1Y5BT

Dianhydrosugar-based benzamidine, factor xa specific inhibitor in complex with bovine trypsin mutant
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsin, cationic
publication title Understanding binding selectivity toward trypsin and factor Xa: the role of aromatic interactions
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2004-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1y5bT01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1y5bT02
4CRCA 1GHBG 3NK8A 1QCPA 1ELDE 2W3KA 1UK2A 1JIMA 2PWXA 3SI4H 4AN7A 4WF8A 2ODPA 2QV1A 2OD3B 2ZGJA 3U8TH 2BTCE 5H4IB 5EXMA 4AYYB 5C67A 3QTOH 1DICA 1V2OT 2ZFQH 3BTFE 3KCGH 2A7CA 1FONA 1YPEH 2YOLA 1V2WT 1N8OC 1MZDA 1FN6A 3M3TA 5J4SA 3ATIA 1EJAA 4I31A 5L2ZH 3T25A 1SGQE 2BDGA 3PO1C 4WH8A 3KN2A 1C1OA 3EDXB 3ZZ8A 4CBOA 1ZR0A 3TH2H 1EAXA 3MH6A 4YT6H 1TYNA 2ZQ1A 5LH8A 1C4U2 1GBIA 1EATA 2BY7X 1NFYA 4Q7YA 1QA7A 2GVFA 1GDNA 1C5TA 1OP0A 1GI2A 1KLTA 1EASA 2ZU1A 1SR5C 1UVUH 1NROH 2G4TA 1QBNA 2NU4E 3SBKA 1EAUA 2HNTE 3MFJA 1A0JA 3LGUA 3MH4A 1O5GH 1KXFA 2B7DH 2A7JA 3T26A 1V6DA 1YGCH 1ABJH 3GCHB 3C27B 3SQEE 2ZQ2A 1PFXC 3KEEA 4U2WA 4R0IA 3RU4E 2A4GA 4IC6A 3K2UA 3O8DA 1GBTA 3PLBA 5B6OA 4I8LA 1NRRH 1CVWH 1P57B 3LC3A 1Z71A 1WCZA 1C5OH 1CGJE 1QQUA 2OQUA 3W94A 2Z3CA 1Q2WA 3KHVA 2AIPA 2WV4A 1Y3VA 3SJ8A 3B23B 1H9IE 4MNVA 3Q00A 7KMEH 3SO3A 5A0CA 1IHSH 3P8OA 1MCTA 3SGAE 1CBWB 1W7GH 1EZXC 4YZUA 3PMBB 1FZZA 1IHTH 1XVOA 1MU8B 4AB9A 4D9RA 5LGOA 3UTUH 1G2MA 4MLFB 2FO9A 2XTTB 1PQAA 2NU2E 1MD7A 3BTEE 4DY7B 1D3TB 2P59A 4CR9A 2P94A 4LZ1H 1FUJA 1IAUA 5GWZA 4UFDH 1GHAF 1BRAA 3A7TA 1P01A 4Y0ZE 1GG6B 1B7XB 2CF9H 1NPMA 1ELEE 1NM6A 3LONA 1QHRB 3RU4T 5AHGH 1NRPH 2ZF0H 3E90B 1P3EA 4GVUA 4A1VA 1H9HE 1C5NH 4CH2B 2GMTC 1O2GH 2ZDLA 1Y3UA 1C1WH 1CQQA 1TMUH 3E6PH 1XXDA 5L6NH 1AZZA 3GY5A 2VH6A 1O3EA 1KXAA 4K2YA 1AB9B 4E05H 1O3DA 3SV7A 3T62A 4INHA 3BTKE 2GZ9A 1O39A 1W12U 5E0HA 2F9OA 3TITA 1HLTH 4FVBA 1INCA 3PTBA 1C2EA 4YESB 2Q1JA 3WY8A 1ZHPA 3BTDE 3UNSA 2PUQH 4NA7A 3ESTA 2XNIA 3P92A 1C2MA 1WTGH 2F9BH 3AAVA 1UTPA 1NRNH 2VJ1A 4WJG2 3UWIA 4AYVB 1PPGE 2ZU3A 4I8HA 3H5CB 5JBAS 1P2KA 1ELCA 1SGFA 2ZGXH 4BNRA 3OU0A 4AFUA 1CA8B 4HI3A 2R0LA 1JIRA 2WPKS 1NU7B 2F9NA 2JETC 1O3LA 4Y76A 2BX4A 3MWIU 1SFIA 5ABWA 1PPHE 4TYDA 2VNTA 1W0ZU 2XYAA 1MU6B 1AU8A 2QF0A 3HGNA 1HCGA 4X0WU 3D49H 1AHTH 3BTTE 2CF8H 2BQWB 4KTUA 1MTUA 5TCAA 3ZV8A 3RXFA 1UTNA 1O2HA 1IQGA 1XX9A 3LOXA 4K1TA 2STBE 1EPTA 1YCPM 3GISB 3E1XB 3F1SB 1YPMH 1CHOF 1AWHB 4A7IB 5EPNA 5FPSA 4TY6A 4YO9A 1P2OA 2HPPH 3UFAA 1C1VH 4I32A 1N8OB 3KIDU 2BY8X 4DCDA 1Z8GA 2J92A 1LKBA 1K22H 2HOBA 3RP2A 1BDAA 1G2LA 2BY9X 8KME2 2ZFFH 3PO1B 5FPYA 3ZVDA 1BHXB 3K6YA 3BIUH 3U69H 5JBTA 1IQKA 1AVXA 1PPCE 1VCQA 4FUDA 2SGAA 5FHTA 1CT2E 2CN0H 1HAVB 1FNIA 3GCTG 5A8YA 1TNIA 1ZTKA 4IGDA 1THPB 2VB0A 2CV3A 1AY6H 3ATKA 1OYQA 3LGVA 1OP8A 1TRYA 3SU2A 1YM0A 5EG4A 3ZVCA 3GY7A 2ZDKA 1AKSB 2A4RA 2FZZA 1CE5A 1H8IH 4MQAA 8GCHG 1WOFA 1UCYE 7GCHF 1TGSZ 4IMQA 1EB2A 1W13U 1FY5A 3RXEA 2GP9B 5C1UA 3A7VA 1A5HA 1TONA 1MQ6A 1GBCA 1P09A 2FOEA 5EW1H 1SGYE 3F9GA 4OS7A 4O9VA 5JB9S 1BZXE 7ESTE 1HAHH 2C8ZB 5FCRA 1E35B 2ZDVH 2PSXA 1MH0A 1DM4B 2R3UA 2GCHG 3A87A 1P2QA 1GI5A 3MYWA 1ZSKA 1TBRH 4K3JA 2WINI 5EU8A 4X2WA 5T6FA 4LZ4B 3HK6B 1O2ZA 5G4BA 3U1IB 3GCNA 1TFXA 3V0XA 1RFNA 2GCTC 3EA9A 3KQCA 5EXNA 1C2HA 2Y81A 3DA9B 5AVDA 1LVYA 2BOHB 1IQHA 1ELBA 1L1NA 2ASUB 1K1JA 1LQDB 3QDZB 1ZLRA 3QK1A 1T4VH 2QIQA 1TNKA 1O3OA 2C8XB 3K9XB 2HGTH 2LPRA 1BMLA 1H8DH 2H9HA 3ZZ5A 2W5EA 1UTJA 4UEHH 4INKA 5F8ZA 3M7QA 1TX7A 1UTLM 3KQEA 2B9LA 2PKAA 4AZ2B 3URDA 2GMTB 3G01A 8LPRA 3TVJB 1MAXA 1P9SA 5EQQA 4JMYA 2PTCE 1MKXK 1GMCG 2V0BA 3V13A 1P12E 5C2ZA 1WAYB 2P8OB 2ZPSA 1TLDA 4WMEA 3GDVA 1GCDA 2FOHA 2OQ5A 4FUEA 1BRCE 5IYTA 2HVXA 1ETSH 1FXYA 1MD8A 2AGGX 3BEUA 3BTGE 3U9AH 4BTUB 3RXPA 2ZWLH 1KDQB 1LO6A 4ZROA 2A7HA 3M5OA 3RC5A 3UWJH 3UNRA 3RU4D 2KAIB 2FOFA 2UWPA 5AFZH 3QZRA 4MPXA 2JH0D 1W8BH 2BVXH 4X8TH 4IBLH 4F4OC 1C1TA 1C2KA 1DDJA 1O36A 2RDLA 1IQNA 3O8BA 1JRTA 4X6PA 4DG4A 4JZEH 2A5IA 5FX5A 1C5RA 3E16B 5EOKA 2FI5E 1LPZB 4THNH 2XWBI 4QT8C 3IG6B 1V2PT 1D9IA 3AW0A 3KQBA 1GL0E 1AVGH 2BD9A 3GICB 1V2UT 2AS9A 8ESTE 4RN6A 1L4DA 1L1GA 1O5FH 1RIWB 4ABBA 1ELTA 1RTKA 2FDAA 1AGJA 1C2JA 5T3HA 1GHBF 1TPOA 4CRDA 1V2ST 3M5NA 3PMAB 2ZU4A 3A83A 2AYWA 1GJ4H 4CR5A 2BLQA 1DX5M 3VXFH 3QGNB 1CU1A 4Q2KA 4NCYA 1ID5H 1Z1JA 2Y7ZA 4KTCA 