1Y5AT

Dianhydrosugar-based benzamidine, factor xa specific inhibitor in complex with bovine trypsin mutant
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsin, cationic
publication title Understanding binding selectivity toward trypsin and factor Xa: the role of aromatic interactions
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2004-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1y5aT01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1y5aT02
4M7GA 1P11E 4WVPE 3SGBE 1C5YB 1J9CH 1P2IA 1SOTA 3BTDE 2XYAA 2PUXB 3RXGA 1TRMA 4H4FA 1OOKB 1BTYA 1N8OC 3BEUA 5DP7A 2YNBA 4X6MA 5HM9A 4BTTB 1YBWA 2BD7A 4VGCB 1O3FA 2GDDA 2FX6A 1YPHE 1C5MD 2GGVB 3NUMA 2XBYA 1T7CA 1SGEE 3P8GA 1XKAC 1Z8GA 2J38A 7GCHF 1ORFA 3KHVA 1KTTB 2SNWA 1CA0C 3TGIE 2H9TH 1TX6A 2J2UA 1DX5M 2NU1E 2XBVA 3SW2B 1NU7B 1F2SE 3DT0H 4F4OC 3LGVA 3S9BA 5K7RA 1O5GH 1A0JA 4UFEH 4JYUH 1CSOE 2FOFA 1FLEE 4BANB 1P9SA 5JBTA 2VINA 3P95A 5LH8A 1BTWA 1D3TB 2B9LA 1GHYH 2ZDKA 3GISB 3SU5A 1O2NA 1JIMA 1JWTA 3JZ2B 1UTQA 4CRFA 3P70B 4UONA 1GHXH 3AW1A 3O8CA 1XXDA 3P8FA 1KTSB 3ESTA 1QL8A 1WQVH 2ZHQH 1BZXE 1TE0A 3SUGA 5L2ZH 1BRUP 1H9LB 2VIWA 4CRGA 5ESBA 1EZQA 3RXOA 2HALA 4IN2A 5JBBS 5ABWA 1FAXA 1TPPA 1HIAA 2BQ6B 1BTUA 3SV2H 2VVUA 2R0KA 4LOYH 2VIQA 2WPHS 1BUIA 1ELGA 3PWBA 4MQAA 1MTWA 2ANKH 5DP3A 1O3GA 4ZXXH 5GIBA 2AMPA 2IN2A 3NKKA 1NRNH 4UFFH 5A0AE 3UOUA 1XUKA 2QF0A 3C1KA 1QBVH 1O2HA 1D9IA 1UTLM 5GXPA 5C5NA 5C1XA 4U32A 1EJMA 3D49H 4I8LA 5PTPA 1C1MA 5BRRE 1P12E 1UTNA 1UCYE 1Y3WA 5JPMH 2H9HA 2IPHA 4INKA 1WSSH 1V2VT 3PMBB 2QGRA 8LPRA 2CHAB 2HRVA 2W5EA 3HGNA 1S0RA 4X8VH 4XFQA 5C5OA 2UUJB 2VH0A 1A7SA 1K28D 3FP7E 1TPOA 2FS9A 1F5KU 4JMYA 4O03A 1YCPM 1B0FA 3AW0A 5EW1H 2AMDA 2A2XH 3GY7A 5LPEA 2C93B 1ID5H 3LGUA 3ZZ4A 5AFYH 3PM3A 1SOZA 1K1OA 2ANWA 1XUJA 1C9PA 2D8WA 4K60A 2EI7A 2ZGCA 4ZKNU 3W94A 1V2QT 1P2KA 4FUGA 1GWAA 3SNEA 2OC1A 3KL6A 1JRSA 2BDBA 4GHQA 3UREA 1VCPA 2O8TA 1C1OA 3TIUA 1GHWH 4I8HA 1SQTA 4ABJA 2STBE 1A5IA 5DKMA 3TVJB 3VB5A 1YP9A 3MO6A 2VNTA 1HJAC 2AH4X 1MZAA 2ZQ1A 1S0QA 2TGTA 2JH5D 1TBZH 2G8TA 3A86A 3GDUA 3M3SA 1V2ST 2KAIB 3RXBA 2ESTE 2GCHF 2HPQH 5GCHF 1O5EH 3A8AA 3AAVA 4MNYA 4B2BA 2DE9A 1FY5A 1UHBB 2TGDA 2GCTB 1EAIA 4O3TA 2CJIA 3F9EA 2UWLA 4B2AA 2Q6DA 4CRCA 3BTTE 1PQAA 1CGIE 4KKDA 4X1RU 1AHTH 2HLCA 1L0ZA 1MMJN 2ZZUH 1PJPA 1T4UH 1XUGA 4MTBA 5C1YA 3MTYA 3U69H 4OGYA 4YM9A 2A5AA 3M7UA 4FUCA 3M3VA 4CHAB 3MI4A 1F0SA 3M5OA 3RC4A 2J95A 1GL0E 1KXCA 2V0BA 4MPWA 3UQVA 5AVDA 3AASA 3QLPH 1OYTH 2BTCE 3RXEA 4CRAA 2Q6FA 2SGAA 4YO9A 3VB4A 2W7UA 1KXAA 2BVRH 4OS7A 3SJ8A 6GCHF 3PB1E 4NIYA 5T6FA 2Y7ZA 1G3EA 3V0XA 1S81A 4NZLA 4THNH 5ETXA 1ESTA 5FAHA 1Q31A 1O3JA 2ZPSA 1JRTA 1KDQA 3TJVA 7LPRA 1AU8A 4CRDA 1LHDH 3RXCA 2PSYA 4RKOB 1MD7A 1F7ZA 1JXPA 2GCHG 2IJOB 2P94A 1NO9H 5GCHG 1CHOF 4AGKA 4X1PU 2XNIA 4NSVA 4FU7A 2F9NA 1O34A 1HAZB 3H7TA 1GMCF 1O3KA 1T31A 5FPYA 2GMTB 1ELBA 2W3IA 2CN0H 1FDPA 3SU6A 1P06A 1C1UH 1EB2A 1SI5H 1OX1A 1SVPA 1HAIH 2J92A 2OUAA 4I31A 3C27B 4VGCC 3HK3B 3MMGA 2V3HH 4Y0ZE 1BTXA 4AG1A 5E0HA 3VB7A 2BQWB 1A5HA 3T62A 3ZVBA 2M5TA 2R2WU 1H8IH 1GL1A 4IGDA 1XVOA 1F0UA 2A7CA 4X6OA 3V12A 1XVMA 1FY8E 1KXDA 1VJ9U 6CHAC 2FOAA 3ZZ3A 3BEIB 1H4WA 6GCHG 3UOPA 3MNBA 1DM4B 1LQDB 3VFEA 1PFXC 1TA6A 1O35A 1C2KA 5EQQA 1ZSJA 4B73A 1A1RA 4A1TA 3MU5A 3ZVFA 3LH3A 4FU9A 1GDNA 1CE5A 2BDIA 1Y3YA 2XCFA 3A8BA 3RXJA 1EP6A 1HLTH 4FUJA 1CHOG 2FTLE 2PTNA 1LO6A 4ABIA 3LH1A 1Z6EA 3BSQA 3A7TA 3NCLA 1HXFH 1GMCG 5EODA 3PTBA 6ESTA 2ZDLA 1HAGE 3E16B 1ZTJA 3FANA 5HXFA 3LKWA 3OTJE 8GCHF 3M5NA 3ZZ8A 1AWFH 2F9BH 4U01A 4JYTA 2ZFTA 1O2WA 4CREA 2VIDA 2ZFRH 4E05H 3PV4A 1O2QA 3E8LA 3A7XA 3ENSB 3QZQA 1QRZA 1Z1IA 4R8TB 3RMMH 2ZNKH 1A46H 2PLXA 2WINI 1S83A 3Q76A 2B5TB 1GCDA 4A5TS 2GX4A 1CO7E 1QBOA 1TBRH 4BXWA 1AWHB 1GBBA 2WYJA 1ZHRA 3KGPA 2FTMA 1WU1A 5LGOA 2BMGB 1DE7H 3RMNH 1G36A 1ELAA 1G3BA 2EA3A 2GV6A 1GJ6A 4CBNA 2Q1JA 1O38A 1TPSA 3K65B 4WF8A 4NZQA 3FAOA 5FHTA 1RTFB 1GMHF 1H8DH 4K1TA 1P2JA 1BT7A 2XW9A 1PPZA 1Z1JA 2CHAC 2C8YB 1V2RT 2BY5X 1IQHA 3H7OA 3O8BA 1O2PA 1HJ9A 4OGXA 4DIHH 2EI8A 1C1QA 4NWKA 2F3CE 4FUIA 2BY7X 3GCOA 1RTLA 1ANCA 1SGFA 1SGQE 3EGKH 1KSNA 4FVBA 1GJDB 1LKAA 3HKJB 4Y11E 3UUZA 2Z9IA 1RIWB 2ZTYA 3ATLA 4NGAH 1MCTA 1DANH 4GUXA 2OBQA 5EW2H 1QIXB 1BA8B 4LXBH 4I8GA 2P8OB 3F9GA 3P6ZB 3HKIB 1PQ8A 1MH0A 1ZLRA 3ZYEA 3TGJE 4AX9H 2FI5E 2F91A 4BOHA 2ZFQH 1EP5A 1IHSH 1GHVH 1N1LA 1D6WA 1QB1A 5ESTE 3RU4E 2RA3A 3RXFA 1UTPA 4FUBA 2BLQA 3SBKA 3ZZCA 1QHRB 3UY9A 2P3TB 1LPKB 3K6YA 1EX3A 4XDEA 2Z3EA 3MU8A 3V3MA 3QGJA 1HDTH 1P8VC 1YLCA 1GMHG 1QB9A 3B9FH 1TMTH 3FZDA 1LQEA 2JETB 1O3IA 4TPYA 1ANDA 3QK1A 2UWOA 3ZVAA 3ZZ6A 4K5ZA 1GJ9B 1MD8A 1LHFH 1FJSA 1BQYA 3MNXA 3RUOA 2BDCA 5DK1A 3L33A 3RXLA 3NK8A 5HYOA 2GCTC 4X2WA 1OPHB 5CHAB 5DP4A 4X6PA 4J2YB 3OYPA 1C5SA 3ELAH 1FY1A 2H6MA 5BPEA 3RXTA 8ESTE 8KME2 1QB6A 1W0ZU 3QUMP 2FOCA 3LGWA 4WH6A 1J8AA 1BTZA 2A4OA 5L2YH 4FUHA 1YLDA 2ASUB 1O2GH 1O2LA 1W3CA 4CHAC 2FI3E 4AORA 1C5ZB 4X8TH 2VGCB 3F6UH 3SJOA 2AMQA 4TY6A 3PMAB 2QYIA 2WUBA 1HAVB 1MAXA 3ODDA 1GHAF 1O2JA 1TGBA 3IITA 2OCVB 1RRKA 3UQOA 3P92A 4CBOA 1VCQA 2A31A 