SGL A;  2GVC A;  2V60 A;  3Q6J A;  4QFD A;  1GES A;  1GOS A;  3M13 A;  2V5Z A;  1SEZ A;  4CRT A;  4JY3 A;  3PS9 A;  3CN8 A;  1D7Y A;  4U8P A;  2OA1 A;  1HYU A;  2X8H A;  1ZP0 A;  4H4Z A;  2GR1 A;  3RNM A;  3NHO X;  2IVE A;  3G5Q A;  4NTD A;  2Z5Y A;  3NYE A;  2JB1 A;  3NYC A;  3BI4 A;  1B8S A;  4RG4 A;  2DU8 A;  2H89 A;  1JRZ A;  1V59 A;  1ZOY A;  3AE4 A;  4X9M A;  3NN6 X;  2BYB A;  2QAE A;  2W0H A;  2GH5 A;  3K7Q X;  4LU6 A;  4QFC A;  1GSN A;  4EIP A;  2FJA A;  1YKJ A;  3QVP A;  5BRT A;  1CJC A;  1NHS A;  2V3B A;  3DA1 A;  4H2Q A;  4U2T A;  3QFA A;  4OCG A;  2OAM A;  5ER0 A;  2YG5 A;  4C74 A;  1PJ7 A;  4KX6 A;  1ELI A;  2BC1 A;  1BKW A;  4Z25 A;  3OZ2 A;  3NK1 X;  1GRG A;  1Q9I A;  1MXT A;  3ZNN A;  5BUK A;  3D1C A;  1EL5 A;  2XYO A;  1CJ2 A;  4NEW A;  1KFY A;  3NG7 X;  3W4K A;  4YSH A;  3P9U A;  1BGJ A;  4YJD A;  3NKS A;  4HA6 A;  2YM1 A;  4OPU A;  3V76 A;  2E82 A;  4Y4M A;  4USQ A;  3JSK A;  4K8D A;  4H4W A;  4NTE A;  3NK0 X;  1NG4 A;  1K4Q A;  4P9S A;  1DOB A;  3F8P A;  4AT0 A;  1DDO A;  1L9D A;  1ZK7 A;  1B37 A;  2E4G A;  4K5R A;  4PAA A;  1BWC A;  5KOW A;  2BCP A;  3EAO A;  2C65 A;  1PBF A;  4UDR A;  2UZZ A;  3AYL A;  4CNK A;  2C64 A;  5EOW A;  3RP7 A;  1GRF A;  2PYX A;  4ZN0 A;  5CQF A;  1TDF A;  2C75 A;  4UDQ A;  3K30 A;  1H84 A;  2CFY A;  1H81 A;  5EB4 A;  2GR2 A;  3P1W A;  4YJH B;  3P4S A;  3QSE A;  2V6O A;  4GF7 A;  3ALM A;  3KVE A;  1RYI A;  2VOU A;  3GMB A;  4Z43 A;  4JY2 A;  4Z26 A;  2JAE A;  1YQ3 A;  2YWL A;  1GXF A;  2VZ2 A;  2GQW A;  3IWA A;  5KRQ A;  3V3O A;  1OJC A;  2TPR A;  1IUU A;  2RGO A;  1GPE A;  1EL8 A;  2WOI A;  4YSZ A;  1PBE A;  4TLX A;  3DGH A;  2VRM A;  4YWO A;  2JB2 A;  4A6N A;  1H82 A;  3GYJ A;  3IC9 A;  3ITJ A;  4I59 A;  1KIF A;  3UKH A;  1K0J A;  3UKQ A;  4DGK A;  1C0I A;  4IV9 A;  4EIQ A;  3AXB A;  3Q9T A;  4EQR A;  4K7Z A;  5J7X A;  1Y56 B;  2YM2 A;  5M0Z A;  1N4U A;  4AT2 A;  1TYP A;  1CBO A;  4XXG A;  3P4R A;  4EMJ A;  2QA1 A;  1RP0 A;  2BS3 A;  1AOG A;  3CNT A;  3CGB A;  1C0K A;  1CC6 A;  2RGH A;  1B4V A;  3FIM B;  1FCD A;  2E5V A;  1JEH A;  2WDV A;  2R9Z A;  2XDO A;  4GR1 A;  5HXI A;  1K0L A;  4BV6 A;  2XVF A;  2GB0 A;  3GRS A;  2H88 A;  1VQW A;  3I3L A;  3FMW A;  4U8M A;  1TYT A;  4BJY A;  2ARD A;  2FBW A;  2GV8 A;  3NIX A;  3VRB A;  3AEA A;  5HY5 A;  1YY5 A;  3T37 A;  4APN A;  1DNC A;  3CNS A;  2C7G A;  3UOX A;  1X31 B;  1O95 A;  1Y0P A;  1Z6L A;  3AE5 A;  4Y4N A;  1DOC A;  3G3E A;  4YTN A;  2C72 A;  2BK4 A;  2C70 A;  3CGD A;  2WDQ A;  4GCM A;  1TDO A;  1YQ4 A;  3PVC A;  3ZNO A;  2GR3 A;  4H4S A;  1NAA A;  1OJA A;  3EF6 A;  2X8C A;  4J31 A;  2ZBW A;  3DK8 A;  4ZCC A;  2WP9 A;  3AD7 B;  4OPL A;  3UKL A;  1OJ9 A;  1VRQ B;  2J3N A;  1GRT A;  3IHG A;  2YVF A;  2YVG A;  1NPX A;  1H83 A;  3DK4 A;  4YKF A;  2YR5 A;  4U2S A;  3P4Q A;  1L9E A;  1CL0 A;  2Y6Q A;  3CUK A;  3CPI G;  3L1R A;  1P2H A;  4H50 A;  4C77 A;  2BS4 A;  3LB8 A;  4K2X A;  3ATQ A;  2YAU A;  1COY A;  2QA2 A;  2WP5 A;  3P4P A;  2YLX A;  3W4I A;  1XHC A;  1LVL A;  2YG6 A;  1TDE A;  2XLR A; 