2AMQA 3TK6A 1BTPA 1NC6A 3GCHC 3DD2H 1O5BB 3DHKH 1AFEH 1O33A 1S82A 3PMJA 2IPHA 1UTMA 1QL8A 1O2QA 3C1KA 2P3UB 1S83A 1NRQH 4INLA 1HJAC 2FLBH 9ESTA 1C1RA 3PWBA 2GZ7A 3A7ZA 2FODA 2Z6BD 1O2VA 5FPTA 1SHYA 1HNEE 1MTWA 2XWAA 1YPJH 1NZQH 1AQ7A 3A80A 1BB0B 3ZZ4A 5A09A 1AE8H 2GT7A 4FUBA 1WQVH 1E38B 3SNBA 2VIWA 5DK1A 3RXUA 1O2UA 5AFYH 2FEQH 1O2TA 4BXSA 5ESTE 2OC7A 1M9UA 1GBKA 1O38A 4HTCH 2FWWA 3PTNA 1Q3XA 1GVKB 3DFLA 4TWWA 5J4QA 3CS0A 4YOGA 1GHYH 2PGBB 4CREA 1NS3A 2BD7A 1K21H 4WWYA 2VWLA 1DWBH 2FYRA 5JB8S 5DO4H 5DKMA 3IWMA 1FAKH 4I7YH 4DT7B 2WYJA 4BANB 1RXPA 2HNTF 4MVNA 1C2FA 1TOCB 4A92A 4ABIA 1O3NA 1NTPA 2SNVA 2VIPA 1GI1A 3FVFB 1DFPA 1O34A 2Z9LA 4FUIA 2ANKH 4NIVA 2AGIX 3LDXH 1VGCC 3LKWA 4DIIH 4Q7ZA 2VVVA 1ZHRA 1E36B 1XUJA 1V2TT 3RM2H 4WXIA 1O2NA 2FM2A 1EX3A 1YPLH 1GJBB 2QXGA 5EPYA 1XVMA 1EJNA 2OUAA 3SJOA 2VU8E 1GJ7B 5FBEA 2GKVE 2NU1E 1SQAA 2GCTB 1QY6A 1SGCA 1THSH 2XRCA 4Y6DA 1JOUB 3LGIA 5HMAA 1BMAA 2SGEE 2A45B 3A8CA 1JWTA 3TIUA 2FOMB 3LGYA 2TGTA 2UUJB 4IW4E 1O2YA 1P2NA 4X1NU 1UVTH 4TY7A 5IDKA 2R3YA 1FJSA 1A4WH 3E91A 6ESTA 4KELA 4KKDA 1A61H 1MAYA 3I78A 1YP9A 1A5IA 1GWAA 4OGYA 1G36A 1ARBA 4OS5A 2QAAA 3GYMA 2FS8A 3QLPH 2XBXA 1ORFA 1V2NT 4JK6A 3ZVAA 3Q3XA 4ABFA 1JBUH 3ATLA 1TOMH 3L33A 1LTOA 4TWYA 3T28A 1KLJH 1OWDA 4X6MA 1A3EH 3VEQB 4Y0YE 1H4WA 1ANEA 1YPHC 1T31A 2AGEX 3SNAA 2ZU2A 1ZJKA 4FUFA 1D4PB 1BBRK 1E34B 2DE8A 5CHAB 1SBWA 1WUNH 2VIDA 2FLRH 3SNCA 4FU9A 5A2MH 5L30H 6GCHG 2K1QA 4Y7BA 2FXRA 3UQOA 2ANYA 2Z9KA 1S85A 5BPEA 3RMOH 1QJ7B 4FUCA 4ISHH 1GVLA 3MNCA 2XCNA 4E06H 1K9OE 3D65E 2THFB 2VWOA 1O2SA 2SGDE 4OS6A 1HRTH 1Y5BT 2AIQA 4LK4A 4A5TS 1V2MT 1UHBB 1HAIH 1LQEA 3TJVA 5DGJA 4FUHA 2TGDA 5HM2A 3GY2A 5FBIA 1C1NA 1GL1A 1SLWB 1BTYA 1GPZA 5EODA 3S9AA 5A0AE 2Y80A 4X1QU 3MNSA 3P70B 3OSYA 2BQ7B 1BUIA 2JH5D 4D76A 1OS8A 2P3FH 1G32B 2ZDAH 3OYPA 4UDWH 2HALA 3E3TA 2ODQA 3PYHA 2GV7A 3V7TA 4AFSA 4X6NA 1A0LA 1TMTH 4ABGA 4K8BA 3B8JA 4H4FA 1O5DH 3P8GA 4J1YA 3HGPA 3TK5A 5C1XA 3MO9A 1HGTH 1TPAE 3STIA 2UWOA 1HV7A 1TWXB 4B76A 2TIOA 4Y8XA 3RUOA 1OP2A 5DP5A 3RXRA 2ZCHP 2ZTYA 1GBEA 1HJAB 1OYTH 1O3MA 3A85A 1QNJA 1YCPH 2F83A 3P8FA 2EI6A 2AFQB 1ZPBA 2FX6A 1C4Y2 9LPRA 1ESTA 1TGNA 5FAHA 1LHFH 1TBQH 4GHQA 4K60A 4WXVA 1D3QB 2DUCA 1GJDB 1XMNB 1W0YH 3U1JB 3GCTF 1LHDH 5GCHG 1FI8A 2Z7FE 2BY6X 3BG8A 3K65B 1KXEA 1O35A 1QIXB 1V3XA 1V2QT 1LDTT 1BTHH 1RTFB 4ZUHA 8GCHF 2VH0A 4K5ZA 1G3EA 2PHBA 2Z9GA 1BTXA 1UCYK 1GJ5H 3PLKA 2Y5FA 4ABHA 3S9BA 1SGDE 1T32A 2R0KA 2W3IA 4NWKA 2FOCA 1IOEA 4X1RU 4CH8B 4DW2U 3AW1A 2BDYA 3GY6A 1W14U 5GDSH 1KTSB 1DXWA 1TGBA 1K2I1 3K6ZA 2UWLA 1LKAA 1S0RA 4JYVH 1GHWH 1TPPA 2CJIA 1GBHA 2GCHF 1TGTA 1H1BA 1VGCB 5E2PA 4ABDA 3EA7A 2P8OC 1N1LA 1AE5A 2YNAA 2D2DA 2VWMA 1IQIA 3EQ0H 1HFDA 1GMHG 1HUTH 2ZNKH 4ZKRU 2VIOA 4D7FA 3BV9B 3VFEA 1UTQA 2FOGA 3TK9A 1O0DH 2AERH 4K1SA 5JYIA 2CXVA 1ELVA 1SSXA 3SN8A 4Y11E 3UY9A 5LPRA 1D3DB 1QBOA 2G00A 4ESTE 2ZCKP 4BAKB 1DS2E 1HJ8A 1SLUB 1W7XH 2BDHA 4X2XA 3BIVH 4FUJA 1Y3XA 2H1UA 3ZZ9A 3FZZA 3B9FH 1S84A 2A4QA 1IQEA 2F9VA 5E0JA 1A5GH 2Y7XA 1C5VA 1GHZA 2W7SA 1A3BH 3LGTA 3RXSA 3ZZDA 1TAWA 2BLWA 3UQVA 1RIWC 2OTVA 4X2VA 1EKBB 1O3GA 3PLPA 5K7RA 1KXBA 1B5GH 1GMCF 1LVOA 1O3HA 1O31A 3ZVBA 4FU8A 1TE0A 2BXUH 1PPZA 2OLGA 1LPGB 1CHGA 2JH6D 2F3CE 1Z7KA 3AVZA 2Q6GA 3DFJA 4H6TA 3GY8A 1MKWK 5EXLA 1QRXA 3SU0A 4ABAA 4AORA 3QWCH 4Y79A 1DY9A 1BIOA 2SFAA 3BF6H 2RA0A 3I29A 1B0FA 3FP8E 1P03A 4ZKSU 2VVUA 3MOCA 1HAVA 3FZDA 3BTWE 1FPCH 1QL9A 5JBBS 3LH1A 3TGIE 2C93B 4Z6AH 1CA0C 2R9PA 4HZHA 2W7UA 3RC4A 1AKSA 1NFUA 5HM9A 1C5WB 1S81A 3PM3A 3H7TA 3SHAH 1AMHA 1WBGB 3ITIA 3BSQA 5C3NA 1HAXB 3H7OA 3I77A 1TQ7B 3SGQE 4XDEA 1P05A 3QO6A 1Q31A 1FDPA 1XUGA 5EW2H 3LU9B 1HYLA 2WUBA 4YTAA 4GCHG 1EZUC 1GBLA 2VINA 1O3KA 2ZECA 3NXPA 1S6FA 2UUKB 2J95A 4B2BA 1LHGH 1ZRKA 1W3CA 4BXWA 5ETXA 1IQMA 3MTYA 1EB1H 1YF4A 2GX4A 1FY1A 5AF9H 1GMDF 4NA8A 3VB3A 4E7NA 3GCOA 1A0HB 1DWEH 2GT8A 2OC1A 3EYDA 2P16A 2SGPE 1ZHMA 2O8UA 3P95A 2GV6A 3ZZCA 2CHAC 1XUFA 2J4IA 2TGPZ 1AZ8A 1J9CH 2VWNA 1G37A 1VJAU 1P2MA 5DP7A 1O3JA 1ZJDA 1BRUP 4NIXA 4X8VH 1JRSA 1EZQA 1OKXA 3FP6E 4ZXXH 2PUXB 2QCYA 1P11E 3SV6A 2BVRH 2TRMA 3AASA 1GI9B 4Y8YA 4D7GA 4D8NA 2C4FH 2WPLS 4UE7H 2A2QH 1RD3B 1P2JA 4ZHLU 2ESTE 2IOTA 1DXPA 3STJA 1DLEA 2ZA5A 1TABE 4AFZA 2FTMA 3FANA 1AI8H 2VIQA 4NGAH 1XUKA 2AMDA 2QN5T 1N6YA 3M3SA 5TCCA 4XE4A 3QGJA 4NZLA 1MBQA 2I6QA 4AG1A 1TRNA 1F0TA 1O2JA 