1AVXA 1MKXK 3BV9B 4WJG2 1WUNH 4SGAE 1GJ8B 1K9OE 1TWXB 5JBCS 1YYY1 3RU4T 5EXLA 4F49A 1A2CH 5EGMA 1Z71A 2OC7A 3RC5A 2ZDVH 3MHWU 3PO1B 1MKWH 1W2KH 1W8BH 2HPPH 1NM6A 2A2QH 1DICA 1FN6A 4JZIA 1K22H 3K6ZA 4Q80A 1WTHD 3DA9B 1GG6B 4OS6A 4INHA 4K8BA 1OXGA 1HGTH 2GMTC 3VPKA 1V2OT 5A0CA 1TFXA 2FX4A 7ESTE 1EATA 3BIUH 1F0RA 2PKAB 1SG8B 4DCDA 1GCTB 1AY6H 4MPUA 3ZV8A 1GDUA 4ABBA 2ZG0H 3IG6B 3E3TA 3EA8A 3CENA 3EA9A 1K1JA 2QIQA 4KTSA 5E8EH 1RS0A 3BTGE 1TIOA 1SGCA 4X2YA 1GHAG 1AKSB 4Q7ZA 1P2NA 1CQQA 1D6RA 4Y76A 1IQGA 4QT8C 3S7HB 1AD8H 1ZMNA 3BTHE 3PLBA 1KXFA 2SFAA 1TAWA 1Y5AT 2RG3A 3TH4H 1O3BA 2A4QA 1SSXA 3SZNA 3VB6A 1GJ4H 4MPVA 4DY7B 2QXHA 3EE0B 4HZHA 1C5NH 2GTBA 5DJ7A 2PGBB 1JBUH 2AYWA 3KEEA 3A89A 4Q7YA 1P3EA 1S6HA 2FS8A 2GZ7A 1ZOMA 2ANMH 2G4UA 3BG4B 4BAKB 1ZTLA 6LPRA 2FOEA 2CV3A 3RXMA 2ZP0H 1W10U 1ELTA 4JZ1A 2Z9KA 1C2JA 1O36A 1PQ7A 2OLGA 4AFUA 1IAUA 1UVOA 9LPRA 1C2GA 1AO5A 1A4WH 4ISIH 1FY3A 1L1JA 3RXKA 4MNXA 2P59A 1AN1E 2ZU4A 3LJJA 1GBKA 3QGNB 3LJOA 4ABGA 1QCPA 1ZJKA 3M37A 2FOMB 2F9OA 1TPAE 1K21H 1IQJA 1DDJA 1ARCA 3T28A 4Y6DA 1IQFA 1OWKA 2BD8A 5TJXA 1FQ3A 4D76A 1W13U 4YOGA 3F1SB 1EZXC 1EPTB 1WAYB 4XBCA 1L1GA 1ZMLA 1FXYA 4MPXA 3EA7A 1C5XB 2VU8E 4B1TA 1EKBB 4K1EA 1SGIB 2TBSA 1C2IA 1DWBH 4A6LA 3U8RH 1CT0E 1F92A 3SU4A 3DFJA 4NSYA 1P05A 1T8MA 1U6QA 4JK5A 4X8UH 5H4IB 1DT2A 3KCGH 3P17H 2KAIA 1JOUB 2A4GA 1HAYB 1AVWA 1O2KA 4FVDA 2A7JA 2QY0B 1NTPA 4YT6H 2P95A 2PKSB 1F5LA 4IBLH 1UHBA 2OTVA 1ZSLA 2AFQB 2ZPQA 5FCKA 1C2FA 3UIRA 2DE8A 3URDA 2BX3A 4DVAU 2GDEH 3RXHA 5JYIA 2ZGBH 4Q7XA 1IQNA 3LDXH 5TCCA 4AFZA 2G00A 5G4BA 1OP2A 3VEQB 3RXUA 1AIXH 3CS7A 3TJNA 1RIWC 3SNBA 2QXIA 2R2MB 2G52A 1WBGB 2EC9H 4ZKOU 1T4VH 2G4TA 1LHCH 1JMOH 4JYVH 2P8OC 2QXJA 4X1QU 4FU8A 1PPEE 3U8TH 1SBWA 4HTCH 1V2NT 4BXSA 1HBTH 3SJ9A 1FMGA 1P03A 2J9NA 1Z8JB 2FDAA 1P01A 1MTUA 1SGFG 3V7TA 1O32A 4U2WA 3PLPA 1A3EH 1PPHE 1C5OH 4CR5A 4XSKU 3A7VA 4BAMB 4IW4E 1DUAA 2JETC 1CGHA 1ABIH 4D9QA 3MU0A 2OXSA 2FXRA 2VJ1A 3T25A 1MUEB 1YM0A 3SV6A 1NFXA 1NZQH 3NWUA 1TQ0B 1O2MA 3MNSA 1O3OA 1UTMA 4WWYA 3HPTB 4OS5A 1DXWA 1O0DH 5CHAC 5AFZH 3UR9A 4A1VA 1AE8H 1Z8RA 4I7YH 1O2XA 2QA9E 1QRXA 4YLQH 5GDSH 2FP7B 3RXPA 2O8WA 2ZA5A 2P93A 1HYLA 3TPIZ 1ZHPA 3KQBA 4KTUA 3ZZBA 1ZPZA 5A09A 3PMHB 2B0FA 3SU2A 2VGCC 2ZKSA 3GY3A 1ESBA 1VITH 4BAOB 4ABDA 1C5LH 1V2UT 4Q2KA 5EOKA 1J14A 2PFEA 2HNTF 1THSH 1GI6A 4OS4A 3PWCA 5HM2A 3BN9A 2RDLA 2Y81A 1BB0B 1EAWA 2CXVA 3SUEA 1DSTA 1MTSA 2F9UA 4B71A 2J94A 3TH3H 2OBOA 4YZUA 5A8XA 1EAUA 2ULLA 1AQ7A 2R9PA 1P02A 3VGCB 4XBDA 3NXPA 3PO1C 3UFAA 1P3CA 3UWIA 2EI6A 2Y80A 4YOIA 1BRBE 1KIGH 1FAKH 1CVWH 1SHHB 1TALA 4ZXYH 1GBTA 3M61U 1GG6C 2XC4A 3TGKE 3CP7A 1QL9A 1MBMA 1YPGH 1BBRH 3QTOH 1DVAH 2A0QB 5T3HA 4OS2A 5J4SA 4TWYA 5DO4H 1V2KT 2BDAA 4ZMAH 3D62A 1ZHMA 4GCHF 2ZDAH 1O2RA 1GCTC 3SUFA 1S84A 1OKXA 2FO9A 5DPAA 2QN5T 3SU3A 1HAOH 1EOJA 3LIWA 2ZFPH 1O2IA 2TGPZ 4I32A 3SJKA 1F0TA 1T8OA 1XM1A 3U1IB 1DITH 2H5CA 3T5FH 2A45B 1WYKA 1THPB 1TNIA 3MU1A 3EQ0H 2FOHA 2BXUH 2HVXA 1P0SH 4YOJA 3GYMA 3O8DA 1YPKH 2Z3CA 1V3XA 1NPMA 3AAUA 2BLVA 5GJ4B 1IQIA 1BMAA 1PPCE 3VB3A 4Y7AA 1T8NA 3A88A 3K9XB 3UR6A 1WV7H 3M5LA 3ZZAA 1E0FD 3DHKH 3K2UA 1O5CB 3BTKE 1E34B 1UO6A 2BX4A 3BG4C 1GI2A 4IN1A 1DFPA 3PYHA 1UK4A 4B75A 1OS8A 1VITF 2ANYA 1BJUA 2ZI2H 1NS3A 4GCHG 1BTHH 1ZRKA 3OU0A 1UK2A 3GYLB 4ZHMU 3L3TA 4FUEA 3S9AA 1FI8A 2Z6BD 2Y82A 2BD4A 4K1SA 3LU9B 1C5VA 1C4V2 3H5CB 5C1UA 4LZ4B 2P3UB 3UPEA 1V2WT 1YC0A 3QTVH 1UK3A 1ZJDA 3GOVB 1O2OA 2JH6D 4ISLA 1ELEE 2XXLA 1BRCE 4K3JA 2A4RA 3E0PB 4MG3A 1ANEA 1AUTC 1EPTC 1T32A 1NFUA 3FFGA 2ZU1A 1NFWA 1BOQA 2Y5GA 3A8DA 4HI3A 1G3DA 4B74A 1V2PT 2WPMS 3SV8A 1P2QA 2HNTC 1FIWA 1QY6A 4Y8XA 1E38B 3EDXB 3U8OH 5T6DA 1Z8IB 3SGAE 1C4U2 4ZHAA 1O2VA 1QJ7B 1A5GH 1GI7B 1NRQH 2PKSC 1FNIA 1UVTH 1J16A 4H6SB 1TA2A 1WQSA 4AB8A 3Q3KA 5K0HA 3T2NA 4R0IA 1VITG 3MYWA 2CF8H 2ODYB 1EASA 1GGDB 2O9QA 1HAXB 4E06H 1ZSKA 1CBWB 1B5GH 5HMAA 3I29A 4MDSA 1O5FH 3BTQE 4X6NA 3SI4H 4E7RG 2Z7FE 3DUXH 4NFFA 3MFJA 1LVYA 3S0NA 3QZRA 1TMBH 3RXVA 4NIXA 2AEIH 2QAAA 1V2TT 2CGAA 3D65E 4KGAA 1BMMH 4O9VA 4AG2A 5DG6A 2G55A 5I25A 1HAVA 5FCRA 4ZKSU 2GKVE 1TGSZ 1ZMJA 1F5RA 1C5UA 1SGYE 4ZH8A 2GZ8A 1OSSA 4UD9H 4ZKRU 1YCPH 4NFEA 4AN7A 1YPLH 3F68H 4A92A 4X2VA 1FN8A 2GP9B 2AS9A 4D9RA 3ODFA 1MKWK 1OWHA 1PQ5A 1DOJA 3PROA 4ZUHA 3MH4A 3ATWA 1O31A 1KXBA 3ZV9A 3SN8A 3DD2H 2ZFFH 3AVZA 2UUYA 2K1QA 2BOKA 1SLWB 3GY6A 1A0LA 1L4ZA 2JH0D 3HK6B 3S69A 1D3DB 1AVGH 3ITIA 1MTNB 2BY6X 2PKAA 2HGTH 2Z94A 1GBAA 2BM2A 1V6DA 4I8KA 2VIOA 1NY22 4H42U 1GI4A 1INCA 3A87A 3HGPA 3FVFB 2Z9LA 4X1NU 4AFQA 1NRRH 3BTME 3SHAH 1O3HA 1O5AB 1BMNH 2VVVA 1GMDF 2ZGXH 4ISHH 4DURA 1AKSA 1EUFA 2IOTA 2ODPA 5DP9A 1GPZA 3QO6A 2Z3DA 2WYGA 2G51A 1BIOA 1GI5A 2V35A 2C8XB 1VGCB 2VWMA 1DWCH 3TK9A 1KY9A 1VCWA 1V2JT 4JZEH 1RJXB 1J15A 3R0FA 1HJ8A 1VZQH 4X2XA 3JZ1B 3CS0A 1G32B 2BDGA 3QWCH 1GI9B 3ZZ9A 3VGCC 3ZVCA 1D3QB 2C3SA 5F8TA 2ZECA 1C1NA 5DP5A 2CMYA 1TBQH 2WUCA 1NRPH 1QQ4A 5FPSA 4O97A 2RA0A 1O37A 2NWNA 3SQEE 2XWAA 2VWNA 3I78A 4UDWH 2OQUA 4CR9A 1WOFA 3L6PA 1O3DA 4K69A 5FX5A 1SLXB 5EPYA 1O3PB 5IYTA 3ZVDA 5FXLA 3S9CA 4TY7A 