#chains in the Genus database with same CATH topology
 4TM0 A;  3GWF A;  4YTM A;  3UTH A;  3SZ0 A;  1CHU A;  2O9Z A;  1E39 A;  4O5Q A;  3UKK A;  5FS6 A;  1LTX R;  5JCM A;  3SXI A;  3B6D A;  4FK1 A;  4Y4L A;  1FL2 A;  1D4E A;  4E0V A;  4J2W A;  4B63 A;  1IUV A;  3AE7 A;  2V61 A;  2C76 A;  3LAD A;  2GMH A;  4OPD A;  3SFE A;  3PO7 A;  2VVM A;  1XDI A;  4H4R A;  4ICY A;  3EPT A;  2RGJ A;  1NEN A;  3W4J A;  2ACZ A;  3LZW A;  1PBB A;  4B68 A;  4Z44 A;  4WCT A;  1NHQ A;  3G5R A;  2BXR A;  4TM4 A;  4U8N A;  3UCL A;  1DOD A;  3UTE A;  4JNA A;  3SM8 A;  1FEB A;  1LQU A;  2WP6 A;  2XVE A;  3NNE A;  2WU2 A;  4EM4 A;  3F8D A;  1ZX9 A;  2FJD A;  1EL7 A;  1GRE A;  4HB9 A;  3F8R A;  2R45 A;  1LV0 A;  5IQ4 A;  2EQ8 A;  2DKH A;  1B5Q A;  3NTA A;  4JDR A;  4B67 A;  2ZZC A;  1C0L A;  3NLC A;  4OPC A;  4C3X A;  1Q1R A;  1TDN A;  3AEE A;  4U8J A;  5KOX A;  4FX9 A;  1IJH A;  4B69 A;  3C4N A;  4ADW A;  3OC4 A;  2XLS A;  3AE8 A;  1ZOV A;  4CBQ A;  3GDP A;  4A6N B;  5BVA A;  3ZNQ A;  4JQ9 A;  5GSN A;  3UOZ A;  2HQM A;  4M52 A;  4GUV A;  1GEU A;  3VR9 A;  4B65 A;  2WET A;  1F8R A;  4H4U A;  4PAB A;  3NN0 X;  4A7A A;  4EMW A;  4OPT A;  3LOV A;  4II3 A;  4YTP A;  2A89 A;  2BCG G;  3IHM A;  2Q7V A;  5U25 A;  1XPQ A;  3T2Y A;  4IA5 A;  1MOK A;  2WBA A;  3CNP A;  3FBS A;  4U8K A;  3UOY A;  3H4K A;  3BI2 A;  4EQW A;  3NTD A;  4ECH A;  1PJ5 A;  1KNP A;  2OLN A;  3COX A;  5JCN A;  2GEW A;  2XFP A;  1S2Y A;  2NVK X;  2VQB A;  1IUW A;  4H2P A;  2BA9 A;  2WDR A;  1GRB A;  2AQJ A;  4LA1 A;  3CND A;  3KLJ A;  2C73 A;  2VRL A;  5FS8 A;  2XFN A;  1GTH A;  2OLO A;  1LQT A;  2Q0K A;  4XWR A;  1Q1W A;  3GD3 A;  4D04 A;  1M64 A;  2XVJ A;  1KSS A;  2YQU A;  3HYX A;  3VR8 A;  4BUR A;  3BI5 A;  3UKF A;  4J56 A;  2JBV A;  2YG4 A;  2YLR A;  3AB1 A;  3NK2 X;  1EL9 A;  3IF9 A;  3E1T A;  3SZW A;  2FJB A;  2ZZB A;  4Z2T A;  4UDP A;  2X3N A;  5EBK A;  3HZL A;  4BK1 A;  1QJD A;  3ISH A;  4CCR A;  3ZDN A;  2WOV A;  4GRT A;  3CGC A;  3GRT A;  2CDU A;  1CC4 A;  1JNR A;  1O94 A;  2WS3 A;  3AEB A;  2JB3 A;  1XAN A;  2WPF A;  3LJP A;  2R0P A;  4KPR A;  4U8I A;  2E1M A;  3AEC A;  1L0V A;  4A65 A;  1S3B A;  2WU5 A;  4H2N A;  2TMD A;  3K7M X;  4IVO B;  4EMI A;  4A9W A;  1GND A;  3DH9 A;  4NTC A;  1LJ1 A;  1E1K A;  3D8X A;  3H8L A;  1D4D A;  3RED A;  2Z5X A;  3ICT A;  1GTE A;  1H6V A;  1O5W A;  1RSG A;  1S2Q A;  2F5Z A;  3AE6 A;  1E1N A;  3KU9 A;  1NHP A;  2YLT A;  5L46 A;  3VRD B;  1PXB A;  1D5T A;  1PBD A;  