4DURA 2GGVB 2ALPA 1KDQA 2XC4A 4BAQB 1BRBE 1WQSA 4ASHA 2HRVA 1PQ8A 3QUMP 4OS4A 2KAIA 1Z1IA 1UTKA 3L3TA 2B0FA 1BJUA 4X8UH 2EA3A 1C1UH 2UUFB 4B2CA 3T27A 3GDSA 1DSUA 5CHAC 1F7ZA 2ZPRA 3SORA 1CGIE 2RCEA 1RJXB 1QRZA 1GHVH 1XM1A 1SG8B 1SI5H 3LC5A 3HKIB 1DANH 4RKJB 3VXEH 2QF3A 3RXGA 2ZP0H 2Z3EA 3GY4A 4KTSA 2J34A 4U01A 1SLXB 1ZTLA 2Q6FA 2ZI2H 1GBDA 1V2KT 1VITG 2OBQA 1TQ0B 4JK5A 2PKAB 1SQOA 1IQLA 4U32A 3U98H 3SW2B 4E7RG 1FN8A 1K1LA 1C5MD 2V6NA 3L6PA 5JBCS 1T8LA 2Z9JA 1HIAA 1VITH 4Y8ZA 1VR1H 2W26A 3SZNA 5T6DA 4ABEA 4IC5A 5DP6A 1MTNB 3UNQA 2D26C 1TIOA 4X6OA 2ZCLP 3SV8A 1UK4A 1PPBH 5JPMH 1C2DA 2Y5GA 1Y8TA 3SQHE 1D6WA 1TGCA 3TGKE 1MTVA 1NESE 2FTLE 1ZMLA 3ATMA 4MPWA 5HGGA 4CRBA 2TPIZ 3MI4A 4NG9H 6GCHF 1WTHD 2QY0B 2TGAA 2O8WA 1A7SA 3F9HA 4AFQA 3R3GB 3SU4A 2FMJA 1KIGH 1O2XA 1QGFA 3A89A 1GMDG 1L4ZA 2Y6TA 3KQDA 4ZHAA 5GIBA 3ZZAA 4X2YA 3RXJA 4HGCA 5DP4A 1QBVH 5E0GA 1UO6A 1QB9A 1J16A 1L2EA 3TPIZ 1V2VT 3TGJE 3SHCH 3RXDA 3SV2H 1CA0B 1T4UH 2BLOA 1FY8E 2G8TA 1SLVB 3ATWA 5C20A 3LJOA 3UIRA 4RSPA 3S0NA 1ELGA 2BD3A 3SJKA 3M7TA 1GCTC 2BYAX 1ANBA 1HAGE 1TALA 2ZTZA 4XBCA 3LJJA 4H6SB 3MNBA 1FY3A 2ZIQH 1L0ZA 1YPKH 3M37A 2C8YB 4BOHA 3SJIA 1UVSH 2ZPQA 5DPAA 2ZEBA 4XBDA 1CO7E 1DUEA 3SNDA 2BOKA 4ISOA 4UFFH 4X1SU 5HYOA 4UONA 4AG2A 1P06A 1ESAA 4GAWA 2H9EH 4GPGA 1O2KA 4FXGH 3HPTB 2ZHEH 1PPEE 2BX3A 1DITH 4BTTB 1EP5A 4ZKOU 3MU8A 2BY5X 1O5EH 5HXFA 2FOAA 3DUXH 1TX8A 3MU1A 3O8RA 2QC2A 1Y59T 4NSVA 1AD8H 4HFPB 4R8TB 1W2KH 1OWHA 2OINA 1KXDA 3ZYDA 4TPYA 2HLCA 2CHAB 3URCA 1O2RA 3A82A 4GUXA 1AN1E 3ZYEA 1O3AA 4WVPE 1ETRH 1VCWA 5GCHF 2ZZUH 2JKHA 1ESBA 5PTPA 2PFEA 1THRH 4CRFA 1O2LA 4CHAC 2Z94A 1CSOE 4DVAU 2R2WU 2A5AA 4PROA 1C2LA 2PV9B 1Z8IB 2XC0A 3SUFA 5F8XA 1PYTD 3MO6A 1EAIA 3BG4C 1AUTC 4AGJA 1BCUH 1D3PB 2AH4X 1BT7A 4XFQA 4IS5A 4KGAA 2PGQB 1T8MA 4B74A 1FIWA 1GJ6A 3RXVA 1GVZA 1F5RA 2GD4B 3HKJB 3N7OA 1MKXH 2QGRA 3BTHE 4I8KA 1GI4A 1EAWA 4ZXYH 2O9QA 1AFQB 1UK3A 1DE7H 3RMLH 4X8SH 2IJOB 2V3OH 4SGBE 3M7UA 4J2YB 4AGKA 1ANDA 1BJVA 1VZQH 5EGMA 5GXPA 4WMDA 1GMHF 3KNXA 1QTFA 2ZKSA 1UHBA 3NUMA 2O8MA 1CT4E 3A81A 3PWCA 1XKBC 5GPIB 3TJNA 1GI0A 1QB6A 3RXAA 2OP9A 3VB6A 1NFWA 4WH6A 1ETTH 1HAZB 1D6RA 4K1EA 1FY4A 3JZ1B 4NSYA 1ZZZA 4BAMB 3TLOA 2H6MA 1ZRBA 2HWLB 2FX4A 3RXQA 1Z8JB 4VGCC 3QTVH 4NWLA 1NT1A 2P93A 1F5KU 1GBBA 2A1DB 2F91A 2ZO3H 3TNSA 3MH5A 3W95A 1SHHB 1ELFA 3LH3A 3SI3H 2ZFPH 1IQJA 3A86A 3GOVB 4UFGH 3OX7U 3A84A 3HK3B 2J2UA 1IQFA 1QA0A 4YLQH 2FS9A 1QFKH 1UVOA 1YLDA 2V35A 2NU3E 1TNLA 5DP3A 3NZIA 4IN1A 1GHXH 1MMJN 1WYKA 5A8XA 1F0SA 1EPTC 4I8JA 3AAUA 3ENSB 1ACBE 1YKTA 3T29A 1O2OA 4I33A 1OSSA 2G4UA 1PQ7A 1ZGVA 1QURH 2ULLA 2BB4A 1W10U 3E0PB 1SFQB 2F9PA 3LT3A 3UPEA 1SGTA 1LPKB 5C5OA 2ZC9H 1O2WA 3ZVFA 1PPFE 2UUYA 3JZ2B 1ZMJA 1YLCA 1DVAH 2GDEH 1C5UA 1LMWB 2ZFRH 1HDTH 1FMGA 3UOPA 2J38A 3D23A 3LGWA 1Y3WA 1L1JA 1C1QA 3EE0B 4Q80A 2O8TA 1QJ1B 2WUCA 1BTWA 5EQSA 2BD2A 1O32A 1QQ4A 2H5DA 1FQ3A 3CP7A 3RXLA 2XBVA 4NIYA 4YT7H 3S9CA 1KXCA 2A4OA 1NFXA 2ANMH 1EUFA 1GCTB 3MH7A 4ISIH 4GCHF 3A7YA 1SMFE 4DJZB 1BITA 3TU7H 4NIWA 1QRWA 4JYTA 5T6GA 1O3IA 1PJPA 1GI3A 2HNTC 4B1TA 2QXHA 2WYGA 4ISNA 2BDCA 2NU0E 2R2MB 1BTUA 2WPHS 3F6UH 1BTZA 1EQ9A 3ZZ3A 1EZSC 1SVPA 3M5LA 4ZMAH 1XKAC 5FXLA 3M5MA 3UR9A 3MU0A 3LPRA 4Y10E 4DIHH 2QYIA 2B5TB 2EI7A 1C4V2 4RKOB 2EI8A 1RGQA 3SUGA 4FU7A 3QX5H 4X1PU 7LPRA 2SGQE 3PROA 1C5PA 1GJ9B 1C5LH 4XBBA 3RMNH 3SUDA 2AEIH 2G5VA 2PKSC 3HATH 5EQRA 4JZDH 1SPJA 3S7HB 1BA8B 2ZDMA 3FFGA 3TH3H 4MNWA 5F6MA 2ZFSA 4BAHB 5ESBA 1G9IE 2YNBA 2BDAA 1CGHA 1V2RT 2G5NA 3ZZBA 4CHAB 1NU9A 4JCNA 6CHAC 1BBRE 4O3UA 1A1RA 2SNWA 1SGIB 4DGJA 3BG4B 1P04A 3D62A 4B71A 1QJ6B 1UJ1A 1TA2A 3R0FA 4K69A 1TMBH 1DPOA 2O8LA 1J14A 1BMNH 1OPHB 3E0NB 1OXGA 1DWDH 3UR6A 1UVPA 5DP9A 3A88A 5FCKA 4ABJA 1A2CH 2Y82A 1GI6A 1BBRH 3A7XA 5F03A 3VGCC 2BZ6H 1MTNC 3NPSA 1G3DA 4NZQA 3Q3YA 1C5ZB 1MUEB 2OCVB 2GDDA 4MTBA 3ZV9A 3P17H 1ANCA 1KTTB 1P0SH 3EAJA 2QA9E 5E8EH 3RM0H 2Q6DA 5LPEA 1GGDC 5SGAE 1W11U 4OS2A 3CENA 2FI3E 2C90B 1NY22 1VJ9U 1YPGH 1DOJA 4YOJA 1ZSLA 1HBTH 1QR3E 2EEKA 1GBAA 1DSTA 2ZHFH 3TJUA 1P3CA 3BN9A 1O5AB 1H9LB 4YOIA 3SJ9A 1VITF 4WY3A 1SC8U 3MU4A 1O5CB 2H5CA 3BEIB 1SOZA 2F9UA 2ZG0H 4VGCB 1F5LA 3A7WA 1HB0B 2BXTH 1E37B 4Y7AA 3RXOA 2ZTXA 1CT0E 3M35A 2V3HH 1U6QA 1ZMNA 4LOYH 1HPGA 2AMPA 1ZPCA 4I8GA 2IN2A 3KF2A 1SGEE 4CRAA 2BQ6B 1LHEH 3V3MA 4JZFH 4AX9H 4O97A 4SGAE 2PSYA 2G52A 4AOQA 