4A7IB 2VWLA 2ZHDA 3M35A 5DP6A 3PLKA 1GMDG 5C20A 2AIQA 2ALVA 4UFGH 3MH6A 1O3CA 2BOHB 2A7HA 1SFQB 1EPTA 2AERH 2Y6TA 4ZAEA 2BD3A 2BLOA 1C1WH 5T6GA 4DT7B 2OQ5A 5EXMA 1DLEA 1TABE 1BTPA 2O8MA 2O8UA 1C5TA 1GVLA 4IC6A 1LCYA 3M5MA 1BRAA 1DWDH 1HXEH 3E91A 1QBNA 3LGYA 1O5BB 5GPIB 2ZDMA 2CF9H 2SGQE 1BMLA 1FY4A 4HFPB 3SU1A 1G2LA 1L4DA 2OC8A 1TB6H 2BZAA 2V3OH 3EYDA 4KTCA 4NCYA 2GVFA 2XTTB 4NG9H 1XUFA 2ZU2A 1SPJA 4U30A 4NIVA 2W3KA 3UNRA 2FLRH 3RU4D 5A0BA 3D23A 1GI8B 3S7KB 3VXFH 3SUDA 2QXGA 4Z6AH 1JIRA 3WY8A 4WXVA 1W0YH 1OP8A 1TOCB 3Q00A 1W7XH 4ABAA 1GBEA 1V2LT 4AZ2B 2F83A 2H2ZA 1KXEA 3ATKA 3B23B 4ASHA 1EB1H 1OWDA 3LT3A 4NA9H 2RCEA 1KLTA 3RXAA 5E0JA 2C90B 2GZ9A 2XBWA 1YGCH 2WPLS 1UTKA 4KELA 4X0WU 3ZZ5A 5FBIA 1C1PA 4JZDH 1ZR0A 2ZCHP 4ESTE 1O2UA 1OWEA 5L6NH 1ESAA 1TX8A 1AFEH 4IS5A 1D4PB 1MQ5A 2OP9A 5SGAE 1AFQB 4ISNA 4D8NA 1YKTA 4B2CA 2QV1A 2QCYA 3OY6U 1GGDC 4GSOA 4O3UA 1P09A 1HAHH 2FZZA 1CBWC 3RMOH 1TNLA 3ZZDA 1DWEH 3SHCH 1G3CA 3RXDA 2ZU3A 5AF9H 3B8JA 2FM2A 2BQ7B 3RXRA 3SV9A 6CHAB 4AYYB 5F6MA 3A85A 1A3BH 1KYNA 1O2SA 4JK6A 4MNWA 2LNCA 1UCYH 4I33A 1Y3VA 2ZDNA 1Z7KA 4GLYA 1H9HE 1FONA 3SNAA 1TNHA 2A5KA 1ZPCA 4NIWA 2NU3E 1HFDA 1UVSH 1NT1A 4K8YA 3M7QA 2FPZA 5IDKA 1GI0A 1OYQA 1YF4A 3P8NA 1OWIA 2BD9A 1MKXH 1UJ1A 1C5PA 1C2DA 1O3AA 2SGFE 4PROA 1MTVA 1UMAH 2BD5A 2FYRA 3TITA 2YOLA 4WMFA 3V13A 1IQEA 1K1IA 1TOMH 4YLUA 3F9FA 2FOBA 1IQMA 3A7YA 4BTUB 3SOSA 3SO3A 5EQSA 1O3EA 1TNJA 5C3NA 5GWZA 1QQUA 1BBRK 1K2I1 4DGJA 2NU2E 1SGNE 2VH6A 3TJUA 1C2EA 2GV7A 3SNCA 1A0HB 4XBBA 4SGBE 3BTEE 1O3NA 2ZQ2A 5EQRA 1SGRE 5E2OA 1MTNC 7GCHG 1ETTH 3GY8A 3TK6A 1ZGVA 1GBFA 2ZPRA 3GY5A 2OC0A 3KQDA 4AYVB 2Y5HA 4YT7H 1EXFA 1ABJH 2AGIX 4K2YA 3U9AH 3LONA 1D3PB 3GY2A 2ODQA 2WPKS 1T8LA 4TPIZ 3GY4A 1CA8B 4GHTA 3QN7A 4MLFB 1ZPBA 2BB4A 2P3FH 1TRNA 1C9TA 3Q3XA 3NPSA 3A83A 1CT2E 3N7OA 1QJ1B 1MU8B 2ILNA 1DSUA 1GI1A 9ESTA 1VGCC 3BG8A 1E36B 2ZCLP 1GJCB 2FWWA 5A8ZA 1QRWA 1GBCA 1O5DH 4WH8A 2ZC9H 1ELCA 1GVZA 3HATH 4AB9A 1RGQA 1LTOA 1UVUH 3A8CA 3O8RA 1XMNB 5C2ZA 2BDHA 2Y7XA 1TNGA 1SHYA 5JB8S 2HNTE 2PW8H 2FMJA 2BVXH 3NZIA 3RXIA 2QF3A 2ZEBA 3MH7A 5A2MH 2FLBH 1TLDA 2BY9X 3M3TA 3BF6H 1FPHH 1BCUH 1GHZA 3RM0H 1P2MA 1PPBH 2H5DA 1X7AC 1LPGB 4RN6A 1W12U 4ABFA 3LC5A 1KLJH 3R3GB 2GT7A 3RLYH 1HUTH 4I8JA 1NROH 1L2EA 1G2MA 1O2YA 2PWXA 3GDVA 2A5IA 3TNSA 3IWMA 1EZSC 1SQAA 4ABHA 1HNEE 4FUDA 4XE4A 3GICB 2THFB 5F03A 5F8ZA 1DXPA 1XKBC 1TMUH 2HWLB 1TX7A 5L30H 3A82A 1BHXB 1YPMH 1C2LA 1PPGE 5TCAA 3ZYDA 1YPHC 1CT4E 3FP8E 4BNRA 1AE5A 3E0NB 1GBDA 1YPEH 3F9HA 2PUQH 2F9VA 1HIAB 1LKBA 5CMXH 3QX5H 4B76A 4NA7A 3OY5U 2QC2A 4GAWA 2ZGJA 2EEKA 1QTFA 4ZROA 5JDUB 1NRSH 1Y3XA 3A84A 4UEHH 1MU6B 3TK5A 4MVNA 3BTFE 1LVOA 1TQ7B 2YNAA 2XRCA 1ANBA 1SGDE 4ZHLU 3UWJH 1LHGH 2JKHA 2VIPA 5E2PA 3SU0A 4JCNA 3E1XB 1W7GH 1S6FA 1K1LA 1LPZB 3DFLA 1HB0B 2GT8A 1ZGIA 1C2HA 1O33A 3A80A 1AZ8A 3TU7H 1QA0A 1TYNA 1XUHA 3P8OA 2XC5A 1RD3B 3RC6A 1WCZA 1Y3UA 2I6SA 1C4Y2 3LGTA 4GVUA 2ZF0H 1PYTD 2FYQA 2BVSH 2TIOA 3KQEA 3GCHB 3MNCA 4IMZA 1YCPK 3U98H 2UUFB 3RDZA 1P10A 1UVPA 2ZTXA 1K1MA 1KLIH 2H9EH 1B7XB 3GCTF 3MH5A 1AB9B 1FPCH 1UTOA 1DS2E 4TWWA 1C1RA 3GCNA 3I77A 3KQCA 5FBEA 2R3YA 1HV7A 1TGCA 4FXGH 1LVBA 1LDTT 4FUFA 1C1TA 1W11U 1AGJA 4AFSA 2BY8X 1HRTH 1NU9A 1TRYA 1ZTKA 1FIZA 2W7SA 1ZZZA 1EJAA 1AFQC 3QDZB 1BBRE 5FX6A 3M7TA 2D1JA 4AOQA 3LOXA 3VXEH 1H1BA 1GHBF 2O8LA 5I46H 1S82A 1SLVB 1XXFA 1ELDE 3MO3A 4Y0YE 5EPNA 4BTIB 5DGJA 1O3LA 1ELFA 1Y5BT 2WV4A 2WPIS 1BDAA 2SGEE 3UTUH 1GJBB 1AUJA 1GBJA 3EAJA 1E37B 5HGGA 1EAXA 1ACBE 4Y8ZA 4YESB 3TNTA 3Q77A 1Y8TA 3PTNA 1BHXF 3RMLH 1IOEA 1EJNA 3LC3A 1XUIA 1K1PA 4DOQA 3GCTG 4WY3A 1PYTC 2FIRH 3SQHE 1C5RA 1TGNA 3STJA 1Q2WA 2OD3B 3E90B 2VVCA 3BTWE 4DJZB 1QNJA 1GVKB 1N8OB 1QL7A 4AGJA 1SC8U 1TONA 4IC5A 4JZFH 1SFIA 3E6PH 1XX9A 1RTKA 4Z0KA 1MQ6A 4WMEA 4Y8YA 5LPRA 1CA0B 1O3MA 1GDQA 4IMQA 2XCNA 2TGAA 1GHBG 1GBIA 1C2MA 4D7FA 1RFNA 1G37A 3KIDU 1GI3A 1QR3E 3A7ZA 1DY9A 4Y71A 1CHGA 2OINA 1SR5C 1NFYA 2P16A 1ZRBA 2BXTH 1AMHA 2STAE 3ATIA 4H6TA 3SV7A 1DPOA 1QJ6B 3A81A 1KDQB 2A32A 4INLA 1M9UA 2I6QA 2ZWLH 4DIIH 1CU1A 1GJ5H 1O2TA 3OSYA 4BAQB 1QURH 2NU4E 2PGQB 4RSPA 3PMJA 2SGDE 2ZO3H 1G30B 1FV9A 1DUEA 1EZUC 1YPJH 3ATMA 4X8SH 5JBAS 4DG4A 2Z9GA 3RP2A 4BAHB 3UNSA 5C67A 1UTJA 5AHGH 2PSXA 2VWOA 1GBHA 1EOLA 1WTGH 2BLWA 2LPRA 2WPJS 1DLKB 2VB0A 2WV5A 1NESE 1SGTA 2ZFSA 2TRMA 2SGPE 3Q3YA 2VIVA 1K1NA 4CH8B 8GCHG 3RXQA 2H1UA 4LK4A 3A7WA 3BEFB 3G01A 3SNDA 2B8OH 2W26A 2R3UA 4Y7BA 2C8ZB 1B0EA 1OP0A 4CH2B 3KN2A 1P57B 2A1DB 1LHEH 1P04A 2J34A 3RLWH 2BYAX 2Z9JA 2AGEX 5A8YA 4X1SU 1SQOA 3LGIA 4RKJB 2HOBA 2D2DA 1QGFA 1ETSH 4J1YA 1N6XA 3RM2H 1AZZA 3URCA 2PR3A 3ZZ7A 3MO9A 3T29A 3FP6E 4A1XA 1GBLA 5J4QA 3KNXA 5FPTA 2FODA 4Y10E 1ARBA 4XOJA 3ZVGA 3MU4A 1SGPE 1S85A 1GJAB 3BIVH 3RXSA 1VR1H 2UWPA 2ZIQH 1TGTA 1A61H 1OWJA 4OS1A 1J17T 3FZZA 3TH2H 4UFDH 3GDSA 3TJOA 4MNVA 2FI4E 1H9IE 4ABEA 3M36A 1AI8H 1IHTH 1LMWB 3T27A 3KF2A 1Q3XA 2G5NA 1SLUB 3U1JB 1VJAU 3MWIU 1MBQA 2TPIZ 4KP0A 1ZYOA 4D7GA 3MOCA 1NC6A 1TNKA 2GD4B 2ZU5A 2AIPA 1DY8A 1IQKA 1UCYK 4DW2U 1HJAB 2FOGA 2SNVA 7KMEH 5EU8A 3SORA 1C5QA 1EQ9A 2ALPA 3T26A 1O39A 4NWLA 1V2MT 2C4FH 1FUJA 1CGJE 2G81E 4TYDA 5E0GA 2Q6GA 1Y59T 1SMFE 5JB9S 3SJIA 2NU0E 1MCVA 1L1NA 1N6YA 3GCHC 3LPRA 5EXNA 1E35B 1AB9C 5EG4A 1O30A 2J4IA 4LZ1H 2XBXA 4CRBA 1HPGA 1GJ7B 2BHGA 2PTCE 1W14U 1Z6JH 2F9PA 3W95A 1FZZA 2BDYA 2C8WB 1ELVA 2PV9B 3UNQA 3ZVEA 2ZHEH 2XC0A 1THRH 2FEQH 2ZHWH 3TLOA 5CE1A 1QA7A 2Y5FA 4UE7H 2ZTZA 3SI3H 5LPFA 2B7DH 1C1VH 2ZCKP 1C1SA 2XWBI 2ZHFH 3SGQE 2BD2A 4WXIA 5DP8A 3STIA 4HGCA 1MAYA 1MZDA 1SL3A 2R0LA 1IQLA 1LVMA 4Y79A 1QFKH 2AGGX 3OX7U 1O2ZA 2DUCA 4E7NA 1HAPH 4WMDA 5B6OA 1PPFE 4NA8A 1NN6A 2V6NA 1BJVA 1HCGA 5F8XA 1BITA 1P2OA 4GPGA 2PHBA 1C5WB 1G9IE 2ZGHA 1GBMA 4YTAA 4ISOA 2BZ6H 1P9UA 1RXPA 2UUKB 1ETRH 2D26C 2G5VA 1S5SA 1SB1H 1Y5UT 2FESH