1GER A;  1GRH A;  5EB5 A;  1FOH A;  2VVL A;  4USR A;  3RP6 A;  5IQ1 A;  4EQS A;  2BXS A;  1NEK A;  2C3D A;  3AEG A;  5BUL A;  5GRT A;  2ZZ0 A;  3NRN A;  5C2T A;  1CJ4 A;  2GAG B;  4YSX A;  3ICR A;  2Q0L A;  1LPF A;  1PN0 A;  4YJH A;  3ATR A;  2RAB A;  1OJT A;  1IUX A;  3ALJ A;  2GF3 A;  3WGT A;  2BK3 A;  3DJG X;  4NEV A;  3I6D A;  4J36 A;  3ALL A;  2B9X A;  2WEU A;  3HYW A;  4LII A;  2XVI A;  4J33 A;  4B64 A;  3SZC A;  4C3Y A;  1PXA A;  3M12 A;  3M0O A;  3AYJ A;  2B9Y A;  2GRT A;  1JNZ A;  1KDG A;  1H86 A;  2V3A A;  4GDP A;  2BS2 A;  4H4Y A;  5JCK A;  2BRY A;  4YJG A;  1L9C A;  3AD8 B;  2I0Z A;  3AWI A;  1YQZ A;  3AED A;  2XCG A;  4H4T A;  3UP5 A;  5LV9 A;  4JNQ A;  4B66 A;  4XWZ A;  2VVL G;  3KD9 A;  3QFB A;  2YR6 A;  3LXD A;  4RG3 A;  3CIR A;  4H7U A;  5TR3 A;  3S61 A;  5DBJ A;  4WX1 A;  3AE9 A;  3AE2 A;  4K5S A;  4TLZ A;  2A87 A;  3FG2 P;  1M6I A;  2WHD A;  3DME A;  1QO8 A;  2JKC A;  4H4P A;  4TM3 A;  4ZCD A;  4AOX A;  1E7P A;  4AP3 A;  1E6E A;  2QCU A;  3UKP A;  3DJJ A;  3GDN A;  1F8W A;  1K0I A;  1GRA A;  2FJE A;  2GQF A;  2X99 A;  3ICS A;  4IVM B;  4CY6 A;  4DSH A;  3GMC A;  3GSI A;  2CUL A;  3NT6 A;  3URH A;  3ABV A;  4JN9 A;  5KXJ A;  3DK9 A;  1KSU A;  4YJF A;  1N4V A;  3QJ4 A;  1ZMD A;  2GR0 A;  3UTF A;  3AEF A;  4AP1 A;  3QSM A;  3BNM A;  4J34 A;  3V3N A;  3DJE A;  1E1L A;  2CVJ A;  3H8I A;  1VG9 A;  4REK A;  1C0P A;  3GD4 A;  4U8L A;  3SQP A;  3SY4 A;  1DOE A;  3ADA B;  2JK6 A;  1JU2 A;  1PBC A;  1VE9 A;  1W4X A;  2B7S A;  5JCL A;  1F8S A;  1E1M A;  3UTG A;  5JCI A;  4RSL A;  3CNJ A;  3RP8 A;  4Z24 A;  1DXL A;  1KF6 A;  2BK5 A;  2BRA A;  4Z2R A;  1F6M A;  1KNR A;  4NZH A;  2B7R A;  3BHK A;  2APG A;  2XFQ A;  4B1B A;  5FS7 A;  2E48 A;  1ZKQ A;  3BHF A;  2YG3 A;  4H4Q A;  1JRX A;  3WE0 A;  3ZYX A;  1IUT A;  4EQX A;  3ZNP A;  1AN9 A;  5HYM A;  4X4J A;  2R46 A;  2YR4 A;  4BK2 A;  1TRB A;  2GMJ A;  1OJD A;  3B3R A;  1QLB A;  2BAB A;  2IID A;  2OAL A;  5CKU A;  1NDA A;  1GV4 A;  4YSY A;  1EVI A;  2YVJ A;  3G5S A;  3UKA A;  1IUS A;  4J57 A;  4TM1 A;  4H2R A;  2B76 A;  3K7T A;  4OPI A;  1TDK A;  4CY8 A;  3DGZ A;  1GT8 A;  3R9U A;  4NWZ A;  2AAQ A;  4GDE A;  4X9N A;  3C96 A;  4MJW A;  2BAC A;  5KWF A;  2WQY A;  2YLW A;  2VQ7 A;  3O0H A;  2PHH A;  1ZY8 A;  5U1O A;  2R0G A;  4IA6 A;  3VQR A;  2EQ7 A;  2EQ6 A;  1S3E A;  4OVI A;  1DJQ A;  2XLU A;  5FMH A;  5U63 A;  2WPE A;  2AR8 A;  4H4X A;  4CNJ A;  1PHH A;  1H7W A;  2Y6R A;  3UP4 A;  4II2 A;  2A8X A;  1DAO A;  3DJD A;  3NYF A;  1N4W A;  4NNJ A;  2R4J A;  4DSG A;  4BJZ A;  2BC0 A;  2XFU A;  3L8K A;  5KNL A;  2NPX A;  3CGE A;  4YXD A;  4A99 A;  2GAH B;  3LZX A;  4C5O A;  3II4 A;  1PDH A;  4FDC B;  3S5W A;  3VRA A;  2WPC A;  2YLZ A;  4I58 A;  4D03 A;  1CC2 A;  3CTY A;  3AD9 