2A32A 1DWCH 2D8WA 2P3TB 4GLYA 1EPTB 1S0QA 2FOBA 2FESH 4ZKNU 3UREA 1FPHH 3RXBA 1GI7B 2WPMS 3RLYH 4MNYA 1SGPE 1HAPH 1NO9H 3O8CA 3ELAH 1JMOH 3SU6A 1AUJA 2ZHWH 3BEFB 1GHAG 1PYTC 1SGNE 5I25A 1UMAH 1SGRE 1A46H 2ODYB 2H9TH 1V2LT 1C1MA 2WV5A 2Y5HA 2FP7B 3ZVEA 2C8WB 1O30A 2XBWA 4MNXA 1BMMH 1OWKA 4ZAEA 3SV9A 1GDUA 1O2PA 2TBSA 3RMMH 2BDIA 1OWJA 1EXFA 1MTSA 1GBFA 1ZTJA 2G81E 1MQ5A 2QXIA 3RXKA 1P2IA 1UCYH 5FX6A 3M61U 1T7CA 1TRMA 4UD9H 3IITA 3GY3A 3BTME 1SB1H 1C1PA 2WPJS 2H2ZA 2Z3DA 3SU3A 1J8AA 1C2IA 3EA8A 3T2NA 1C5YB 4YLUA 1P10A 4F49A 3ODFA 1UTOA 1O37A 1K1NA 3MHWU 1TB6H 3T5FH 1AO5A 1ABIH 1TA6A 1WU1A 3QZQA 1C9TA 5DJ7A 1K1OA 1K1MA 4MPUA 1AFQC 1LVBA 5C1YA 1EOJA 1HXFH 1KSNA 3S7KB 3MMGA 2FIRH 2G55A 2PW8H 1KY9A 1OWEA 3FP7E 2VGCC 3M36A 1F0UA 3UUZA 4O3TA 1T8NA 2RG3A 3VB7A 1OX1A 5A0BA 3RXCA 5JDUB 1DY8A 2XBYA 1YBWA 3RLWH 1RRKA 3OTJE 5CE1A 5GJ4B 1TNHA 2PKSB 2ALVA 3OY5U 3U8OH 3QN7A 1O3BA 3DT0H 2A31A 2J9NA 4Q7XA 1FLEE 4NFEA 1BOQA 4A1XA 1Y5UT 1EP6A 1WSSH 2ZHQH 2BVSH 1F92A 1JXPA 3NCLA 5CMXH 3PB1E 3P6ZB 4ISLA 1C2GA 2PTNA 6CHAB 1DUAA 2OC0A 6LPRA 1GJCB 1V2JT 2GZ8A 1ZOMA 4LXBH 3ZVGA 3GDUA 4H42U 5TJXA 1SL3A 3U8RH 1B0EA 5F8TA 1N6XA 1FV9A 2OC8A 4NA9H 2I6SA 1HJ9A 4WMFA 3PMHB 1CHOG 1AIXH 1ZGIA 2P95A 2ZHDA 4MPVA 3VB5A 3KGPA 1MZAA 2PLXA 4Z0KA 4B73A 4B2AA 3VGCB 1MKWH 3A8BA 2Z9IA 1C5SA 2VIVA 4NFFA 2DE9A 1C9PA 3VPKA 4JZIA 4O03A 1K1PA 1GJAB 3P8NA 1MCVA 1XUHA 1RTLA 3VB4A 1GGDB 3F68H 2XXLA 4FUGA 5DG6A 3EGKH 1ARCA 3FAOA 3A8AA 3RDZA 2JETB 1BHXF 2NWNA 2XW9A 4A1TA 2OXSA 2OBOA 1QL7A 2CMYA 3SOSA 3SU1A 5L2YH 1GBMA 2D1JA 3SGBE 4DOQA 3PV4A 3MO3A 1P9UA 1Z6EA 4BTIB 5E2OA 4MG3A 2GTBA 1HIAB 4Y71A 7GCHG 1S6HA 1X7AC 2CGAA 2EC9H 4JYUH 4K8YA 3RXIA 4ZHMU 3RXMA 1TNGA 1AVWA 2FYQA 5A8ZA 3TNTA 5BRRE 1FIZA 4MDSA 2BM2A 3OY6U 2C3SA 2QXJA 4M7GA 1VCPA 1YYY1 2M5TA 1DLKB 3GYLB 3V12A 2BHGA 4FVDA 3F9FA 1QB1A 1EJMA 1HAOH 1C5XB 5C5NA 4XSKU 3UOUA 2BZAA 2BLVA 3RC6A 1J17T 1G3BA 3NWUA 4U30A 4ZH8A 4XOJA 1G3CA 1ZYOA 1OOKB 3ZZ7A 1CBWC 1ELAA 3S69A 2BDBA 1O3FA 1WV7H 1Z8RA 1YCPK 3MNXA 4OS1A 1S5SA 3SNEA 1GDQA 1SOTA 2WPIS 3A8DA 5I46H 1NN6A 2ANWA 2HPQH 2BD5A 3NKKA 2J94A 2FPZA 3RXTA 2PR3A 1LVMA 1BQYA 1PQ5A 2A0QB 4IN2A 1TBZH 3ODDA 1ZSJA 2ZU5A 1GG6C 1O2IA 4TPIZ 3CS7A 1TX6A 1P02A 1ZPZA 2XCFA 1EOLA 2ZGCA 1XUIA 2BMGB 1T8OA 1G30B 1SQTA 4YM9A 1K28D 3Q77A 3F9EA 1KYNA 4BAOB 5K0HA 2FI4E 2ZGHA 1YPHE 2ZFTA 4D9QA 3TJOA 1HXEH 4OGXA 3SUEA 1Z6JH 4KP0A 2A2XH 1C1SA 1AB9C 4GHTA 1AWFH 4CRGA 3E8LA 3Q3KA 2BD4A 2ZGBH 1HAYB 1O3PB 3LIWA 4JZ1A 2ZDNA 2XC5A 3SU5A 1F0RA 2G51A 2VVCA 3RXHA 3MU5A 1O2MA 1C5QA 1LCYA 3ZZ6A 1E0FD 1J15A 2BD8A 3BTQE 2B8OH 1TNJA 1GJ8B 1P8VC 2STAE 4IMZA 1O3CA 1XXFA 3M3VA 3Q76A 5LPFA 1GBJA 1K1IA 1Y5AT 2A5KA 2VGCB 1NRSH 4UFEH 3TH4H 4AB8A 1F2SE 1FAXA 1SGFG 4GSOA 1GI8B 4B75A 2SGFE 1KLIH 1Y3YA 1YC0A 1MBMA 1LHCH 1TPSA 5DP8A 1RS0A 2LNCA 2ILNA 1OWIA 3KL6A 4A6LA 4CBNA 2RA3A 1DT2A
chains in the Genus database with same CATH superfamily
4CRCA 1GHBG 3F0OA 3NK8A 1QCPA 1ELDE 2W3KA 1UK2A 1JIMA 2PWXA 3SI4H 4AN7A 5C94A 4WF8A 2ODPA 5CDFE 2QV1A 2OD3B 2ZGJA 3U8TH 2BTCE 5H4IB 5EXMA 4AYYB 5C67A 3QTOH 1DICA 1V2OT 2ZFQH 3BTFE 3KCGH 2A7CA 1FONA 1YPEH 2GJGA 2YOLA 1V2WT 1N8OC 1MZDA 1FN6A 3M3TA 5J4SA 3ATIA 1EJAA 4I31A 5L2ZH 3T25A 1SGQE 3SYJA 2BDGA 5DSFA 3PO1C 4WH8A 3KN2A 1C1OA 3EDXB 3ZZ8A 4CBOA 1MABB 1ZR0A 3TH2H 1EAXA 3MH6A 4YT6H 1TYNA 2ZQ1A 5LH8A 1C4U2 1GBIA 1EATA 2BY7X 1NFYA 4Q7YA 1QA7A 2GVFA 1GDNA 1C5TA 1OP0A 1GI2A 2HLDD 1KLTA 1EASA 2ZU1A 1SR5C 1UVUH 1NROH 2G4TA 1QBNA 2NU4E 3SBKA 1EAUA 2HNTE 3MFJA 1A0JA 3LGUA 3MH4A 1O5GH 1KXFA 2B7DH 4ACAA 2A7JA 3T26A 1V6DA 1YGCH 1ABJH 4RT1A 3GCHB 3C27B 3SQEE 2ZQ2A 1PFXC 3KEEA 4U2WA 4R0IA 3RU4E 2A4GA 4IC6A 3K2UA 3O8DA 1GBTA 3PLBA 3U28C 5B6OA 4I8LA 1NRRH 1CVWH 1P57B 3LC3A 1Z71A 1BMFD 1WCZA 1C5OH 1CGJE 1QQUA 2OQUA 3W94A 2Z3CA 1Q2WA 3KHVA 2AIPA 2WV4A 1Y3VA 3SJ8A 3B23B 1H9IE 4MNVA 3Q00A 7KMEH 3SO3A 5A0CA 1IHSH 3P8OA 1MCTA 3SGAE 1CBWB 1W7GH 1EZXC 4YZUA 3PMBB 1FZZA 1IHTH 1XVOA 1MU8B 4AB9A 4D9RA 5LGOA 3UTUH 1G2MA 4MLFB 2FO9A 2XTTB 1PQAA 2NU2E 1MD7A 3BTEE 4DY7B 1D3TB 1K0HA 2P59A 4CR9A 2P94A 4LZ1H 1FUJA 1IAUA 5GWZA 4UFDH 1GHAF 1BRAA 3UB0A 3A7TA 1SKYE 1P01A 1W0KD 4Y0ZE 1GG6B 1B7XB 3FKSD 2CF9H 1NPMA 1ELEE 1NM6A 3LONA 1QHRB 3RU4T 5AHGH 1NRPH 2ZF0H 3E90B 1P3EA 4GVUA 4OM9A 4A1VA 1H9HE 1C5NH 4CH2B 2GMTC 1O2GH 2ZDLA 1Y3UA 5FL7D 1C1WH 1CQQA 1TMUH 3E6PH 1XXDA 5L6NH 1AZZA 3GY5A 2VH6A 1O3EA 1KXAA 4K2YA 1AB9B 4E05H 1O3DA 3SV7A 5C0TA 5F53A 3T62A 4INHA 1YWUA 3BTKE 2GZ9A 1O39A 1W12U 5E0HA 2F9OA 4TSFD 3TITA 2J98A 1HLTH 4FVBA 1INCA 4F48B 3PTBA 3CNRA 1C2EA 4YESB 2Q1JA 3WY8A 1ZHPA 3BTDE 3UNSA 2PUQH 4NA7A 3ESTA 2XNIA 3P92A 1C2MA 1WTGH 2F9BH 3AAVA 1UTPA 3OAAD 4M9FA 1NRNH 2WV9A 2VJ1A 4WJG2 3UWIA 4AYVB 1PPGE 2ZU3A 4I8HA 3H5CB 5JBAS 1P2KA 1ELCA 1SGFA 2ZGXH 4BNRA 2KCPA 3OU0A 4AFUA 1CA8B 3FOAA 4HI3A 2R0LA 1JIRA 2WPKS 1NU7B 2F9NA 2JETC 1O3LA 5IK2D 4Y76A 2BX4A 3MWIU 1SFIA 5ABWA 1PPHE 4TYDA 2VNTA 1W0ZU 2XYAA 1MU6B 1AU8A 2QF0A 3HGNA 1HCGA 4X0WU 3D49H 1AHTH 3BTTE 2CF8H 2BQWB 4KTUA 1MTUA 5TCAA 3ZV8A 3RXFA 1UTNA 2M2AA 1O2HA 1IQGA 1XX9A 3LOXA 4K1TA 2STBE 1EPTA 1YCPM 3GISB 3E1XB 3F1SB 1YPMH 1CHOF 1AWHB 4A7IB 5EPNA 5FPSA 4TY6A 4YO9A 1P2OA 2HPPH 3UFAA 1C1VH 4I32A 1N8OB 3KIDU 4Q4LA 2BY8X 4DCDA 1Z8GA 2F4LA 2J92A 1LKBA 1K22H 4FOUC 2HOBA 3RP2A 1BDAA 1G2LA 2BY9X 8KME2 2ZFFH 3PO1B 2YMSC 5FPYA 3ZVDA 1BHXB 3K6YA 3BIUH 3U69H 5JBTA 1IQKA 1AVXA 1PPCE 1VCQA 4FUDA 2SGAA 5FHTA 1CT2E 2CN0H 1HAVB 1FNIA 3GCTG 5A8YA 1TNIA 1ZTKA 4IGDA 1THPB 2VB0A 2CV3A 1AY6H 3ATKA 1OYQA 3LGVA 4Q63A 1OP8A 1TRYA 3SU2A 1YM0A 5EG4A 3ZVCA 3GY7A 2ZDKA 1AKSB 2A4RA 2FZZA 1CE5A 1H8IH 4MQAA 8GCHG 1WOFA 1UCYE 7GCHF 1TGSZ 4IMQA 1EB2A 1W13U 1FY5A 3RXEA 2GP9B 5C1UA 3A7VA 1A5HA 1TONA 3UAIC 1MQ6A 1GBCA 1P09A 2FOEA 5EW1H 1SGYE 3F9GA 4OS7A 4O9VA 5JB9S 1BZXE 7ESTE 2HVYB 1HAHH 2C8ZB 5FCRA 1E35B 2ZDVH 2PSXA 1MH0A 1DM4B 2R3UA 2GCHG 3A87A 1P2QA 1GI5A 1WDIA 3MYWA 1ZSKA 1TBRH 4K3JA 2WINI 5EU8A 4X2WA 5T6FA 4LZ4B 3HK6B 1O2ZA 5G4BA 3U1IB 3GCNA 1TFXA 3V0XA 1RFNA 2GCTC 3EA9A 1FX0B 3KQCA 5EXNA 1C2HA 2Y81A 3DA9B 5AVDA 1LVYA 2BOHB 1IQHA 1ELBA 1L1NA 2ASUB 1K1JA 1LQDB 2IJD1 3QDZB 1ZLRA 3QK1A 1T4VH 2QIQA 1TNKA 1O3OA 2C8XB 3K9XB 2HGTH 2LPRA 1BMLA 1H8DH 1E79D 2H9HA 3ZZ5A 2W5EA 1UTJA 4UEHH 4INKA 5F8ZA 3M7QA 1TX7A 1UTLM 3KQEA 2B9LA 2PKAA 4AZ2B 3URDA 2GMTB 3G01A 4ZCNA 8LPRA 3TVJB 1MAXA 1P9SA 5EQQA 4JMYA 2PTCE 1MKXK 1GMCG 2V0BA 3V13A 1P12E 2WHXA 5C2ZA 1WAYB 2P8OB 2ZPSA 1TLDA 4WMEA 3GDVA 1GCDA 2FOHA 3PRBA 2OQ5A 4FUEA 1BRCE 5IYTA 2HVXA 1ETSH 1FXYA 1MD8A 2AGGX 3BEUA 3BTGE 3U9AH 4BTUB 3RXPA 2ZWLH 1KDQB 1LO6A 4ZROA 2A7HA 3M5OA 3RC5A 3UWJH 3UNRA 3RU4D 2KAIB 2FOFA 2UWPA 5AFZH 3QZRA 4MPXA 2JH0D 1W8BH 2BVXH 4X8TH 4IBLH 4F4OC 1C1TA 1C2KA 1DDJA 1O36A 2RDLA 1IQNA 3O8BA 1JRTA 4X6PA 4DG4A 4JZEH 2A5IA 5FX5A 1C5RA 3E16B 5EOKA 2FI5E 1LPZB 4THNH 2XWBI 4QT8C 3IG6B 1V2PT 1D9IA 3AW0A 3KQBA 1GL0E 1E1QD 1AVGH 2BD9A 3GICB 1V2UT 2AS9A 8ESTE 4RN6A 1L4DA 1L1GA 1O5FH 1RIWB 4ABBA 1ELTA 1RTKA 2FDAA 1AGJA 1C2JA 5T3HA 1GHBF 1TPOA 4CRDA 1V2ST 3M5NA 3PMAB 2ZU4A 2KM0A 3A83A 2AYWA 1GJ4H 4CR5A 2BLQA 1DX5M 3VXFH 3QGNB 1CU1A 4Q2KA 4NCYA 2JJ2D 3N99A 1ID5H 1Z1JA 2Y7ZA 4KTCA 2AMQA 5CHBA 3TK6A 1BTPA 1NC6A 3GCHC 3DD2H 2KCOA 1O5BB 3DHKH 1AFEH 1O33A 1S82A 3PMJA 1YLNA 2IPHA 1S6LA 1UTMA 1QL8A 1O2QA 3C1KA 2P3UB 1S83A 1NRQH 4INLA 1HJAC 2FLBH 9ESTA 1C1RA 3PWBA 2GZ7A 3A7ZA 2FODA 2Z6BD 1O2VA 5FPTA 1SHYA 1HNEE 1MTWA 2XWAA 1YPJH 1NZQH 1AQ7A 4TT3D 3A80A 1BB0B 3ZZ4A 5A09A 1AE8H 2GT7A 4FUBA 1WQVH 1E38B 2YMSB 3SNBA 2VIWA 4B6EA 5DK1A 3RXUA 3PV5A 1O2UA 5AFYH 2FEQH 1O2TA 4BXSA 5ESTE 2OC7A 1M9UA 1GBKA 1O38A 4HTCH 2FWWA 3PTNA 1Q3XA 1GVKB 3DFLA 4TWWA 5J4QA 3CS0A 4YOGA 1GHYH 2PGBB 4CREA 1NS3A 2BD7A 1K21H 4WWYA 2VWLA 3DSOA 1DWBH 2FYRA 5JB8S 5DO4H 5DKMA 3IWMA 1FAKH 4I7YH 4DT7B 2WYJA 2YMSD 4BANB 1RXPA 2HNTF 4MVNA 1C2FA 1TOCB 4A92A 4ABIA 1O3NA 1NTPA 2SNVA 2VIPA 1GI1A 3FVFB 1DFPA 1O34A 2Z9LA 4FUIA 2ANKH 4NIVA 2AGIX 3LDXH 1VGCC 3LKWA 4DIIH 4Q7ZA 2VVVA 1ZHRA 1E36B 1XUJA 1V2TT 3RM2H 4WXIA 1O2NA 2FM2A 1EX3A 1YPLH 1GJBB 2QXGA 5EPYA 1XVMA 1EJNA 2OUAA 3SJOA 2VU8E 1GJ7B 1UW7A 5FBEA 2GKVE 2NU1E 1SQAA 2GCTB 1QY6A 1SGCA 1THSH 2XRCA 4Y6DA 4DT4A 1JOUB 3LGIA 5HMAA 1BMAA 2SGEE 2A45B 3A8CA 1JWTA 3TIUA 2FOMB 3LGYA 2TGTA 2UUJB 4IW4E 1O2YA 1P2NA 4X1NU 1UVTH 4TY7A 5IDKA 2R3YA 1FJSA 3KQ5A 1A4WH 3E91A 5EJZA 6ESTA 4KELA 4KKDA 1A61H 1MAYA 3I78A 1YP9A 1A5IA 1GWAA 4OGYA 1G36A 1ARBA 4OS5A 2QAAA 3GYMA 2FS8A 3QLPH 2XBXA 1ORFA 1V2NT 4JK6A 3ZVAA 3Q3XA 4ABFA 4HG6A 1JBUH 3ATLA 1TOMH 3L33A 1LTOA 4TWYA 3T28A 1KLJH 1OWDA 4X6MA 1A3EH 3VEQB 4Y0YE 1H4WA 1ANEA 1YPHC 1T31A 1E1RD 2AGEX 3SNAA 2ZU2A 2KR7A 1ZJKA 4FUFA 1D4PB 1BBRK 1E34B 2DE8A 5CHAB 1SBWA 1WUNH 2VIDA 2FLRH 3SNCA 4FU9A 5A2MH 5L30H 6GCHG 2K1QA 4Y7BA 2FXRA 3UQOA 2ANYA 2Z9KA 