chains in the Genus database with same CATH superfamily
4M7GA 1P11E 4WVPE 3SGBE 1C5YB 1J9CH 1P2IA 1SOTA 3BTDE 2XYAA 2PUXB 3RXGA 1TRMA 4H4FA 1OOKB 1BTYA 1N8OC 3BEUA 5DP7A 2YNBA 4X6MA 5HM9A 4BTTB 1YBWA 2BD7A 4VGCB 1O3FA 2GDDA 2FX6A 1QZ8A 1YPHE 1C5MD 2GGVB 3NUMA 2XBYA 1T7CA 1SGEE 3P8GA 1XKAC 1Z8GA 2J38A 7GCHF 1ORFA 3KHVA 1KTTB 2SNWA 1CA0C 3TGIE 2KM0A 2H9TH 1TX6A 2J2UA 1DX5M 2NU1E 2XBVA 3SW2B 1NU7B 1F2SE 3DT0H 4F4OC 3LGVA 3S9BA 5K7RA 1O5GH 1A0JA 4UFEH 4JYUH 1CSOE 2FOFA 1FLEE 4BANB 1P9SA 5JBTA 2VINA 3P95A 5LH8A 1BTWA 1D3TB 2B9LA 1GHYH 2ZDKA 3GISB 3SU5A 1O2NA 1JIMA 1JWTA 3JZ2B 1UTQA 4CRFA 3P70B 4UONA 1GHXH 3AW1A 3O8CA 1XXDA 3P8FA 1KTSB 3ESTA 1QL8A 1WQVH 2ZHQH 1BZXE 1TE0A 3SUGA 5L2ZH 1BRUP 1H9LB 5C17A 2XOKD 2VIWA 4CRGA 5ESBA 1EZQA 3RXOA 3UAIC 2HALA 4IN2A 5JBBS 5ABWA 1FAXA 1TPPA 1HIAA 2BQ6B 1BTUA 3SV2H 2VVUA 2R0KA 3W1EA 4LOYH 2VIQA 2WPHS 1BUIA 1ELGA 3F2GA 3PWBA 4MQAA 1MTWA 2ANKH 4I86A 5DP3A 4FETA 1O3GA 4ZXXH 5GIBA 2AMPA 2IN2A 3NKKA 1NRNH 4UFFH 5A0AE 3UOUA 1XUKA 2QF0A 3C1KA 1QBVH 1O2HA 1D9IA 1UTLM 5GXPA 5C5NA 5C1XA 4U32A 1EJMA 3D49H 4I8LA 5PTPA 1C1MA 5BRRE 1P12E 1UTNA 1UCYE 1Y3WA 5JPMH 2H9HA 1NBME 2IPHA 4INKA 1WSSH 1V2VT 3CNRA 3PMBB 2QGRA 8LPRA 2CHAB 2HRVA 2W5EA 3HGNA 1S0RA 4X8VH 4XFQA 5C5OA 2UUJB 2VH0A 1A7SA 1K28D 3FP7E 1TPOA 2FS9A 1F5KU 4JMYA 1S6LA 4O03A 1YCPM 1B0FA 3AW0A 5EW1H 2AMDA 2A2XH 3GY7A 5LPEA 1KMHB 2C93B 1ID5H 3LGUA 3ZZ4A 5AFYH 3PM3A 1SOZA 1K1OA 2ANWA 1XUJA 1C9PA 2D8WA 4K60A 2EI7A 2ZGCA 4ZKNU 3W94A 1V2QT 1P2KA 4FUGA 1GWAA 3SNEA 2OC1A 3KL6A 1JRSA 2BDBA 4GHQA 3UREA 1VCPA 2O8TA 1C1OA 3TIUA 1GHWH 4I8HA 1SQTA 4ABJA 2STBE 1A5IA 5DKMA 2V3MA 3TVJB 3VB5A 1YP9A 3MO6A 2VNTA 1HJAC 2AH4X 1MZAA 2ZQ1A 1S0QA 4YXWD 2TGTA 2JH5D 1TBZH 2G8TA 3A86A 3GDUA 3M3SA 1V2ST 5C94A 2KAIB 3RXBA 2ESTE 2GCHF 2HPQH 4P00A 5GCHF 1O5EH 3A8AA 3AAVA 4MNYA 4B2BA 2DE9A 1FY5A 1UHBB 2TGDA 2GCTB 1EAIA 4O3TA 2CJIA 3F9EA 2UWLA 3FO8D 5FL7D 4B2AA 2Q6DA 4CRCA 5HIYA 3BTTE 1PQAA 1CGIE 4KKDA 4X1RU 1AHTH 2HLCA 1L0ZA 1MMJN 2ZZUH 1PJPA 1T4UH 1XUGA 4MTBA 5C1YA 3MTYA 3U69H 4OGYA 4YM9A 2A5AA 3M7UA 4FUCA 3M3VA 4CHAB 2J98B 3MI4A 1F0SA 3M5OA 3RC4A 2J95A 1GL0E 1KXCA 2V0BA 4MPWA 3UQVA 5AVDA 3AASA 3QLPH 1OYTH 2BTCE 3RXEA 4CRAA 2Q6FA 2SGAA 4YO9A 3VB4A 2W7UA 1KXAA 2BVRH 4OS7A 3SJ8A 6GCHF 3PB1E 4NIYA 5T6FA 2Y7ZA 1G3EA 2AHME 3V0XA 1S81A 4NZLA 4THNH 5ETXA 1ESTA 5FAHA 1Q31A 2KCOA 1O3JA 2ZPSA 1JRTA 1KDQA 3TJVA 7LPRA 1AU8A 5CDFE 4CRDA 1LHDH 3RXCA 2PSYA 4RKOB 1MD7A 1F7ZA 1JXPA 2GCHG 2IJOB 2P94A 1NO9H 5GCHG 1CHOF 4AGKA 4X1PU 2XNIA 4NSVA 4FU7A 2F9NA 1O34A 1HAZB 3H7TA 1GMCF 1O3KA 1T31A 5FPYA 2GMTB 1ELBA 2W3IA 2CN0H 2PP6A 1FDPA 3SU6A 1P06A 1C1UH 1EB2A 1SI5H 1OX1A 1SVPA 4AC9A 1HAIH 2J92A 2OUAA 4I31A 1H8ED 3C27B 1W0JD 3HK3B 4VGCC 4B6EA 3MMGA 2V3HH 4Y0ZE 1BTXA 4AG1A 5E0HA 3VB7A 2BQWB 1A5HA 3T62A 3ZVBA 2M5TA 2R2WU 1H8IH 1GL1A 4IGDA 1XVOA 1F0UA 2GJGA 2A7CA 4X6OA 3V12A 1XVMA 1FY8E 1KXDA 1VJ9U 6CHAC 2FOAA 3ZZ3A 3BEIB 1H4WA 6GCHG 3UOPA 3MNBA 1DM4B 1LQDB 3VFEA 1PFXC 1TA6A 1O35A 1C2KA 3PV2A 5EQQA 1ZSJA 4B73A 1A1RA 4A1TA 3MU5A 3ZVFA 2WV9A 3LH3A 4FU9A 1GDNA 1CE5A 2BDIA 1Y3YA 2XCFA 3A8BA 3RXJA 1EP6A 1HLTH 4FUJA 1CHOG 2FTLE 2PTNA 1LO6A 4ABIA 3LH1A 1Z6EA 3BSQA 3A7TA 3NCLA 1HXFH 1GMCG 5EODA 2WZQA 3PTBA 6ESTA 2ZDLA 1HAGE 3E16B 1ZTJA 3FANA 5HXFA 3LKWA 3OTJE 8GCHF 3M5NA 3ZZ8A 1AWFH 2F9BH 4U01A 4JYTA 2ZFTA 1O2WA 1YWUA 3N7EA 4CREA 2VIDA 2ZFRH 4E05H 3PV4A 2J97A 1O2QA 3E8LA 3A7XA 3ENSB 3QZQA 1QRZA 1Z1IA 4R8TB 3RMMH 2ZNKH 1A46H 2PLXA 2WINI 1S83A 3Q76A 2B5TB 1GCDA 3GS9A 4A5TS 2GX4A 1CO7E 1QBOA 1TBRH 4BXWA 1AWHB 1GBBA 2WYJA 1ZHRA 3KGPA 2K0QA 4B6FA 2FTMA 1WU1A 5LGOA 4HG6A 2BMGB 1DE7H 3RMNH 1G36A 1ELAA 1G3BA 2EA3A 2GV6A 1GJ6A 4CBNA 2Q1JA 1O38A 1TPSA 3K65B 4WF8A 4NZQA 1COWD 3FAOA 5FHTA 1RTFB 1GMHF 1H8DH 4K1TA 1P2JA 1BT7A 2XW9A 1PPZA 1Z1JA 2CHAC 2C8YB 1V2RT 2BY5X 1IQHA 3H7OA 3O8BA 1O2PA 1HJ9A 4OGXA 4DIHH 2EI8A 1C1QA 4NWKA 2F3CE 4FUIA 2BY7X 3GCOA 1RTLA 1ANCA 1SGFA 1SGQE 3EGKH 1KSNA 4FVBA 1GJDB 1LKAA 3HKJB 4Y11E 3UUZA 2Z9IA 1RIWB 2ZTYA 3ATLA 3DSGA 1MCTA 4NGAH 1DANH 4GUXA 2OBQA 5EW2H 1QIXB 1BA8B 4LXBH 4I8GA 2P8OB 3F9GA 3P6ZB 3HKIB 1PQ8A 1MH0A 1ZLRA 3ZYEA 3TGJE 4AX9H 2FI5E 2F91A 4BOHA 2ZFQH 2KCYA 1EP5A 1IHSH 1GHVH 1N1LA 3UB0A 1D6WA 1QB1A 4DT4A 5ESTE 3RU4E 2RA3A 3RXFA 1UTPA 4FUBA 3PV5A 2BLQA 3SBKA 3ZZCA 1QHRB 3UY9A 2P3TB 1LPKB 3K6YA 1EX3A 4XDEA 2Z3EA 