B;  1NG3 A;  5KVI A;  4DNA A;  1VDC A;  2E4A A;  1REO A;  1ZMC A;  2R4E A;  3T2Z A;  4A79 A;  4AOS A;  5KVH A;  3BNU A;  3T0K A;  4Z2U A;  2DKI A;  3UOV A;  4FK1 C;  3SX6 A;  3SFD A;  4YJG B;  2EQ9 A;  3KA7 A;  1EBD A;  5IPY A;  1BGN A;  3AYI A;  1BZL A;  3KKJ A;  1DJN A;  5C3J A;  1JRY A;  4YT0 A;  1ONF A;  3NH3 X;  4H4V A;  2WOW A;  3QVR A;  1MO9 A;  5KMQ A;  1GAL A;  3GYI A;  2XLT A;  3AE1 A;  1P2E A;  1PS9 A;  4K22 A;  2R0C A;  1NHR A;  4EM3 A;  5KMR A;  1H7X A;  4UP3 A;  1FEA A;  2YG7 A;  1UKV G;  3KPF A;  1VG0 A;  3T14 A;  2B9W A;  4A5L A;  1GET A;  3NGC X;  2YLS A;  2WES A;  2C67 A;  5HHF A;  2C3C A;  1ZDL A;  2X50 A;  4BK3 A;  2XFO A;  1JOA A;  4O5U A;  2X8G A;  1PJ6 A;  4N9X A;  3AE3 A;  4CCQ A;  4U2L A;  3C4A A;  1FEC A;  3QSS A;  1CF3 A;  3EAN A;  2E49 A;  2Q6U A;  2XVH A;  3GWD A;  3RHA A;  2IVD A;  3T2K A;  3CPJ G;  4YJF B;  4U8O A;  5J60 A;  1BF3 A;  4YKG A;  2C66 A;  1D7L A;  4OPG A;  1D4C A;  1PXC A;  1N1P A;  3CPH G;  1F3P A;  3FPZ A;  2XLP A;  5M10 A;  3KPK A;  5FS9 A;  1Y56 A;  1CJ3 A;  3SGL A;  2GVC A;  3T31 A;  2V60 A;  3Q6J A;  4QFD A;  1GES A;  1GOS A;  3M13 A;  2V5Z A;  1SEZ A;  4CRT A;  4JY3 A;  4GAV A;  3PS9 A;  3CN8 A;  1D7Y A;  4U8P A;  2OA1 A;  1HYU A;  2X8H A;  1ZP0 A;  4H4Z A;  2GR1 A;  3RNM A;  3NHO X;  2IVE A;  3G5Q A;  4NTD A;  2Z5Y A;  3NYE A;  2C4C A;  3NYC A;  2JB1 A;  3BI4 A;  1B8S A;  4RG4 A;  2DU8 A;  2H89 A;  1JRZ A;  1V59 A;  1ZOY A;  3AE4 A;  4X9M A;  3NN6 X;  2BYB A;  2QAE A;  2W0H A;  2GH5 A;  3K7Q X;  4LU6 A;  4QFC A;  4EIP A;  1GSN A;  2FJA A;  1YKJ A;  3QVP A;  5BRT A;  1CJC A;  1NHS A;  2V3B A;  3DA1 A;  4H2Q A;  4U2T A;  3QFA A;  4OCG A;  2OAM A;  5ER0 A;  4G9K A;  2YG5 A;  4G74 A;  1PJ7 A;  4GAP A;  4C74 A;  4KX6 A;  1ELI A;  2BC1 A;  1BKW A;  4Z25 A;  3OZ2 A;  3NK1 X;  1GRG A;  1Q9I A;  1MXT A;  3ZNN A;  5BUK A;  3D1C A;  1EL5 A;  2XYO A;  1CJ2 A;  4NEW A;  1KFY A;  3NG7 X;  3W4K A;  4YSH A;  3P9U A;  1BGJ A;  4YJD A;  3NKS A;  4HA6 A;  2YM1 A;  4OPU A;  3V76 A;  2E82 A;  4Y4M A;  4USQ A;  3JSK A;  4K8D A;  4H4W A;  4NTE A;  3NK0 X;  5KMP A;  1NG4 A;  1K4Q A;  4P9S A;  1DOB A;  3F8P A;  4AT0 A;  1DDO A;  1L9D A;  1ZK7 A;  1B37 A;  2E4G A;  4K5R A;  4PAA A;  1BWC A;  5KOW A;  2BCP A;  3EAO A;  2C65 A;  1PBF A;  4UDR A;  2UZZ A;  3AYL A;  4CNK A;  2C64 A;  5EOW A;  3RP7 A;  1GRF A;  3GYX A;  2PYX A;  4ZN0 A;  5CQF A;  1TDF A;  2C75 A;  4UDQ A;  3K30 A;  1H84 A;  2CFY A;  1H81 A;  5EB4 A;  2GR2 A;  3P1W A;  4YJH B;  3P4S A;  3QSE A;  2V6O A;  4GF7 A;  3ALM A;  3KVE A;  1RYI A;  2VOU A;  3GMB A;  4Z43 A;  4JY2 A;  4Z26 A;  2JAE A;  1YQ3 A;  2YWL A;  1GXF A;  2VZ2 A;  2GQW A;  3IWA A;  5KRQ A;  3V3O A;  1OJC A;  2TPR A;  1IUU A;  2RGO A;  1GPE A;  1EL8 A;  2WOI A;  4YSZ A;  1PBE A;  4TLX A;  3SZF A;  3DGH A;  2VRM A;  4YWO A;  2JB2 A;  4A6N A;  1H82 A;  3GYJ A;  3IC9 A;  3ITJ A;  4I59 A;  1KIF A;  3UKH A;  1K0J A;  3UKQ A;  4DGK A;  1C0I A;  4EIQ A;  4IV9 A;  3AXB A;  3Q9T A;  4EQR A;  4K7Z A;  5J7X A;  1Y56 B;  2YM2 A;  5M0Z A;  1N4U A;  4AT2 A;  1TYP A;  1CBO A;  4XXG A;  3SYI A;  3P4R A;  4G73 A;  4EMJ A;  2QA1 A;  1RP0 A;  2BS3 A;  1AOG A;  3CNT A;  3HYV A;  3CGB A;  1C0K A;  3CMM A;  1CC6 A;  2RGH A;  1B4V A;  3FIM B;  4G6G A;  1FCD A;  2E5V A;  1JEH A;  2WDV A;  2R9Z A;  2XDO A;  4GR1 A;  5HXI A;  1K0L A;  4BV6 A;  2XVF A;  2GB0 A;  3GRS A;  2H88 A;  1VQW A;  3I3L A;  3FMW A;  4U8M A;  1TYT A;  4BJY A;  2ARD A;  2FBW A;  2GV8 A;  3NIX A;  5KMS A;  3VRB A;  3AEA A;  5HY5 A;  1YY5 A;  3T37 A;  4APN A;  4G6H A;  1DNC A;  3CNS A;  2C7G A;  3UOX A;  1X31 B;  1O95 A;  1Y0P A;  1Z6L A;  3AE5 A;  4Y4N A;  1DOC A;  3G3E A;  4YTN A;  2C72 A;  2BK4 A;  2C70 A;  3CGD A;  2WDQ A;  4GCM A;  1TDO A;  1YQ4 A;  3PVC A;  3ZNO A;  2GR3 A;  4H4S A;  1NAA A;  1OJA A;  3EF6 A;  2X8C A;  4J31 A;  2ZBW A;  3DK8 A;  4ZCC A;  2WP9 A;  3AD7 B;  4OPL A;  3UKL A;  1OJ9 A;  1VRQ B;  2J3N A;  3IHG A;  1GRT A;  2YVF A;  2YVG A;  1NPX A;  1H83 A;  3DK4 A;  4YKF A;  2YR5 A;  4U2S A;  3P4Q A;  1L9E A;  1CL0 A;  2Y6Q A;  3CUK A;  3CPI G;  3L1R A;  1P2H A;  4H50 A;  4C77 A;  2BS4 A;  3LB8 A;  4K2X A;  3ATQ A;  2YAU A;  1COY A;  2QA2 A;  2WP5 A;  3P4P A;  2YLX A;  3W4I A;  1XHC A;  1LVL A;  2YG6 A;  1TDE A;  2XLR A; 
#chains in the Genus database with same CATH homology
 4TM0 A;  3GWF A;  4YTM A;  3UTH A;  3SZ0 A;  1CHU A;  2O9Z A;  1E39 A;  4O5Q A;  3UKK A;  5FS6 A;  1LTX R;  5JCM A;  3SXI A;  3B6D A;  4FK1 A;  4Y4L A;  1FL2 A;  1D4E A;  4E0V A;  4J2W A;  4B63 A;  1IUV A;  3AE7 A;  2V61 A;  2C76 A;  3LAD A;  2GMH A;  4OPD A;  3SFE A;  3PO7 A;  2VVM A;  1XDI A;  4H4R A;  4ICY A;  3EPT A;  1NEN A;  2ACZ A;  3W4J A;  2RGJ A;  3LZW A;  1PBB A;  4B68 A;  4Z44 A;  4WCT A;  1NHQ A;  3G5R A;  2BXR A;  4TM4 A;  4U8N A;  3UCL A;  1DOD A;  3UTE A;  4JNA A;  3SM8 A;  1FEB A;  1LQU A;  2WP6 A;  2XVE A;  3NNE A;  2WU2 A;  4EM4 A;  3F8D A;  1ZX9 A;  2FJD A;  1EL7 A;  1GRE A;  4HB9 A;  3F8R A;  2R45 A;  1LV0 A;  5IQ4 A;  2EQ8 A;  1B5Q A;  2DKH A;  3NTA A;  4JDR A;  4B67 A;  2ZZC A;  1C0L A;  3NLC A;  4OPC A;  4C3X A;  1Q1R A;  1TDN A;  3AEE A;  4U8J A;  5KOX A;  4FX9 A;  1IJH A;  4B69 A;  3C4N A;  4ADW A;  3OC4 A;  2XLS A;  3AE8 A;  1ZOV A;  4CBQ A;  3GDP A;  4A6N B;  5BVA A;  3ZNQ A;  4JQ9 A;  5GSN A;  3UOZ A;  2HQM A;  4M52 A;  4GUV A;  1GEU A;  3VR9 A;  4B65 A;  2WET A;  1F8R A;  4H4U A;  4PAB A;  3NN0 X;  4A7A A;  4EMW A;  4OPT A;  3LOV A;  4II3 A;  4YTP A;  2A89 A;  2BCG G;  3IHM A;  2Q7V A;  5U25 A;  1XPQ A;  3T2Y A;  4IA5 