1S85A 5BPEA 3RMOH 1QJ7B 4FUCA 4ISHH 1GVLA 3KYFA 3MNCA 2XCNA 4E06H 1K9OE 3D65E 2THFB 2JDID 1O2SA 2SGDE 2VWOA 4OS6A 5C17A 1HRTH 1Y5BT 2AIQA 4LK4A 4A5TS 1V2MT 1UHBB 1HAIH 1LQEA 3TJVA 5DGJA 4FUHA 2TGDA 5HM2A 3GY2A 5FBIA 1C1NA 1GL1A 1SLWB 1BTYA 1GPZA 5EODA 3S9AA 5A0AE 2Y80A 4X1QU 3MNSA 3P70B 3OSYA 2BQ7B 1BUIA 2JH5D 4D76A 1OS8A 2P3FH 1G32B 2ZDAH 3OYPA 4UDWH 2HALA 3E3TA 2ODQA 4ASUD 3PYHA 2GV7A 3V7TA 4AFSA 4X6NA 1A0LA 1TMTH 4ABGA 4K8BA 3B8JA 4H4FA 1O5DH 3P8GA 4J1YA 3HGPA 1NBMD 5HIZA 3TK5A 5C1XA 3MO9A 2EQNA 4RI0A 4XD7D 1YY3A 1HGTH 1TPAE 3STIA 2QF5A 2UWOA 1HV7A 1TWXB 4B76A 2TIOA 4Y8XA 3RUOA 1OP2A 5DP5A 3RXRA 2ZCHP 2ZTYA 1GBEA 1HJAB 1OYTH 1O3MA 3A85A 1QNJA 1YCPH 2F83A 3P8FA 2J97A 2EI6A 1EFRD 2AFQB 1ZPBA 2FX6A 3PRDA 3F3BA 1C4Y2 9LPRA 2EY4C 1ESTA 1TGNA 5FAHA 1LHFH 1TBQH 4GHQA 4K60A 4WXVA 1D3QB 2DUCA 1GJDB 1XMNB 1W0YH 3U1JB 3GCTF 1LHDH 5GCHG 1FI8A 2Z7FE 2BY6X 3BG8A 3K65B 1KXEA 1O35A 1QIXB 1H8HD 1V3XA 1V2QT 3DSPA 1LDTT 1BTHH 2K8IA 1RTFB 4ZUHA 8GCHF 2VH0A 4K5ZA 1G3EA 2PHBA 4F55A 2Z9GA 1BTXA 1UCYK 1GJ5H 3PLKA 2Y5FA 4ABHA 3S9BA 1SGDE 1T32A 2R0KA 2W3IA 4NWKA 2FOCA 1IOEA 4X1RU 4CH8B 4DW2U 3AW1A 2BDYA 3GY6A 1W14U 5C0UA 5GDSH 1KTSB 3OE7D 4P02A 1DXWA 1TGBA 1K2I1 3K6ZA 2UWLA 1LKAA 1S0RA 4JYVH 1GHWH 1TPPA 2CJIA 1GBHA 2GCHF 1TGTA 1H1BA 1VGCB 2JJ1D 5E2PA 4ABDA 3EA7A 2P8OC 1N1LA 1AE5A 2YNAA 2D2DA 2VWMA 1IQIA 3EQ0H 1HFDA 1GMHG 1HUTH 1VKYA 2ZNKH 4ZKRU 2VIOA 4D7FA 3BV9B 3VFEA 1UTQA 2FOGA 3TK9A 1O0DH 2AERH 4XRNA 4K1SA 4YXWD 5JYIA 2CXVA 2PP6A 1ELVA 1SSXA 3SN8A 4Y11E 3UY9A 5LPRA 1D3DB 1QBOA 2G00A 4ESTE 2ZCKP 4BAKB 1DS2E 1HJ8A 1SLUB 1W7XH 2BDHA 4X2XA 3BIVH 4FUJA 1Y3XA 2H1UA 3ZZ9A 3F0PA 3FZZA 3B9FH 1S84A 2A4QA 1IQEA 2F9VA 5E0JA 1A5GH 2Y7XA 1C5VA 1GHZA 2W7SA 1A3BH 3LGTA 3RXSA 3ZZDA 1TAWA 2BLWA 3UQVA 1RIWC 2OTVA 4X2VA 1EKBB 1O3GA 3PLPA 5K7RA 1KXBA 1B5GH 1GMCF 1LVOA 1O3HA 1O31A 3ZVBA 4FU8A 1TE0A 2BXUH 1PPZA 2OLGA 1LPGB 1CHGA 2JH6D 2F3CE 1Z7KA 3AVZA 2Q6GA 2LELA 2VBCA 3DFJA 4H6TA 3GY8A 1MKWK 5EXLA 1QRXA 3SU0A 4ABAA 4AORA 3QWCH 4Y79A 1DY9A 1BIOA 2SFAA 3BF6H 2RA0A 3I29A 1B0FA 3FP8E 1P03A 4ZKSU 2VVUA 3MOCA 1HAVA 3FZDA 3BTWE 3GS9A 1FPCH 1QL9A 5JBBS 3LH1A 3TGIE 2C93B 4Z6AH 1CA0C 2R9PA 4HZHA 2W7UA 3RC4A 1AKSA 1NFUA 5HM9A 1C5WB 1S81A 3PM3A 3H7TA 3SHAH 1AMHA 1WBGB 3ITIA 3BSQA 5C3NA 1HAXB 3H7OA 3I77A 1TQ7B 3SGQE 4XDEA 1P05A 3AK5A 3QO6A 1Q31A 1FDPA 1XUGA 5EW2H 3LU9B 1HYLA 2WUBA 4YTAA 4GCHG 1EZUC 1GBLA 2VINA 1O3KA 2ZECA 3NXPA 1S6FA 2UUKB 2J95A 4B2BA 1LHGH 1ZRKA 1W3CA 4BXWA 5ETXA 1IQMA 2F43B 5GNDA 3MTYA 1EB1H 1YF4A 2GX4A 1FY1A 5AF9H 1GMDF 4NA8A 3VB3A 4E7NA 3GCOA 1A0HB 1DWEH 2GT8A 4FETA 2OC1A 3EYDA 3MQKC 2P16A 2SGPE 1ZHMA 2O8UA 3P95A 2GV6A 3ZZCA 2CHAC 1XUFA 2J4IA 2TGPZ 1AZ8A 1J9CH 2VWNA 1G37A 1VJAU 1P2MA 5DP7A 1O3JA 1ZJDA 1BRUP 4NIXA 4X8VH 1JRSA 1EZQA 1OKXA 2WPDD 3FP6E 4ZXXH 2PUXB 2QCYA 1P11E 3SV6A 2BVRH 2TRMA 3AASA 1GI9B 4Y8YA 4D7GA 4D8NA 2C4FH 2WPLS 2QF4A 4UE7H 2A2QH 1RD3B 1P2JA 2W6ID 4ZHLU 2ESTE 2IOTA 1DXPA 3STJA 1DLEA 2ZA5A 1TABE 5KGOA 4AFZA 2FTMA 3FANA 1AI8H 2VIQA 4NGAH 1XUKA 2AMDA 2QN5T 3KYGA 1N6YA 2KFWA 3M3SA 5TCCA 4XE4A 3QGJA 4NZLA 1MBQA 2I6QA 4AG1A 1TRNA 1F0TA 1O2JA 4DURA 2GGVB 2ALPA 1KDQA 2XC4A 4BAQB 1BRBE 1WQSA 4ASHA 2HRVA 3OTPA 1PQ8A 3QUMP 4OS4A 2KAIA 1Z1IA 1UTKA 3L3TA 2B0FA 1BJUA 4X8UH 2EA3A 1C1UH 2UUFB 4B2CA 3T27A 3GDSA 1DSUA 5CHAC 1F7ZA 2JIZD 2ZPRA 3SORA 1CGIE 2RCEA 1RJXB 1QRZA 1GHVH 1XM1A 1SG8B 1SI5H 3LC5A 3HKIB 1DANH 4RKJB 3VXEH 2QE7D 2QF3A 3RXGA 2ZP0H 2Z3EA 3GY4A 4KTSA 2J34A 4U01A 1SLXB 1ZTLA 2Q6FA 2ZI2H 1GBDA 1V2KT 1VITG 2OBQA 1TQ0B 4JK5A 2PKAB 1SQOA 1IQLA 4U32A 2W6JD 3U98H 3SW2B 4E7RG 1FN8A 1K1LA 1C5MD 2V6NA 3L6PA 5JBCS 1T8LA 2Z9JA 1HIAA 1VITH 4Y8ZA 1VR1H 3OEED 2W26A 3SZNA 5T6DA 4ABEA 4IC5A 5DP6A 1MTNB 3UNQA 2D26C 1TIOA 4X6OA 2ZCLP 3SV8A 1UK4A 1PPBH 5JPMH 1C2DA 2Y5GA 1Y8TA 3SQHE 1D6WA 1TGCA 3TGKE 1MTVA 1NESE 2FTLE 1ZMLA 3ATMA 4MPWA 5HGGA 4CRBA 2TPIZ 3MI4A 4NG9H 6GCHF 1WTHD 2QY0B 2TGAA 2O8WA 1A7SA 3F9HA 4AFQA 3R3GB 3SU4A 2FMJA 1KIGH 2IPQX 1O2XA 1QGFA 3A89A 1GMDG 1L4ZA 2Y6TA 3DCLA 3KQDA 4ZHAA 5GIBA 3ZZAA 4X2YA 3RXJA 4HGCA 5DP4A 1QBVH 5E0GA 1UO6A 1QB9A 3H09A 1J16A 1L2EA 3TPIZ 1V2VT 3TGJE 3SHCH 3RXDA 3SV2H 1CA0B 1T4UH 2BLOA 1FY8E 2G8TA 3FN8A 1SLVB 3ATWA 5C20A 3LJOA 3UIRA 4RSPA 3S0NA 1ELGA 2BD3A 3SJKA 3M7TA 1GCTC 2BYAX 1ANBA 1HAGE 1TALA 2ZTZA 4XBCA 3LJJA 4H6SB 3MNBA 1FY3A 2ZIQH 4AC9A 1L0ZA 1YPKH 