3MU8A 3V3MA 3QGJA 1HDTH 3OEED 1P8VC 1YLCA 1GMHG 1QB9A 2OK5A 3B9FH 1TMTH 3FZDA 1LQEA 2JETB 1O3IA 4TPYA 1ANDA 3QK1A 2UWOA 3ZVAA 3ZZ6A 4K5ZA 1GJ9B 1MD8A 1LHFH 1FJSA 1BQYA 3MNXA 3RUOA 2BDCA 5DK1A 2JJ1D 3L33A 5EIYA 3RXLA 3NK8A 1BMFD 5HYOA 1FX0B 2GCTC 4X2WA 1OPHB 5CHAB 5DP4A 4X6PA 4J2YB 3OYPA 1C5SA 3ELAH 1FY1A 2H6MA 5BPEA 3RXTA 8ESTE 3H09A 8KME2 1QB6A 1W0ZU 3QUMP 2FOCA 3LGWA 4WH6A 1J8AA 1BTZA 2A4OA 5L2YH 4FUHA 1YLDA 2ASUB 1O2GH 1O2LA 1W3CA 4CHAC 2FI3E 4AORA 1C5ZB 4X8TH 2VGCB 3F6UH 3SJOA 2AMQA 4TY6A 3PMAB 2QYIA 2WUBA 1HAVB 1MAXA 3ODDA 1GHAF 3PRBA 1O2JA 1TGBA 3IITA 2OCVB 5EJZA 1RRKA 3UQOA 3P92A 4CBOA 3OE7D 1VCQA 2A31A 1AVXA 1MKXK 3BV9B 4WJG2 1WUNH 4SGAE 3WWFA 1GJ8B 1K9OE 1TWXB 5JBCS 1YYY1 3RU4T 5EXLA 4F49A 1A2CH 5EGMA 1Z71A 2OC7A 3RC5A 2ZDVH 3MHWU 3PO1B 1MKWH 1W2KH 1W8BH 2HPPH 1NM6A 2A2QH 1DICA 1FN6A 4JZIA 1K22H 3K6ZA 4Q80A 1WTHD 3DA9B 1GG6B 4OS6A 4INHA 4K8BA 1OXGA 1HGTH 2GMTC 3VPKA 1V2OT 5A0CA 1TFXA 2FX4A 7ESTE 1EATA 3BIUH 1F0RA 2PKAB 1SG8B 4DCDA 1GCTB 1AY6H 4MPUA 2JDID 1GDUA 3ZV8A 4ABBA 2ZG0H 3IG6B 3E3TA 3EA8A 3CENA 3EA9A 1K1JA 2CK3D 2QIQA 4KTSA 5E8EH 1RS0A 3BTGE 3FKSD 1TIOA 1SGCA 4X2YA 1GHAG 1AKSB 4Q7ZA 1P2NA 1CQQA 1D6RA 4Y76A 1IQGA 4QT8C 3S7HB 1AD8H 1ZMNA 3BTHE 3PLBA 1KXFA 2SFAA 1TAWA 1Y5AT 2RG3A 2EY4C 3TH4H 1O3BA 2A4QA 1SSXA 3SZNA 3VB6A 1GJ4H 4MPVA 4DY7B 2QXHA 3EE0B 4HZHA 1C5NH 2GTBA 5DJ7A 2PGBB 1JBUH 2AYWA 3KEEA 3A89A 4Q7YA 1P3EA 1S6HA 2FS8A 2GZ7A 1ZOMA 2ANMH 2G4UA 3BG4B 4BAKB 1ZTLA 6LPRA 2FOEA 2CV3A 3RXMA 2ZP0H 2F4LA 1W10U 1ELTA 4JZ1A 2Z9KA 1C2JA 1O36A 1PQ7A 2OLGA 4AFUA 1IAUA 1UVOA 9LPRA 1C2GA 1AO5A 1A4WH 4ISIH 1FY3A 1L1JA 3RXKA 4MNXA 2P59A 1AN1E 2ZU4A 3LJJA 1GBKA 3QGNB 3LJOA 4ABGA 1QCPA 1ZJKA 3M37A 2FOMB 2F9OA 1TPAE 1K21H 1IQJA 1DDJA 1ARCA 3T28A 4Y6DA 1IQFA 1OWKA 2BD8A 5TJXA 1WXRA 1FQ3A 4D76A 1W13U 4YOGA 3KYGA 3F1SB 1EZXC 1EPTB 1WAYB 4XBCA 1L1GA 1ZMLA 1FXYA 4MPXA 3EA7A 1C5XB 2VU8E 4B1TA 1EKBB 5B6LA 4K1EA 1SGIB 2TBSA 1C2IA 1DWBH 4A6LA 3U8RH 1CT0E 1F92A 3SU4A 3DFJA 4NSYA 1P05A 1T8MA 1U6QA 4JK5A 4X8UH 5H4IB 1DT2A 3KCGH 3P17H 2KAIA 1JOUB 2A4GA 1HAYB 1AVWA 1O2KA 4FVDA 2A7JA 3F0PA 2QY0B 1NTPA 4YT6H 2P95A 2PKSB 1F5LA 4IBLH 1UHBA 2OTVA 1ZSLA 2AFQB 2ZPQA 5FCKA 1C2FA 3UIRA 2DE8A 3URDA 2BX3A 4DVAU 2GDEH 3RXHA 5JYIA 2ZGBH 4Q7XA 1IQNA 3LDXH 5TCCA 4AFZA 2G00A 5G4BA 1OP2A 3VEQB 3RXUA 1AIXH 3CS7A 3TJNA 1RIWC 3SNBA 2QXIA 2R2MB 2G52A 1WBGB 2EC9H 4ZKOU 1T4VH 2G4TA 1LHCH 1JMOH 2JIZD 4JYVH 2P8OC 2QXJA 4X1QU 2J98A 4FU8A 1PPEE 3U8TH 1SBWA 4HTCH 1V2NT 4ACAA 4BXSA 4Q63A 1HBTH 3SJ9A 1FMGA 1P03A 2J9NA 1Z8JB 2FDAA 1P01A 1MTUA 1SGFG 3V7TA 1O32A 4U2WA 3PLPA 2KCAA 1A3EH 2QF5A 1PPHE 1C5OH 4CR5A 4XSKU 3A7VA 4BAMB 4IW4E 1DUAA 2JETC 1CGHA 1ABIH 4D9QA 3MU0A 2OXSA 2FXRA 2VJ1A 3T25A 1MUEB 1YM0A 5HKKD 3SV6A 1NFXA 1NZQH 3NWUA 1TQ0B 1O2MA 3MNSA 1O3OA 1UTMA 4WWYA 3HPTB 4OS5A 1DXWA 1O0DH 5CHAC 5AFZH 3UR9A 4A1VA 1AE8H 4F48B 1Z8RA 4I7YH 1O2XA 1OHHD 2QA9E 1QRXA 4YLQH 5GDSH 3N7DA 2FP7B 3RXPA 2O8WA 2ZA5A 2P93A 1HYLA 3TPIZ 1ZHPA 3KQBA 4KTUA 3ZZBA 1ZPZA 5A09A 3PMHB 2B0FA 3SU2A 2VGCC 2ZKSA 3GY3A 1ESBA 1VITH 4BAOB 4ABDA 1C5LH 1V2UT 4Q2KA 5EOKA 1J14A 2PFEA 2HNTF 1THSH 1GI6A 4OS4A 3PWCA 5HM2A 3BN9A 2RDLA 2Y81A 1BB0B 1EAWA 2CXVA 3WW7A 3SUEA 1DSTA 1MTSA 2F9UA 4B71A 2J94A 3TH3H 2OBOA 4YZUA 5A8XA 1EAUA 2ULLA 1AQ7A 2R9PA 1P02A 3VGCB 4XBDA 3NXPA 3PO1C 3UFAA 1P3CA 3UWIA 2LELA 2VBCA 2EI6A 2Y80A 4YOIA 1BRBE 1KIGH 2HLDD 1FAKH 5GNDA 1CVWH 1SHHB 1TALA 4ZXYH 1GBTA 3M61U 1GG6C 2XC4A 3TGKE 3CP7A 1QL9A 1MBMA 1YPGH 1BBRH 3QTOH 1DVAH 2A0QB 5T3HA 4OS2A 5J4SA 4TWYA 5DO4H 1V2KT 2BDAA 4ZMAH 3D62A 1ZHMA 4GCHF 2ZDAH 1O2RA 1GCTC 3SUFA 1S84A 1OKXA 5F53A 2FO9A 5DPAA 2QN5T 3SU3A 1HAOH 5KGOA 1EOJA 3LIWA 2ZFPH 1O2IA 2TGPZ 4I32A 3SJKA 1F0TA 1T8OA 1XM1A 3U1IB 1DITH 2H5CA 3T5FH 2A45B 1WYKA 1THPB 1TNIA 3MU1A 3EQ0H 2FOHA 2BXUH 2HVXA 1P0SH 4YOJA 3GYMA 3O8DA 1YPKH 2Z3CA 1V3XA 1NPMA 3AAUA 2BLVA 5GJ4B 1IQIA 1BMAA 1PPCE 3VB3A 4Y7AA 1T8NA 1EFRD 3A88A 3K9XB 3UR6A 1WV7H 3M5LA 3ZZAA 1E0FD 3DHKH 3K2UA 1O5CB 3BTKE 1SQRA 1E34B 1UO6A 2BX4A 3BG4C 1GI2A 4IN1A 1DFPA 3PYHA 1UK4A 4B75A 1OS8A 1VITF 2ANYA 1BJUA 2ZI2H 1NS3A 4GCHG 1BTHH 1ZRKA 3OU0A 1UK2A 3GYLB 4ZHMU 2KR7A 3L3TA 4FUEA 3S9AA 1FI8A 2Z6BD 2Y82A 2BD4A 4K1SA 3LU9B 1C5VA 1C4V2 3H5CB 5C1UA 4LZ4B 2P3UB 3UPEA 1V2WT 1YC0A 3QTVH 1UK3A 1ZJDA 3GOVB 5DN6D 1O2OA 2JH6D 4ISLA 1ELEE 2XXLA 1BRCE 4K3JA 2A4RA 3E0PB 4MG3A 1ANEA 1AUTC 1EPTC 1T32A 1NFUA 3FFGA 2ZU1A 1NFWA 1BOQA 2Y5GA 3A8DA 5IK2D 4HI3A 1G3DA 4B74A 1V2PT 2WPMS 3SV8A 1P2QA 2HNTC 1FIWA 1QY6A 4Y8XA 1E38B 3OAAD 3EDXB 1VKYA 3U8OH 5T6DA 1Z8IB 3SGAE 1C4U2 4ZHAA 1O2VA 1QJ7B 1A5GH 1GI7B 1NRQH 2PKSC 2W6ID 1FNIA 1UVTH 1J16A 3DSOA 4H6SB 3SZEA 1TA2A 1WQSA 4AB8A 3Q3KA 5K0HA 3T2NA 1MABB 4R0IA 1VITG 2WSSD 3MYWA 2CF8H 2ODYB 1EASA 1GGDB 2O9QA 1HAXB 4E06H 1ZSKA 3FN8A 1CBWB 1B5GH 5HMAA 3I29A 4MDSA 1O5FH 3BTQE 4X6NA 3SI4H 4E7RG 2Z7FE 3DUXH 4NFFA 3MFJA 1LVYA 3S0NA 3QZRA 1TMBH 3RXVA 4NIXA 2AEIH 2QAAA 1V2TT 2CGAA 3D65E 4KGAA 1BMMH 4O9VA 2V7QD 4AG2A 5DG6A 2G55A 5I25A 1HAVA 5FCRA 4ZKSU 2QE7D 2GKVE 1TGSZ 1ZMJA 1F5RA 1C5UA 1SGYE 4ZH8A 2GZ8A 1OSSA 4UD9H 4ZKRU 