A;  1MOK A;  2WBA A;  3CNP A;  3FBS A;  4U8K A;  3UOY A;  3H4K A;  3BI2 A;  4EQW A;  3NTD A;  4ECH A;  1PJ5 A;  1KNP A;  2OLN A;  3COX A;  5JCN A;  2GEW A;  2XFP A;  1S2Y A;  2NVK X;  2VQB A;  1IUW A;  4H2P A;  2BA9 A;  2WDR A;  1GRB A;  2AQJ A;  4LA1 A;  3CND A;  3KLJ A;  2C73 A;  2VRL A;  5FS8 A;  2XFN A;  1GTH A;  2OLO A;  1LQT A;  2Q0K A;  4XWR A;  1Q1W A;  3GD3 A;  4D04 A;  1M64 A;  2XVJ A;  1KSS A;  2YQU A;  3HYX A;  3VR8 A;  4BUR A;  3BI5 A;  3UKF A;  4J56 A;  2JBV A;  2YG4 A;  2YLR A;  3AB1 A;  3NK2 X;  1EL9 A;  3IF9 A;  3E1T A;  3SZW A;  2FJB A;  2ZZB A;  4Z2T A;  4UDP A;  2X3N A;  5EBK A;  3HZL A;  1QJD A;  3ISH A;  4BK1 A;  4CCR A;  3ZDN A;  2WOV A;  4GRT A;  3CGC A;  3GRT A;  2CDU A;  1CC4 A;  1JNR A;  1O94 A;  2WS3 A;  3AEB A;  2JB3 A;  1XAN A;  2WPF A;  3LJP A;  2R0P A;  4KPR A;  4U8I A;  2E1M A;  3AEC A;  1L0V A;  4A65 A;  1S3B A;  2WU5 A;  4H2N A;  2TMD A;  3K7M X;  4IVO B;  4EMI A;  4A9W A;  1GND A;  3DH9 A;  4NTC A;  1LJ1 A;  1E1K A;  3D8X A;  3H8L A;  1D4D A;  3RED A;  2Z5X A;  3ICT A;  1GTE A;  1H6V A;  1O5W A;  1RSG A;  1S2Q A;  2F5Z A;  3AE6 A;  1E1N A;  3KU9 A;  1NHP A;  2YLT A;  5L46 A;  3VRD B;  1PXB A;  1D5T A;  1PBD A;  1GER A;  1GRH A;  5EB5 A;  1FOH A;  2VVL A;  4USR A;  5IQ1 A;  3RP6 A;  4EQS A;  2BXS A;  1NEK A;  2C3D A;  3AEG A;  5BUL A;  5GRT A;  2ZZ0 A;  3NRN A;  5C2T A;  1CJ4 A;  2GAG B;  4YSX A;  3ICR A;  2Q0L A;  1LPF A;  1PN0 A;  4YJH A;  3ATR A;  2RAB A;  1OJT A;  1IUX A;  3ALJ A;  2GF3 A;  3WGT A;  2BK3 A;  3DJG X;  4NEV A;  3I6D A;  4J36 A;  2B9X A;  2WEU A;  3ALL A;  3HYW A;  4LII A;  2XVI A;  4J33 A;  4B64 A;  3SZC A;  4C3Y A;  1PXA A;  3M12 A;  3M0O A;  3AYJ A;  2B9Y A;  2GRT A;  1JNZ A;  1KDG A;  1H86 A;  2V3A A;  4GDP A;  2BS2 A;  4H4Y A;  5JCK A;  2BRY A;  4YJG A;  1L9C A;  3AD8 B;  2I0Z A;  3AWI A;  1YQZ A;  3AED A;  2XCG A;  4H4T A;  3UP5 A;  5LV9 A;  4JNQ A;  4B66 A;  4XWZ A;  2VVL G;  3KD9 A;  3QFB A;  2YR6 A;  3LXD A;  4RG3 A;  3CIR A;  4H7U A;  5TR3 A;  3S61 A;  5DBJ A;  4WX1 A;  3AE9 A;  3AE2 A;  4K5S A;  4TLZ A;  2A87 A;  3FG2 P;  1M6I A;  2WHD A;  3DME A;  1QO8 A;  2JKC A;  4H4P A;  4TM3 A;  4ZCD A;  4AOX A;  1E7P A;  4AP3 A;  1E6E A;  2QCU A;  3UKP A;  3DJJ A;  3GDN A;  1F8W A;  1K0I A;  1GRA A;  2FJE A;  2GQF A;  2X99 A;  3ICS A;  4IVM B;  4CY6 A;  4DSH A;  3GMC A;  3GSI A;  2CUL A;  3NT6 A;  3URH A;  3ABV A;  4JN9 A;  5KXJ A;  3DK9 A;  1KSU A;  4YJF A;  1N4V A;  3QJ4 A;  1ZMD A;  2GR0 A;  3UTF A;  3AEF A;  4AP1 A;  3QSM A;  3BNM A;  4J34 A;  3V3N A;  3DJE A;  1E1L A;  2CVJ A;  3H8I A;  1VG9 A;  4REK A;  1C0P A;  3GD4 A;  4U8L A;  3SQP A;  3SY4 A;  1DOE A;  3ADA B;  2JK6 A;  1JU2 A;  1PBC A;  1VE9 A;  1W4X A;  2B7S A;  5JCL A;  1F8S A;  1E1M A;  3UTG A;  5JCI