3M37A 2C8YB 4BOHA 3SJIA 1UVSH 2ZPQA 5DPAA 2ZEBA 4XBDA 1CO7E 1DUEA 3SNDA 2BOKA 4ISOA 4UFFH 4X1SU 5HYOA 4UONA 4AG2A 1P06A 1ESAA 4GAWA 2H9EH 4GPGA 1O2KA 4FXGH 3HPTB 4I86A 2ZHEH 1PPEE 2BX3A 2XNDD 1H8ED 1DITH 4BTTB 5EJLA 1EP5A 4ZKOU 3MU8A 2BY5X 1O5EH 5HXFA 2FOAA 3DUXH 1TX8A 3MU1A 3O8RA 2QC2A 1Y59T 4NSVA 1AD8H 4HFPB 4R8TB 1W2KH 1OWHA 2OINA 1KXDA 3ZYDA 4TPYA 2HLCA 2CHAB 3URCA 1O2RA 3A82A 4GUXA 1AN1E 3ZYEA 2LP6A 1O3AA 4WVPE 1ETRH 1VCWA 5GCHF 2ZZUH 2JKHA 1ESBA 5PTPA 2PFEA 1THRH 4CRFA 1O2LA 4CHAC 2Z94A 1CSOE 4DVAU 2R2WU 2KCYA 2A5AA 4PROA 1C2LA 2PV9B 1Z8IB 2XC0A 3SUFA 5F8XA 1PYTD 3MO6A 1EAIA 3BG4C 1AUTC 4AGJA 1BCUH 1D3PB 2AH4X 1BT7A 4XFQA 4IS5A 4KGAA 2PGQB 1T8MA 4B74A 1FIWA 1GJ6A 3RXVA 1GVZA 1F5RA 2GD4B 3HKJB 3N7OA 1MKXH 2QGRA 3BTHE 4I8KA 1GI4A 1EAWA 4ZXYH 2O9QA 1AFQB 1UK3A 1DE7H 3RMLH 4X8SH 2IJOB 2V3OH 3WWBA 4SGBE 3M7UA 4J2YB 4AGKA 1ANDA 1BJVA 1VZQH 5EGMA 5GXPA 4WMDA 1GMHF 3KNXA 1QTFA 2ZKSA 1UHBA 3NUMA 2O8MA 1CT4E 3A81A 3PWCA 1XKBC 5GPIB 3TJNA 1GI0A 1QB6A 3RXAA 2OP9A 3VB6A 1NFWA 4WH6A 1ETTH 1HAZB 1D6RA 4K1EA 3SZEA 1FY4A 3JZ1B 4NSYA 1ZZZA 4BAMB 3TLOA 2H6MA 1ZRBA 2HWLB 2FX4A 3RXQA 1Z8JB 4VGCC 3QTVH 4NWLA 1NT1A 2P93A 1F5KU 1GBBA 2A1DB 2F91A 2ZO3H 3TNSA 3MH5A 3W95A 1SHHB 1ELFA 3LH3A 3NRLA 4B6FA 3SI3H 2ZFPH 1IQJA 3A86A 3GOVB 4UFGH 3OX7U 3A84A 3HK3B 2J2UA 1IQFA 1QA0A 4YLQH 2FS9A 1QFKH 1UVOA 4RT0A 1YLDA 2V35A 2NU3E 1TNLA 5DP3A 2V3MA 3NZIA 4IN1A 1GHXH 1MMJN 1WYKA 5A8XA 1F0SA 1EPTC 4I8JA 3AAUA 3ENSB 1ACBE 1YKTA 3T29A 1O2OA 4I33A 1OSSA 2G4UA 1PQ7A 1ZGVA 1QURH 2ULLA 3W1EA 2BB4A 2OK5A 1W10U 3E0PB 1SFQB 2F9PA 3LT3A 3UPEA 1SGTA 1LPKB 5C5OA 2ZC9H 1O2WA 3ZVFA 1PPFE 2UUYA 3JZ2B 1ZMJA 1YLCA 1DVAH 5KECA 3F2GA 1QZ8A 2GDEH 1C5UA 1LMWB 2ZFRH 1HDTH 1FMGA 3UOPA 2J38A 3D23A 3LGWA 1Y3WA 3F2HA 1L1JA 1C1QA 3EE0B 4Q80A 2O8TA 1QJ1B 5T1VA 2WUCA 1BTWA 5EQSA 2BD2A 1O32A 1QQ4A 2H5DA 1FQ3A 3CP7A 3RXLA 2XBVA 4NIYA 4YT7H 3S9CA 1KXCA 2A4OA 1NFXA 2ANMH 1EUFA 1GCTB 3MH7A 4ISIH 4GCHF 3A7YA 2V7QD 1SMFE 4DJZB 1BITA 3TU7H 4NIWA 1QRWA 4JYTA 5T6GA 1O3IA 1PJPA 1GI3A 2HNTC 2L6OA 4B1TA 2QXHA 2WYGA 4ISNA 2BDCA 2NU0E 2R2MB 1BTUA 2WPHS 3F6UH 1BTZA 1EQ9A 3ZZ3A 1EZSC 1SVPA 3M5LA 4ZMAH 1XKAC 5FXLA 3M5MA 5KEDA 3UR9A 3MU0A 3LPRA 4Y10E 4DIHH 2QYIA 2B5TB 2EI7A 1C4V2 4RKOB 2EI8A 1RGQA 3SUGA 4FU7A 3QX5H 4X1PU 7LPRA 2SGQE 3PROA 1C5PA 1GJ9B 1C5LH 4XBBA 3RMNH 3SUDA 2AEIH 2G5VA 2PKSC 3HATH 5EQRA 4JZDH 1SPJA 3S7HB 1BA8B 2ZDMA 3FFGA 3TH3H 4MNWA 5F6MA 2ZFSA 4BAHB 5ESBA 1G9IE 2YNBA 2BDAA 1CGHA 1V2RT 2G5NA 3ZZBA 5B6LA 4CHAB 1NU9A 4JCNA 6CHAC 1BBRE 4O3UA 1A1RA 2SNWA 1SGIB 4P00A 4DGJA 3BG4B 1P04A 3D62A 4B71A 1QJ6B 1UJ1A 1TA2A 2KZ4A 3R0FA 4K69A 1TMBH 1DPOA 2O8LA 1J14A 1BMNH 1OPHB 3E0NB 1OXGA 1DWDH 3UR6A 1UVPA 5DP9A 3A88A 5FCKA 4ABJA 1A2CH 2Y82A 1GI6A 1BBRH 3A7XA 5F03A 3VGCC 2BZ6H 1MTNC 3NPSA 1G3DA 4NZQA 3Q3YA 1C5ZB 1MUEB 2OCVB 2GDDA 4MTBA 3ZV9A 2L74A 2J98B 3P17H 1ANCA 1KTTB 1P0SH 3EAJA 2QA9E 5E8EH 3RM0H 2Q6DA 5LPEA 3VG8A 1GGDC 1OHHD 5SGAE 1W11U 2WZQA 4OS2A 3CENA 2FI3E 1SQRA 2C90B 1NY22 1VJ9U 1YPGH 1DOJA 4YOJA 1ZSLA 1HBTH 1QR3E 2EEKA 1GBAA 1DSTA 2ZHFH 3TJUA 1P3CA 3BN9A 1O5AB 1H9LB 4YOIA 3SJ9A 1VITF 4WY3A 1SC8U 3MU4A 1O5CB 2H5CA 3BEIB 1SOZA 2F9UA 2ZG0H 4VGCB 1F5LA 3A7WA 1HB0B 2BXTH 2CK3D 1E37B 4Y7AA 3RXOA 3DSGA 2ZTXA 1CT0E 3M35A 2V3HH 1U6QA 1ZMNA 4LOYH 1HPGA 2KCAA 2AMPA 1ZPCA 4I8GA 2IN2A 3KF2A 1SGEE 4CRAA 2BQ6B 1LHEH 3V3MA 4JZFH 4AX9H 4O97A 4SGAE 2PSYA 2G52A 4AOQA 1COWD 2A32A 1DWCH 2D8WA 2P3TB 4GLYA 1EPTB 1S0QA 2FOBA 2FESH 4ZKNU 3UREA 1FPHH 3RXBA 1GI7B 5EJ1A 2WPMS 3RLYH 3WW7A 4MNYA 1SGPE 5HKKD 5EIYA 1HAPH 1NO9H 3O8CA 2WSSD 3ELAH 1JMOH 3SU6A 1AUJA 2ZHWH 3BEFB 1GHAG 1PYTC 1SGNE 5I25A 1UMAH 1KMHB 1A46H 1SGRE 2ODYB 2H9TH 1V2LT 1C1MA 3OEHD 2WV5A 2Y5HA 2FP7B 3ZVEA 2C8WB 1O30A 2XBWA 4MNXA 1BMMH 1OWKA 4ZAEA 3SV9A 1GDUA 1O2PA 2TBSA 3RMMH 2BDIA 1OWJA 1EXFA 1MTSA 1GBFA 1ZTJA 2KX4A 2G81E 1MQ5A 2QXIA 2RFKC 3RXKA 1P2IA 1UCYH 5FX6A 3M61U 1T7CA 1TRMA 4UD9H 3IITA 3GY3A 3BTME 1SB1H 1C1PA 2WPJS 2H2ZA 2Z3DA 3SU3A 1J8AA 1C2IA 4ACBA 3EA8A 3T2NA 1C5YB 4YLUA 1P10A 4F49A 3ODFA 1UTOA 1O37A 1K1NA 3MHWU 1TB6H 3T5FH 1AO5A 1ABIH 1TA6A 1WU1A 3F2FA 1C9TA 3QZQA 5DJ7A 1K1OA 1K1MA 4MPUA 1AFQC 1LVBA 5C1YA 1EOJA 1HXFH 1KSNA 3S7KB 3MMGA 2FIRH 2G55A 2J5UA 2PW8H 1KY9A 1OWEA 3FP7E 1NBME 2VGCC 3M36A 1F0UA 3UUZA 4O3TA 1T8NA 2RG3A 3VB7A 1OX1A 5A0BA 3RXCA 5JDUB 1DY8A 2XBYA 1YBWA 3RLWH 