1YCPH 4NFEA 4AN7A 1YPLH 3F68H 4A92A 4X2VA 1FN8A 2GP9B 2AS9A 3AK5A 4D9RA 3ODFA 1MKWK 1OWHA 1PQ5A 1DOJA 3PROA 4ZUHA 3MH4A 3ATWA 1O31A 1KXBA 3ZV9A 3SN8A 3DD2H 2ZFFH 3AVZA 2UUYA 2K1QA 2BOKA 1SLWB 4RT0A 3GY6A 1A0LA 1L4ZA 2JH0D 3HK6B 3S69A 1D3DB 1AVGH 3ITIA 1MTNB 2BY6X 2PKAA 2HGTH 2Z94A 1GBAA 2BM2A 1V6DA 4I8KA 2VIOA 1NY22 4H42U 1GI4A 1INCA 3A87A 3HGPA 3FVFB 2Z9LA 4X1NU 4AFQA 4Z1MD 1NRRH 3BTME 3SHAH 1O3HA 1O5AB 1BMNH 2VVVA 1GMDF 2ZGXH 4ISHH 1K0HA 4DURA 1AKSA 1EUFA 2IOTA 2ODPA 5DP9A 1GPZA 3QO6A 2Z3DA 2WYGA 2G51A 1BIOA 1GI5A 2V35A 2C8XB 1VGCB 2VWMA 1DWCH 4ACBA 3TK9A 1KY9A 1VCWA 1V2JT 4JZEH 1RJXB 1J15A 3R0FA 1HJ8A 1VZQH 4X2XA 3JZ1B 3CS0A 3DSPA 1G32B 2BDGA 5CHBA 3U28C 3QWCH 1GI9B 3ZZ9A 3VGCC 3ZVCA 1D3QB 2C3SA 4ZCNA 1UW7A 5F8TA 2ZECA 1C1NA 5DP5A 2CMYA 1TBQH 2WUCA 1NRPH 1QQ4A 5FPSA 4O97A 2RA0A 1O37A 2NWNA 3SQEE 2XWAA 2VWNA 3I78A 4UDWH 2OQUA 4CR9A 1WOFA 3L6PA 1O3DA 4K69A 1YLNA 1SLXB 5EPYA 5FX5A 1O3PB 5IYTA 3ZVDA 5FXLA 3S9CA 4TY7A 4A7IB 2VWLA 2ZHDA 3M35A 5DP6A 3PLKA 1GMDG 5C20A 4OM9A 2AIQA 2ALVA 4UFGH 3MH6A 1O3CA 2BOHB 2A7HA 4ASUD 1SFQB 1EPTA 2AERH 2Y6TA 1SKYE 4ZAEA 2KCPA 2BD3A 2BLOA 1C1WH 5T6GA 4DT7B 2OQ5A 5EXMA 1DLEA 1TABE 1BTPA 2O8MA 1C5TA 1GVLA 2O8UA 4IC6A 1LCYA 2F43B 3M5MA 1BRAA 1DWDH 1HXEH 3E91A 1QBNA 3LGYA 1O5BB 5GPIB 2ZDMA 3KQ5A 2CF9H 2SGQE 1BMLA 1FY4A 4HFPB 3SU1A 1G2LA 1L4DA 2OC8A 1TB6H 2BZAA 2V3OH 3EYDA 4KTCA 4NCYA 2GVFA 2XTTB 4NG9H 1XUFA 2ZU2A 1SPJA 4U30A 4NIVA 2W3KA 3UNRA 3OEHD 2FLRH 3RU4D 5A0BA 3D23A 1GI8B 3S7KB 3VXFH 3SUDA 2QXGA 4Z6AH 1JIRA 3WY8A 4WXVA 1W0YH 1OP8A 1TOCB 3Q00A 1W7XH 4ABAA 1GBEA 1V2LT 4AZ2B 2F83A 2H2ZA 1KXEA 3ATKA 3B23B 4ASHA 1EB1H 1OWDA 3LT3A 4FOUC 4NA9H 3N99A 2RCEA 1KLTA 3RXAA 5E0JA 2C90B 2GZ9A 2XBWA 5T1VA 1YGCH 2WPLS 1UTKA 4KELA 4X0WU 5EJLA 3ZZ5A 5FBIA 3MQKC 1C1PA 4JZDH 1ZR0A 2ZCHP 4M9FA 4ESTE 2HVYB 1O2UA 1OWEA 5L6NH 1ESAA 1TX8A 1AFEH 4IS5A 1D4PB 1MQ5A 2OP9A 5SGAE 1AFQB 4ISNA 4D8NA 1YKTA 4B2CA 2QV1A 2QCYA 3OY6U 1GGDC 4GSOA 4O3UA 1P09A 1HAHH 2FZZA 1CBWC 3RMOH 3DCLA 1TNLA 3ZZDA 1DWEH 3SHCH 1G3CA 3RXDA 2ZU3A 5AF9H 3B8JA 2FM2A 2BQ7B 3RXRA 3SYJA 3SV9A 6CHAB 4AYYB 5F6MA 3A85A 1A3BH 1KYNA 1O2SA 4JK6A 4MNWA 2LNCA 1UCYH 4I33A 1Y3VA 2ZDNA 1Z7KA 4GLYA 1H9HE 1FONA 3SNAA 1TNHA 2A5KA 1ZPCA 4NIWA 2NU3E 1HFDA 1UVSH 1NT1A 3EE7A 3M7QA 2FPZA 4K8YA 5IDKA 4TT3D 1GI0A 1OYQA 1YF4A 2KZ4A 3P8NA 1OWIA 2BD9A 1MKXH 1UJ1A 1C5PA 1C2DA 3F2HA 1O3AA 2SGFE 4PROA 1MTVA 1UMAH 2BD5A 4F55A 2FYRA 3TITA 2YOLA 4WMFA 3V13A 1IQEA 1K1IA 1TOMH 4YLUA 3F9FA 2FOBA 1IQMA 3A7YA 4BTUB 3SOSA 3SO3A 5EQSA 1O3EA 2JJ2D 1TNJA 5C3NA 4RT1A 5GWZA 1QQUA 1BBRK 1K2I1 4DGJA 2NU2E 1SGNE 2VH6A 3TJUA 1C2EA 2GV7A 3SNCA 1A0HB 4XBBA 4SGBE 3BTEE 1O3NA 2ZQ2A 5EQRA 1SGRE 5E2OA 1MTNC 7GCHG 1ETTH 3GY8A 3TK6A 1ZGVA 1GBFA 2ZPRA 2RDEA 3GY5A 2OC0A 3KQDA 4AYVB 2Y5HA 4YT7H 1EXFA 1ABJH 2AGIX 4K2YA 3U9AH 3LONA 1D3PB 3GY2A 2ODQA 2WPKS 1T8LA 4TPIZ 3GY4A 1CA8B 4GHTA 3QN7A 4MLFB 1ZPBA 2BB4A 2P3FH 1TRNA 1C9TA 3Q3XA 3NPSA 3A83A 1CT2E 3N7OA 1QJ1B 1MU8B 3NRLA 2ILNA 1DSUA 1GI1A 9ESTA 1VGCC 3BG8A 1E36B 2ZCLP 1GJCB 2FWWA 5A8ZA 1QRWA 1GBCA 2L6OA 2RFKC 1O5DH 4WH8A 2ZC9H 1ELCA 1GVZA 3HATH 4AB9A 1RGQA 2KFWA 1LTOA 3OTPA 1UVUH 3A8CA 3O8RA 1XMNB 5C2ZA 2BDHA 2Y7XA 1TNGA 1SHYA 5JB8S 2HNTE 2PW8H 2FMJA 2BVXH 3NZIA 3RXIA 2QF3A 2ZEBA 3MH7A 5A2MH 2FLBH 1TLDA 2BY9X 3M3TA 3BF6H 1FPHH 1BCUH 1GHZA 3RM0H 1P2MA 1PPBH 2H5DA 1X7AC 1LPGB 4RN6A 1W12U 4ABFA 3LC5A 2LP6A 1KLJH 2M2AA 2GT7A 3R3GB 3RLYH 1HUTH 4Q4LA 4I8JA 1NROH 1L2EA 1G2MA 1O2YA 2PWXA 3GDVA 2A5IA 3TNSA 3IWMA 1EZSC 1SQAA 4ABHA 1HNEE 4FUDA 4XE4A 3GICB 1YY3A 2THFB 5F03A 5F8ZA 1DXPA 1XKBC 1TMUH 2HWLB 1TX7A 5L30H 3A82A 1BHXB 1YPMH 1C2LA 1PPGE 5TCAA 3ZYDA 1YPHC 1CT4E 3FP8E 4BNRA 1AE5A 3E0NB 1GBDA 1YPEH 3F9HA 2PUQH 2F9VA 1HIAB 1LKBA 5CMXH 3QX5H 4B76A 4NA7A 3OY5U 2QC2A 4GAWA 2ZGJA 2WPDD 2EEKA 1QTFA 4ZROA 5JDUB 1NRSH 1Y3XA 3A84A 4UEHH 1MU6B 3TK5A 4MVNA 1NBMD 3BTFE 1LVOA 1TQ7B 2YNAA 2XRCA 1ANBA 1SGDE 4ZHLU 3UWJH 1LHGH 2JKHA 2IJD1 2VIPA 5E2PA 3SU0A 4JCNA 3E1XB 1E79D 1W7GH 1S6FA 1K1LA 1LPZB 2K8IA 3DFLA 1E1RD 1HB0B 2GT8A 1ZGIA 1C2HA 1O33A 3A80A 1AZ8A 3TU7H 1QA0A 1TYNA 1XUHA 3P8OA 2XC5A 1RD3B 3RC6A 1WCZA 1Y3UA 2I6SA 1C4Y2 3LGTA 4GVUA 2ZF0H 1PYTD 2FYQA 2BVSH 2TIOA 3KQEA 3GCHB 1W0KD 3MNCA 4IMZA 1YCPK 3U98H 2UUFB 3RDZA 1P10A 1UVPA 2ZTXA 1K1MA 1KLIH 2H9EH 4XRNA 1B7XB 3GCTF 3MH5A 1AB9B 1FPCH 1UTOA 1DS2E 4P02A 4TWWA 1C1RA 3GCNA 3I77A 3KQCA 2XNDD 5FBEA 2R3YA 5C0TA 1HV7A 1TGCA 4FXGH 1LVBA 3VG8A 1LDTT 4FUFA 1C1TA 1W11U 1AGJA 4AFSA 2BY8X 5HIZA 1HRTH 1NU9A 1TRYA 1ZTKA 2YMSB 1FIZA 2W7SA 1ZZZA 1EJAA 1AFQC 3QDZB 1BBRE 5FX6A 3M7TA 2D1JA 4AOQA 3LOXA 3VXEH 1H1BA 4TSFD 1GHBF 2O8LA 5I46H 1S82A 1SLVB 1XXFA 1ELDE 3MO3A 4Y0YE 5EPNA 4BTIB 5DGJA 1O3LA 1ELFA 1Y5BT 2WV4A 2WPIS 1BDAA 2SGEE 3UTUH 1GJBB 1AUJA 1GBJA 3EAJA 1E37B 5HGGA 1EAXA 1ACBE 4Y8ZA 4YESB 3TNTA 3Q77A 1WDIA 1Y8TA 3F2FA 3PTNA 1BHXF 3RMLH 1IOEA 1EJNA 4RI0A 2J5UA 3LC3A 1XUIA 1K1PA 4DOQA 3GCTG 4WY3A 1PYTC 2FIRH 3SQHE 1C5RA 1TGNA 3STJA 1Q2WA 2OD3B 3E90B 2VVCA 3BTWE 4DJZB 1QNJA 1GVKB 3FOAA 5EJ1A 1N8OB 1QL7A 4AGJA 1SC8U 1TONA 4IC5A 4JZFH 1SFIA 