A;  4RSL A;  3CNJ A;  3RP8 A;  4Z24 A;  1DXL A;  1KF6 A;  2BK5 A;  2BRA A;  4Z2R A;  1F6M A;  1KNR A;  4NZH A;  2B7R A;  3BHK A;  2APG A;  2XFQ A;  4B1B A;  5FS7 A;  2E48 A;  1ZKQ A;  3BHF A;  2YG3 A;  4H4Q A;  1JRX A;  3WE0 A;  3ZYX A;  1IUT A;  4EQX A;  3ZNP A;  1AN9 A;  5HYM A;  4X4J A;  2R46 A;  2YR4 A;  4BK2 A;  1TRB A;  2GMJ A;  1OJD A;  3B3R A;  1QLB A;  2BAB A;  2IID A;  2OAL A;  5CKU A;  1NDA A;  1GV4 A;  4YSY A;  1EVI A;  2YVJ A;  3G5S A;  3UKA A;  1IUS A;  4J57 A;  4TM1 A;  2B76 A;  3K7T A;  4H2R A;  4OPI A;  1TDK A;  4CY8 A;  3DGZ A;  1GT8 A;  3R9U A;  4NWZ A;  2AAQ A;  4GDE A;  4X9N A;  3C96 A;  4MJW A;  2BAC A;  5KWF A;  2WQY A;  2YLW A;  2VQ7 A;  3O0H A;  2PHH A;  1ZY8 A;  5U1O A;  2R0G A;  4IA6 A;  3VQR A;  2EQ7 A;  2EQ6 A;  1S3E A;  4OVI A;  1DJQ A;  2XLU A;  5FMH A;  5U63 A;  2WPE A;  2AR8 A;  4H4X A;  4CNJ A;  1PHH A;  1H7W A;  2Y6R A;  3UP4 A;  4II2 A;  2A8X A;  1DAO A;  3DJD A;  3NYF A;  1N4W A;  4NNJ A;  2R4J A;  4DSG A;  4BJZ A;  2BC0 A;  2XFU A;  3L8K A;  5KNL A;  2NPX A;  3CGE A;  4YXD A;  4A99 A;  2GAH B;  3LZX A;  4C5O A;  3II4 A;  1PDH A;  4FDC B;  3S5W A;  3VRA A;  2WPC A;  2YLZ A;  4I58 A;  4D03 A;  1CC2 A;  3CTY A;  3AD9 B;  1NG3 A;  5KVI A;  4DNA A;  1VDC A;  2E4A A;  1REO A;  1ZMC A;  2R4E A;  3T2Z A;  4A79 A;  4AOS A;  5KVH A;  3BNU A;  3T0K A;  4Z2U A;  2DKI A;  3UOV A;  4FK1 C;  3SX6 A;  3SFD A;  4YJG B;  2EQ9 A;  3KA7 A;  1EBD A;  5IPY A;  1BGN A;  3AYI A;  1BZL A;  3KKJ A;  1DJN A;  5C3J A;  1JRY A;  4YT0 A;  1ONF A;  3NH3 X;  4H4V A;  2WOW A;  3QVR A;  1MO9 A;  5KMQ A;  1GAL A;  3GYI A;  2XLT A;  3AE1 A;  1P2E A;  1PS9 A;  4K22 A;  1NHR A;  2R0C A;  4EM3 A;  5KMR A;  1H7X A;  4UP3 A;  1FEA A;  2YG7 A;  1UKV G;  3KPF A;  1VG0 A;  3T14 A;  2B9W A;  4A5L A;  1GET A;  3NGC X;  2YLS A;  2WES A;  2C67 A;  5HHF A;  2C3C A;  1ZDL A;  2X50 A;  4BK3 A;  2XFO A;  1JOA A;  4O5U A;  2X8G A;  1PJ6 A;  4N9X A;  3AE3 A;  4CCQ A;  4U2L A;  3C4A A;  3QSS A;  1FEC A;  1CF3 A;  3EAN A;  2E49 A;  2Q6U A;  2XVH A;  3GWD A;  3RHA A;  2IVD A;  3T2K A;  3CPJ G;  4YJF B;  4U8O A;  5J60 A;  1BF3 A;  4YKG A;  2C66 A;  1D7L A;  4OPG A;  1D4C A;  1PXC A;  1N1P A;  3CPH G;  1F3P A;  3FPZ A;  2XLP A;  5M10 A;  3KPK A;  5FS9 A;  1Y56 A;  1CJ3 A;  3SGL A;  2GVC A;  3T31 A;  2V60 A;  3Q6J A;  4QFD A;  1GES A;  1GOS A;  3M13 A;  2V5Z A;  1SEZ A;  4CRT A;  4JY3 A;  4GAV A;  3PS9 A;  3CN8 A;  1D7Y A;  4U8P A;  2OA1 A;  1HYU A;  2X8H A;  1ZP0 A;  4H4Z A;  2GR1 A;  3RNM A;  3NHO X;  2IVE A;  3G5Q A;  4NTD A;  2Z5Y A;  3NYE A;  2C4C A;  3NYC A;  2JB1 A;  3BI4 A;  1B8S A;  4RG4 A;  2DU8 A;  2H89 A;  1JRZ A;  1V59 A;  1ZOY A;  3AE4 A;  4X9M A;  3NN6 X;  2BYB A;  2QAE A;  2W0H A;  2GH5 A;  3K7Q X;  4LU6 A;  4QFC A;  1GSN