3E6PH 1XX9A 1RTKA 4Z0KA 1MQ6A 4WMEA 4Y8YA 5LPRA 1CA0B 1O3MA 1GDQA 4IMQA 2XCNA 2TGAA 1GHBG 1GBIA 1C2MA 4D7FA 1RFNA 1G37A 3KIDU 1GI3A 1QR3E 3A7ZA 1DY9A 4Y71A 1CHGA 2OINA 1SR5C 1NFYA 2P16A 1ZRBA 2BXTH 1AMHA 2STAE 3ATIA 4H6TA 3SV7A 1DPOA 1QJ6B 3A81A 1KDQB 2A32A 4INLA 1M9UA 2I6QA 2ZWLH 4DIIH 1CU1A 1GJ5H 1O2TA 3OSYA 4BAQB 1QURH 2NU4E 2PGQB 3KYFA 4RSPA 3PMJA 2SGDE 2ZO3H 1G30B 1FV9A 1DUEA 1EZUC 1YPJH 3ATMA 4X8SH 4XD7D 5JBAS 4DG4A 2Z9GA 3RP2A 4BAHB 3UNSA 5C67A 1UTJA 5AHGH 2PSXA 2VWOA 1GBHA 1EOLA 1WTGH 2BLWA 2LPRA 2WPJS 1DLKB 2VB0A 2WV5A 1NESE 1SGTA 2ZFSA 2TRMA 2SGPE 3Q3YA 2VIVA 1K1NA 4CH8B 8GCHG 3RXQA 2H1UA 4LK4A 3A7WA 3BEFB 3G01A 3SNDA 5C0UA 2B8OH 2W26A 2R3UA 1E1QD 4Y7BA 2C8ZB 1B0EA 1OP0A 4CH2B 3KN2A 1P57B 2A1DB 1LHEH 1P04A 2J34A 3RLWH 2BYAX 2L74A 2Z9JA 2AGEX 5A8YA 4X1SU 1SQOA 3LGIA 4RKJB 2HOBA 2D2DA 1QGFA 3WWBA 1ETSH 4J1YA 1N6XA 3RM2H 1AZZA 3URCA 2PR3A 3ZZ7A 3MO9A 3T29A 2EQNA 3FP6E 4A1XA 1GBLA 5J4QA 5KEDA 3KNXA 5FPTA 2FODA 4Y10E 5DSFA 1ARBA 4XOJA 3ZVGA 3MU4A 1SGPE 1S85A 1GJAB 3BIVH 3RXSA 1VR1H 2UWPA 2ZIQH 1TGTA 1A61H 1OWJA 4OS1A 1J17T 3FZZA 3TH2H 4UFDH 3GDSA 3TJOA 4MNVA 3F3BA 2FI4E 1H9IE 4ABEA 3M36A 2YMSD 1AI8H 1IHTH 1LMWB 3T27A 3KF2A 1Q3XA 2G5NA 1SLUB 3U1JB 1VJAU 3MWIU 3OFND 1MBQA 3F0OA 2TPIZ 4KP0A 1ZYOA 4D7GA 3MOCA 1H8HD 1NC6A 1TNKA 2GD4B 2ZU5A 2AIPA 1DY8A 1IQKA 1UCYK 4DW2U 1HJAB 2FOGA 2SNVA 7KMEH 5EU8A 5KECA 3SORA 1C5QA 1EQ9A 2ALPA 3PRDA 3T26A 1O39A 4NWLA 1V2MT 2C4FH 1FUJA 1CGJE 2W6JD 2G81E 4TYDA 5E0GA 2Q6GA 1Y59T 1SMFE 5JB9S 3SJIA 2NU0E 1MCVA 1L1NA 1N6YA 3GCHC 3LPRA 5EXNA 1E35B 1AB9C 5EG4A 1O30A 2J4IA 4LZ1H 2XBXA 4CRBA 1HPGA 1GJ7B 2BHGA 2PTCE 1W14U 1Z6JH 2F9PA 3W95A 1FZZA 2IPQX 2BDYA 2C8WB 1ELVA 2PV9B 3UNQA 3ZVEA 2ZHEH 2XC0A 1THRH 2FEQH 2ZHWH 3TLOA 5CE1A 1QA7A 2Y5FA 2YMSC 2ZTZA 4UE7H 3SI3H 5LPFA 2B7DH 1C1VH 2ZCKP 1C1SA 2XWBI 2ZHFH 3SGQE 2BD2A 3ZIAD 4WXIA 5DP8A 3STIA 4HGCA 1MAYA 1MZDA 1SL3A 2R0LA 1IQLA 1LVMA 4Y79A 1QFKH 2AGGX 3OX7U 1O2ZA 2DUCA 4E7NA 1HAPH 2QF4A 4WMDA 5B6OA 1PPFE 4NA8A 1NN6A 2V6NA 1BJVA 1HCGA 5F8XA 1BITA 1P2OA 4GPGA 2PHBA 1C5WB 1G9IE 2ZGHA 1GBMA 4YTAA 4ISOA 2BZ6H 1P9UA 1RXPA 2UUKB 1ETRH 2D26C 2G5VA 1S5SA 1SB1H 1Y5UT 2FESH 2WHXA 2KX4A
chains in the Genus database with same CATH topology
4M7GA 1P11E 4WVPE 3SGBE 1C5YB 1J9CH 1P2IA 1SOTA 3BTDE 2XYAA 2PUXB 3RXGA 1TRMA 4H4FA 1OOKB 1BTYA 1N8OC 3BEUA 5DP7A 2YNBA 4X6MA 5HM9A 4BTTB 1YBWA 2BD7A 4VGCB 1O3FA 2GDDA 2FX6A 1YPHE 1C5MD 2GGVB 3NUMA 2XBYA 1T7CA 1SGEE 3P8GA 1XKAC 1Z8GA 2J38A 7GCHF 1ORFA 3KHVA 1KTTB 2SNWA 1CA0C 3TGIE 2H9TH 1TX6A 2J2UA 1DX5M 2NU1E 2XBVA 3SW2B 1NU7B 1F2SE 3DT0H 4F4OC 3LGVA 3S9BA 5K7RA 1O5GH 1A0JA 4UFEH 4JYUH 1CSOE 2FOFA 1FLEE 4BANB 1P9SA 5JBTA 2VINA 3P95A 5LH8A 1BTWA 1D3TB 2B9LA 1GHYH 2ZDKA 3GISB 3SU5A 1O2NA 1JIMA 1JWTA 3JZ2B 1UTQA 4CRFA 3P70B 4UONA 1GHXH 3AW1A 3O8CA 1XXDA 3P8FA 1KTSB 3ESTA 1QL8A 1WQVH 2ZHQH 1BZXE 1TE0A 3SUGA 5L2ZH 1BRUP 1H9LB 2VIWA 4CRGA 5ESBA 1EZQA 3RXOA 2HALA 4IN2A 5JBBS 5ABWA 1FAXA 1TPPA 1HIAA 2BQ6B 1BTUA 3SV2H 2VVUA 2R0KA 4LOYH 2VIQA 2WPHS 1BUIA 1ELGA 3PWBA 4MQAA 1MTWA 2ANKH 5DP3A 1O3GA 4ZXXH 5GIBA 2AMPA 2IN2A 3NKKA 1NRNH 4UFFH 5A0AE 3UOUA 1XUKA 2QF0A 3C1KA 1QBVH 1O2HA 1D9IA 1UTLM 5GXPA 5C5NA 5C1XA 4U32A 1EJMA 3D49H 4I8LA 5PTPA 1C1MA 5BRRE 1P12E 1UTNA 1UCYE 1Y3WA 5JPMH 2H9HA 2IPHA 4INKA 1WSSH 1V2VT 3PMBB 2QGRA 8LPRA 2CHAB 2HRVA 2W5EA 3HGNA 1S0RA 4X8VH 4XFQA 5C5OA 2UUJB 2VH0A 1A7SA 1K28D 3FP7E 1TPOA 2FS9A 1F5KU 4JMYA 4O03A 1YCPM 1B0FA 3AW0A 5EW1H 2AMDA 2A2XH 3GY7A 5LPEA 2C93B 1ID5H 3LGUA 3ZZ4A 5AFYH 3PM3A 1SOZA 1K1OA 2ANWA 1XUJA 1C9PA 2D8WA 4K60A 2EI7A 2ZGCA 4ZKNU 3W94A 1V2QT 1P2KA 4FUGA 1GWAA 3SNEA 2OC1A 3KL6A 1JRSA 2BDBA 4GHQA 3UREA 1VCPA 2O8TA 1C1OA 3TIUA 1GHWH 4I8HA 1SQTA 4ABJA 2STBE 1A5IA 5DKMA 3TVJB 3VB5A 1YP9A 3MO6A 2VNTA 1HJAC 2AH4X 1MZAA 2ZQ1A 1S0QA 2TGTA 2JH5D 1TBZH 2G8TA 3A86A 3GDUA 3M3SA 1V2ST 2KAIB 3RXBA 2ESTE 2GCHF 2HPQH 5GCHF 1O5EH 3A8AA 3AAVA 4MNYA 4B2BA 2DE9A 1FY5A 1UHBB 2TGDA 2GCTB 1EAIA 4O3TA 2CJIA 3F9EA 2UWLA 4B2AA 2Q6DA 4CRCA 3BTTE 1PQAA 1CGIE 4KKDA 4X1RU 1AHTH 2HLCA 1L0ZA 1MMJN 2ZZUH 1PJPA 1T4UH 1XUGA 4MTBA 5C1YA 3MTYA 3U69H 4OGYA 4YM9A 2A5AA 3M7UA 4FUCA 3M3VA 4CHAB 3MI4A 1F0SA 3M5OA 3RC4A 2J95A 1GL0E 1KXCA 2V0BA 4MPWA 3UQVA 5AVDA 3AASA 3QLPH 1OYTH 2BTCE 3RXEA 4CRAA 2Q6FA 2SGAA 4YO9A 3VB4A 2W7UA 1KXAA 2BVRH 4OS7A 3SJ8A 6GCHF 3PB1E 4NIYA 5T6FA 2Y7ZA 1G3EA 3V0XA 1S81A 4NZLA 4THNH 5ETXA 1ESTA 5FAHA 1Q31A 1O3JA 2ZPSA 1JRTA 1KDQA 3TJVA 7LPRA 1AU8A 4CRDA 1LHDH 3RXCA 2PSYA 4RKOB 1MD7A 1F7ZA 1JXPA 2GCHG 2IJOB 2P94A 1NO9H 5GCHG 1CHOF 4AGKA 4X1PU 2XNIA 4NSVA 4FU7A 2F9NA 1O34A 1HAZB 3H7TA 1GMCF 1O3KA 1T31A 5FPYA 2GMTB 1ELBA 2W3IA 2CN0H 1FDPA 3SU6A 1P06A 1C1UH 1EB2A 1SI5H 1OX1A 1SVPA 1HAIH 2J92A 2OUAA 4I31A 3C27B 4VGCC 3HK3B 3MMGA 2V3HH 4Y0ZE 1BTXA 4AG1A 5E0HA 3VB7A 2BQWB 1A5HA 3T62A 3ZVBA 2M5TA 2R2WU 1H8IH 1GL1A 4IGDA 1XVOA 1F0UA 2A7CA 4X6OA 3V12A 1XVMA 1FY8E 1KXDA 1VJ9U 6CHAC 2FOAA 3ZZ3A 3BEIB 1H4WA 6GCHG 3UOPA 3MNBA 1DM4B 1LQDB 3VFEA 1PFXC 1TA6A 1O35A 1C2KA 5EQQA 1ZSJA 4B73A 1A1RA 4A1TA 3MU5A 3ZVFA 3LH3A 4FU9A 1GDNA 