A;  4EIP A;  2FJA A;  1YKJ A;  3QVP A;  5BRT A;  1CJC A;  1NHS A;  2V3B A;  3DA1 A;  4H2Q A;  4U2T A;  3QFA A;  4OCG A;  2OAM A;  5ER0 A;  4G9K A;  2YG5 A;  4G74 A;  1PJ7 A;  4GAP A;  4C74 A;  4KX6 A;  1ELI A;  2BC1 A;  1BKW A;  4Z25 A;  3OZ2 A;  3NK1 X;  1GRG A;  1Q9I A;  1MXT A;  3ZNN A;  5BUK A;  3D1C A;  1EL5 A;  2XYO A;  1CJ2 A;  4NEW A;  1KFY A;  3NG7 X;  3W4K A;  4YSH A;  3P9U A;  1BGJ A;  4YJD A;  3NKS A;  4HA6 A;  2YM1 A;  4OPU A;  3V76 A;  2E82 A;  4Y4M A;  4USQ A;  3JSK A;  4K8D A;  4H4W A;  4NTE A;  3NK0 X;  5KMP A;  1NG4 A;  1K4Q A;  4P9S A;  1DOB A;  3F8P A;  4AT0 A;  1DDO A;  1L9D A;  1ZK7 A;  1B37 A;  2E4G A;  4K5R A;  4PAA A;  1BWC A;  5KOW A;  2BCP A;  3EAO A;  2C65 A;  1PBF A;  4UDR A;  2UZZ A;  3AYL A;  4CNK A;  2C64 A;  5EOW A;  3RP7 A;  1GRF A;  3GYX A;  2PYX A;  4ZN0 A;  5CQF A;  1TDF A;  2C75 A;  4UDQ A;  3K30 A;  1H84 A;  2CFY A;  1H81 A;  5EB4 A;  2GR2 A;  3P1W A;  4YJH B;  3P4S A;  3QSE A;  2V6O A;  4GF7 A;  3ALM A;  3KVE A;  1RYI A;  2VOU A;  3GMB A;  4Z43 A;  4JY2 A;  4Z26 A;  2JAE A;  1YQ3 A;  2YWL A;  1GXF A;  2VZ2 A;  2GQW A;  3IWA A;  5KRQ A;  3V3O A;  1OJC A;  2TPR A;  1IUU A;  2RGO A;  1GPE A;  1EL8 A;  2WOI A;  4YSZ A;  1PBE A;  4TLX A;  3SZF A;  3DGH A;  2VRM A;  4YWO A;  2JB2 A;  4A6N A;  1H82 A;  3GYJ A;  3IC9 A;  3ITJ A;  4I59 A;  1KIF A;  3UKH A;  1K0J A;  3UKQ A;  4DGK A;  1C0I A;  4IV9 A;  4EIQ A;  3AXB A;  3Q9T A;  4EQR A;  4K7Z A;  5J7X A;  1Y56 B;  2YM2 A;  5M0Z A;  1N4U A;  4AT2 A;  1TYP A;  1CBO A;  4XXG A;  3SYI A;  3P4R A;  4G73 A;  4EMJ A;  2QA1 A;  1RP0 A;  2BS3 A;  1AOG A;  3CNT A;  3HYV A;  3CGB A;  1C0K A;  3CMM A;  1CC6 A;  2RGH A;  1B4V A;  3FIM B;  4G6G A;  1FCD A;  2E5V A;  1JEH A;  2WDV A;  2R9Z A;  2XDO A;  4GR1 A;  5HXI A;  1K0L A;  4BV6 A;  2XVF A;  2GB0 A;  3GRS A;  2H88 A;  1VQW A;  3I3L A;  3FMW A;  4U8M A;  1TYT A;  4BJY A;  2ARD A;  2FBW A;  2GV8 A;  3NIX A;  5KMS A;  3VRB A;  3AEA A;  5HY5 A;  1YY5 A;  3T37 A;  4APN A;  4G6H A;  1DNC A;  3CNS A;  2C7G A;  3UOX A;  1X31 B;  1O95 A;  1Y0P A;  1Z6L A;  3AE5 A;  4Y4N A;  1DOC A;  3G3E A;  4YTN A;  2C72 A;  2BK4 A;  2C70 A;  3CGD A;  2WDQ A;  4GCM A;  1TDO A;  1YQ4 A;  3PVC A;  3ZNO A;  2GR3 A;  4H4S A;  1NAA A;  1OJA A;  3EF6 A;  2X8C A;  4J31 A;  2ZBW A;  3DK8 A;  4ZCC A;  2WP9 A;  3AD7 B;  4OPL A;  3UKL A;  1OJ9 A;  1VRQ B;  2J3N A;  1GRT A;  3IHG A;  2YVF A;  2YVG A;  1NPX A;  1H83 A;  3DK4 A;  4YKF A;  2YR5 A;  4U2S A;  3P4Q A;  1L9E A;  1CL0 A;  2Y6Q A;  3CUK A;  3CPI G;  3L1R A;  1P2H A;  4H50 A;  4C77 A;  2BS4 A;  3LB8 A;  4K2X A;  3ATQ A;  2YAU A;  1COY A;  2QA2 A;  2WP5 A;  3P4P A;  2YLX A;  3W4I A;  1XHC A;  1LVL A;  2YG6 A;  1TDE A;  2XLR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...