1CE5A 2BDIA 1Y3YA 2XCFA 3A8BA 3RXJA 1EP6A 1HLTH 4FUJA 1CHOG 2FTLE 2PTNA 1LO6A 4ABIA 3LH1A 1Z6EA 3BSQA 3A7TA 3NCLA 1HXFH 1GMCG 5EODA 3PTBA 6ESTA 2ZDLA 1HAGE 3E16B 1ZTJA 3FANA 5HXFA 3LKWA 3OTJE 8GCHF 3M5NA 3ZZ8A 1AWFH 2F9BH 4U01A 4JYTA 2ZFTA 1O2WA 4CREA 2VIDA 2ZFRH 4E05H 3PV4A 1O2QA 3E8LA 3A7XA 3ENSB 3QZQA 1QRZA 1Z1IA 4R8TB 3RMMH 2ZNKH 1A46H 2PLXA 2WINI 1S83A 3Q76A 2B5TB 1GCDA 4A5TS 2GX4A 1CO7E 1QBOA 1TBRH 4BXWA 1AWHB 1GBBA 2WYJA 1ZHRA 3KGPA 2FTMA 1WU1A 5LGOA 2BMGB 1DE7H 3RMNH 1G36A 1ELAA 1G3BA 2EA3A 2GV6A 1GJ6A 4CBNA 2Q1JA 1O38A 1TPSA 3K65B 4WF8A 4NZQA 3FAOA 5FHTA 1RTFB 1GMHF 1H8DH 4K1TA 1P2JA 1BT7A 2XW9A 1PPZA 1Z1JA 2CHAC 2C8YB 1V2RT 2BY5X 1IQHA 3H7OA 3O8BA 1O2PA 1HJ9A 4OGXA 4DIHH 2EI8A 1C1QA 4NWKA 2F3CE 4FUIA 2BY7X 3GCOA 1RTLA 1ANCA 1SGFA 1SGQE 3EGKH 1KSNA 4FVBA 1GJDB 1LKAA 3HKJB 4Y11E 3UUZA 2Z9IA 1RIWB 2ZTYA 3ATLA 4NGAH 1MCTA 1DANH 4GUXA 2OBQA 5EW2H 1QIXB 1BA8B 4LXBH 4I8GA 2P8OB 3F9GA 3P6ZB 3HKIB 1PQ8A 1MH0A 1ZLRA 3ZYEA 3TGJE 4AX9H 2FI5E 2F91A 4BOHA 2ZFQH 1EP5A 1IHSH 1GHVH 1N1LA 1D6WA 1QB1A 5ESTE 3RU4E 2RA3A 3RXFA 1UTPA 4FUBA 2BLQA 3SBKA 3ZZCA 1QHRB 3UY9A 2P3TB 1LPKB 3K6YA 1EX3A 4XDEA 2Z3EA 3MU8A 3V3MA 3QGJA 1HDTH 1P8VC 1YLCA 1GMHG 1QB9A 3B9FH 1TMTH 3FZDA 1LQEA 2JETB 1O3IA 4TPYA 1ANDA 3QK1A 2UWOA 3ZVAA 3ZZ6A 4K5ZA 1GJ9B 1MD8A 1LHFH 1FJSA 1BQYA 3MNXA 3RUOA 2BDCA 5DK1A 3L33A 3RXLA 3NK8A 5HYOA 2GCTC 4X2WA 1OPHB 5CHAB 5DP4A 4X6PA 4J2YB 3OYPA 1C5SA 3ELAH 1FY1A 2H6MA 5BPEA 3RXTA 8ESTE 8KME2 1QB6A 1W0ZU 3QUMP 2FOCA 3LGWA 4WH6A 1J8AA 1BTZA 2A4OA 5L2YH 4FUHA 1YLDA 2ASUB 1O2GH 1O2LA 1W3CA 4CHAC 2FI3E 4AORA 1C5ZB 4X8TH 2VGCB 3F6UH 3SJOA 2AMQA 4TY6A 3PMAB 2QYIA 2WUBA 1HAVB 1MAXA 3ODDA 1GHAF 1O2JA 1TGBA 3IITA 2OCVB 1RRKA 3UQOA 3P92A 4CBOA 1VCQA 2A31A 1AVXA 1MKXK 3BV9B 4WJG2 1WUNH 4SGAE 1GJ8B 1K9OE 1TWXB 5JBCS 1YYY1 3RU4T 5EXLA 4F49A 1A2CH 5EGMA 1Z71A 2OC7A 3RC5A 2ZDVH 3MHWU 3PO1B 1MKWH 1W2KH 1W8BH 2HPPH 1NM6A 2A2QH 1DICA 1FN6A 4JZIA 1K22H 3K6ZA 4Q80A 1WTHD 3DA9B 1GG6B 4OS6A 4INHA 4K8BA 1OXGA 1HGTH 2GMTC 3VPKA 1V2OT 5A0CA 1TFXA 2FX4A 7ESTE 1EATA 3BIUH 1F0RA 2PKAB 1SG8B 4DCDA 1GCTB 1AY6H 4MPUA 3ZV8A 1GDUA 4ABBA 2ZG0H 3IG6B 3E3TA 3EA8A 3CENA 3EA9A 1K1JA 2QIQA 4KTSA 5E8EH 1RS0A 3BTGE 1TIOA 1SGCA 4X2YA 1GHAG 1AKSB 4Q7ZA 1P2NA 1CQQA 1D6RA 4Y76A 1IQGA 4QT8C 3S7HB 1AD8H 1ZMNA 3BTHE 3PLBA 1KXFA 2SFAA 1TAWA 1Y5AT 2RG3A 3TH4H 1O3BA 2A4QA 1SSXA 3SZNA 3VB6A 1GJ4H 4MPVA 4DY7B 2QXHA 3EE0B 4HZHA 1C5NH 2GTBA 5DJ7A 2PGBB 1JBUH 2AYWA 3KEEA 3A89A 4Q7YA 1P3EA 1S6HA 2FS8A 2GZ7A 1ZOMA 2ANMH 2G4UA 3BG4B 4BAKB 1ZTLA 6LPRA 2FOEA 2CV3A 3RXMA 2ZP0H 1W10U 1ELTA 4JZ1A 2Z9KA 1C2JA 1O36A 1PQ7A 2OLGA 4AFUA 1IAUA 1UVOA 9LPRA 1C2GA 1AO5A 1A4WH 4ISIH 1FY3A 1L1JA 3RXKA 4MNXA 2P59A 1AN1E 2ZU4A 3LJJA 1GBKA 3QGNB 3LJOA 4ABGA 1QCPA 1ZJKA 3M37A 2FOMB 2F9OA 1TPAE 1K21H 1IQJA 1DDJA 1ARCA 3T28A 4Y6DA 1IQFA 1OWKA 2BD8A 5TJXA 1FQ3A 4D76A 1W13U 4YOGA 3F1SB 1EZXC 1EPTB 1WAYB 4XBCA 1L1GA 1ZMLA 1FXYA 4MPXA 3EA7A 1C5XB 2VU8E 4B1TA 1EKBB 4K1EA 1SGIB 2TBSA 1C2IA 1DWBH 4A6LA 3U8RH 1CT0E 1F92A 3SU4A 3DFJA 4NSYA 1P05A 1T8MA 1U6QA 4JK5A 4X8UH 5H4IB 1DT2A 3KCGH 3P17H 2KAIA 1JOUB 2A4GA 1HAYB 1AVWA 1O2KA 4FVDA 2A7JA 2QY0B 1NTPA 4YT6H 2P95A 2PKSB 1F5LA 4IBLH 1UHBA 2OTVA 1ZSLA 2AFQB 2ZPQA 5FCKA 1C2FA 3UIRA 2DE8A 3URDA 2BX3A 4DVAU 2GDEH 3RXHA 5JYIA 2ZGBH 4Q7XA 1IQNA 3LDXH 5TCCA 4AFZA 2G00A 5G4BA 1OP2A 3VEQB 3RXUA 1AIXH 3CS7A 3TJNA 1RIWC 3SNBA 2QXIA 2R2MB 2G52A 1WBGB 2EC9H 4ZKOU 1T4VH 2G4TA 1LHCH 1JMOH 4JYVH 2P8OC 2QXJA 4X1QU 4FU8A 1PPEE 3U8TH 1SBWA 4HTCH 1V2NT 4BXSA 1HBTH 3SJ9A 1FMGA 1P03A 2J9NA 1Z8JB 2FDAA 1P01A 1MTUA 1SGFG 3V7TA 1O32A 4U2WA 3PLPA 1A3EH 1PPHE 1C5OH 4CR5A 4XSKU 3A7VA 4BAMB 4IW4E 1DUAA 2JETC 1CGHA 1ABIH 4D9QA 3MU0A 2OXSA 2FXRA 2VJ1A 3T25A 1MUEB 1YM0A 3SV6A 1NFXA 1NZQH 3NWUA 1TQ0B 1O2MA 3MNSA 1O3OA 1UTMA 4WWYA 3HPTB 4OS5A 1DXWA 1O0DH 5CHAC 5AFZH 3UR9A 4A1VA 1AE8H 1Z8RA 4I7YH 1O2XA 2QA9E 1QRXA 4YLQH 5GDSH 2FP7B 3RXPA 2O8WA 2ZA5A 2P93A 1HYLA 3TPIZ 1ZHPA 3KQBA 4KTUA 3ZZBA 1ZPZA 5A09A 3PMHB 2B0FA 3SU2A 2VGCC 2ZKSA 3GY3A 1ESBA 1VITH 4BAOB 4ABDA 1C5LH 1V2UT 4Q2KA 5EOKA 1J14A 2PFEA 2HNTF 1THSH 1GI6A 4OS4A 3PWCA 5HM2A 3BN9A 2RDLA 2Y81A 1BB0B 1EAWA 2CXVA 3SUEA 1DSTA 1MTSA 2F9UA 4B71A 2J94A 3TH3H 2OBOA 4YZUA 5A8XA 1EAUA 2ULLA 1AQ7A 2R9PA 1P02A 3VGCB 4XBDA 3NXPA 3PO1C 3UFAA 1P3CA 3UWIA 2EI6A 2Y80A 4YOIA 1BRBE 1KIGH 1FAKH 1CVWH 1SHHB 1TALA 4ZXYH 1GBTA 3M61U 1GG6C 2XC4A 3TGKE 3CP7A 1QL9A 1MBMA 1YPGH 1BBRH 3QTOH 1DVAH 2A0QB 5T3HA 4OS2A 5J4SA 4TWYA 5DO4H 1V2KT 2BDAA 4ZMAH 3D62A 1ZHMA 4GCHF 2ZDAH 1O2RA 1GCTC 3SUFA 1S84A 1OKXA 2FO9A 5DPAA 2QN5T 3SU3A 1HAOH 1EOJA 3LIWA 2ZFPH 1O2IA 2TGPZ 4I32A 3SJKA 1F0TA 1T8OA 1XM1A 3U1IB 1DITH 2H5CA 3T5FH 2A45B 1WYKA 1THPB 1TNIA 3MU1A 3EQ0H 2FOHA 2BXUH 2HVXA 1P0SH 4YOJA 3GYMA 3O8DA 1YPKH 2Z3CA 1V3XA 1NPMA 3AAUA 2BLVA 5GJ4B 1IQIA 1BMAA 1PPCE 3VB3A 4Y7AA 1T8NA 3A88A 3K9XB 3UR6A 1WV7H 3M5LA 3ZZAA 1E0FD 3DHKH 3K2UA 1O5CB 3BTKE 1E34B 1UO6A 2BX4A 3BG4C 1GI2A 4IN1A 1DFPA 3PYHA 1UK4A 4B75A 1OS8A 1VITF 2ANYA 1BJUA 2ZI2H 1NS3A 4GCHG 1BTHH 1ZRKA 3OU0A 1UK2A 3GYLB 4ZHMU 3L3TA