1RRKA 3OTJE 5CE1A 5GJ4B 1TNHA 2PKSB 2ALVA 3OY5U 3U8OH 3QN7A 1O3BA 3DT0H 2A31A 2J9NA 4Q7XA 1FLEE 4NFEA 1BOQA 5DN6D 4A1XA 1Y5UT 1EP6A 1WSSH 2ZHQH 2BVSH 1F92A 1JXPA 3NCLA 5CMXH 3PB1E 3P6ZB 4ISLA 1C2GA 2PTNA 6CHAB 3WWFA 1DUAA 2OC0A 6LPRA 1GJCB 1V2JT 2GZ8A 1ZOMA 4LXBH 3ZVGA 3GDUA 4H42U 5TJXA 1SL3A 3U8RH 1B0EA 5F8TA 1N6XA 1FV9A 2OC8A 4NA9H 2I6SA 1HJ9A 4WMFA 3PMHB 1CHOG 1AIXH 1ZGIA 2P95A 2ZHDA 4MPVA 2XOKD 3VB5A 3KGPA 1MZAA 2PLXA 4Z0KA 4B73A 4B2AA 3N7EA 3VGCB 1MKWH 3A8BA 3OFND 2Z9IA 1C5SA 2VIVA 4Z1MD 4NFFA 2DE9A 1C9PA 3VPKA 4JZIA 4O03A 1K1PA 1GJAB 3P8NA 1MCVA 1XUHA 1RTLA 3VB4A 1GGDB 3F68H 2XXLA 4FUGA 5DG6A 3EGKH 1ARCA 3FAOA 3A8AA 3RDZA 2JETB 1BHXF 2NWNA 2XW9A 4A1TA 2OXSA 2OBOA 1QL7A 2CMYA 3SOSA 3SU1A 5L2YH 1GBMA 2D1JA 3SGBE 4DOQA 3PV4A 3MO3A 1P9UA 1Z6EA 4BTIB 5E2OA 4MG3A 2GTBA 1HIAB 4Y71A 7GCHG 1S6HA 1X7AC 2CGAA 2EC9H 4JYUH 4K8YA 3RXIA 4ZHMU 1W0JD 1TNGA 1AVWA 2FYQA 3RXMA 3TNTA 5A8ZA 5BRRE 1FIZA 4MDSA 2BM2A 3OY6U 1WXRA 2C3SA 2QXJA 4M7GA 1VCPA 1YYY1 2M5TA 1DLKB 3GYLB 3V12A 2BHGA 4FVDA 3F9FA 1QB1A 1EJMA 1HAOH 1C5XB 5C5NA 4XSKU 3UOUA 2BZAA 2BLVA 3RC6A 1J17T 1G3BA 3NWUA 4U30A 4ZH8A 4XOJA 1G3CA 1ZYOA 1OOKB 3ZZ7A 1CBWC 1ELAA 3S69A 2BDBA 1O3FA 1WV7H 1Z8RA 1YCPK 3MNXA 4OS1A 1S5SA 3SNEA 1GDQA 1SOTA 2WPIS 3A8DA 5I46H 1NN6A 2ANWA 2HPQH 2BD5A 3NKKA 2J94A 2FPZA 3N7DA 3RXTA 2PR3A 1LVMA 1BQYA 1PQ5A 2A0QB 5HIYA 4IN2A 1TBZH 3ODDA 1ZSJA 2ZU5A 1GG6C 1O2IA 4TPIZ 3CS7A 1TX6A 3EE7A 2RDEA 1P02A 3FO8D 1ZPZA 2XCFA 1EOLA 2ZGCA 1XUIA 2BMGB 1T8OA 1G30B 1SQTA 4YM9A 1K28D 3Q77A 3F9EA 1KYNA 4BAOB 5K0HA 2FI4E 2ZGHA 1YPHE 2ZFTA 4D9QA 3TJOA 1HXEH 4OGXA 3SUEA 1Z6JH 4KP0A 2A2XH 1C1SA 1AB9C 4GHTA 1AWFH 4CRGA 3E8LA 3Q3KA 2BD4A 2ZGBH 1HAYB 1O3PB 3LIWA 4JZ1A 2ZDNA 2AHME 2XC5A 3ZIAD 3SU5A 1F0RA 2G51A 2VVCA 3RXHA 3MU5A 1O2MA 1C5QA 1LCYA 3ZZ6A 1E0FD 1J15A 2BD8A 3BTQE 2B8OH 1TNJA 1GJ8B 1P8VC 2STAE 4IMZA 1O3CA 1XXFA 3M3VA 3Q76A 5LPFA 1GBJA 1K1IA 3PV2A 1Y5AT 2A5KA 2VGCB 1NRSH 4UFEH 3TH4H 4AB8A 1F2SE 1FAXA 1SGFG 4GSOA 1GI8B 4B75A 2SGFE 1KLIH 1Y3YA 1YC0A 1MBMA 1LHCH 1TPSA 5DP8A 1RS0A 2K0QA 2LNCA 2ILNA 1OWIA 3KL6A 4A6LA 4CBNA 2RA3A 1DT2A
chains in the Genus database with same CATH topology
4CRCA 1GHBG 3NK8A 1QCPA 1ELDE 2W3KA 1UK2A 1JIMA 2PWXA 3SI4H 4AN7A 4WF8A 2ODPA 2QV1A 2OD3B 2ZGJA 3U8TH 2BTCE 5H4IB 5EXMA 4AYYB 5C67A 3QTOH 1DICA 1V2OT 2ZFQH 3BTFE 3KCGH 2A7CA 1FONA 1YPEH 2YOLA 1V2WT 1N8OC 1MZDA 1FN6A 3M3TA 5J4SA 3ATIA 1EJAA 4I31A 5L2ZH 3T25A 1SGQE 2BDGA 3PO1C 4WH8A 3KN2A 1C1OA 3EDXB 3ZZ8A 4CBOA 1ZR0A 3TH2H 1EAXA 3MH6A 4YT6H 1TYNA 2ZQ1A 5LH8A 1C4U2 1GBIA 1EATA 2BY7X 1NFYA 4Q7YA 1QA7A 2GVFA 1GDNA 1C5TA 1OP0A 1GI2A 1KLTA 1EASA 2ZU1A 1SR5C 1UVUH 1NROH 2G4TA 1QBNA 2NU4E 3SBKA 1EAUA 2HNTE 3MFJA 1A0JA 3LGUA 3MH4A 1O5GH 1KXFA 2B7DH 2A7JA 3T26A 1V6DA 1YGCH 1ABJH 3GCHB 3C27B 3SQEE 2ZQ2A 1PFXC 3KEEA 4U2WA 4R0IA 3RU4E 2A4GA 4IC6A 3K2UA 3O8DA 1GBTA 3PLBA 5B6OA 4I8LA 1NRRH 1CVWH 1P57B 3LC3A 1Z71A 1WCZA 1C5OH 1CGJE 1QQUA 2OQUA 3W94A 2Z3CA 1Q2WA 3KHVA 2AIPA 2WV4A 1Y3VA 3SJ8A 3B23B 1H9IE 4MNVA 3Q00A 7KMEH 3SO3A 5A0CA 1IHSH 3P8OA 1MCTA 3SGAE 1CBWB 1W7GH 1EZXC 4YZUA 3PMBB 1FZZA 1IHTH 1XVOA 1MU8B 4AB9A 4D9RA 5LGOA 3UTUH 1G2MA 4MLFB 2FO9A 2XTTB 1PQAA 2NU2E 1MD7A 3BTEE 4DY7B 1D3TB 2P59A 4CR9A 2P94A 4LZ1H 1FUJA 1IAUA 5GWZA 4UFDH 1GHAF 1BRAA 3A7TA 1P01A 4Y0ZE 1GG6B 1B7XB 2CF9H 1NPMA 1ELEE 1NM6A 3LONA 1QHRB 3RU4T 5AHGH 1NRPH 2ZF0H 3E90B 1P3EA 4GVUA 4A1VA 1H9HE 1C5NH 4CH2B 2GMTC 1O2GH 2ZDLA 1Y3UA 1C1WH 1CQQA 1TMUH 3E6PH 1XXDA 5L6NH 1AZZA 3GY5A 2VH6A 1O3EA 1KXAA 4K2YA 1AB9B 4E05H 1O3DA 3SV7A 3T62A 4INHA 3BTKE 2GZ9A 1O39A 1W12U 5E0HA 2F9OA 3TITA 1HLTH 4FVBA 1INCA 3PTBA 1C2EA 4YESB 2Q1JA 3WY8A 1ZHPA 3BTDE 3UNSA 2PUQH 4NA7A 3ESTA 2XNIA 3P92A 1C2MA 1WTGH 2F9BH 3AAVA 1UTPA 1NRNH 2VJ1A 4WJG2 3UWIA 4AYVB 1PPGE 2ZU3A 4I8HA 3H5CB 5JBAS 1P2KA 1ELCA 1SGFA 2ZGXH 4BNRA 3OU0A 4AFUA 1CA8B 4HI3A 2R0LA 1JIRA 2WPKS 1NU7B 2F9NA 2JETC 1O3LA 4Y76A 2BX4A 3MWIU 1SFIA 5ABWA 1PPHE 4TYDA 2VNTA 1W0ZU 2XYAA 1MU6B 1AU8A 2QF0A 3HGNA 1HCGA 4X0WU 3D49H 1AHTH 3BTTE 2CF8H 2BQWB 4KTUA 1MTUA 5TCAA 3ZV8A 3RXFA 1UTNA 1O2HA 1IQGA 1XX9A 3LOXA 4K1TA 2STBE 1EPTA 1YCPM 3GISB 3E1XB 3F1SB 1YPMH 1CHOF 1AWHB 4A7IB 5EPNA 5FPSA 4TY6A 4YO9A 1P2OA 2HPPH 3UFAA 1C1VH 4I32A 1N8OB 3KIDU 2BY8X 4DCDA 1Z8GA 2J92A 1LKBA 1K22H 2HOBA 3RP2A 1BDAA 1G2LA 2BY9X 8KME2 2ZFFH 3PO1B 5FPYA 3ZVDA 1BHXB 3K6YA 3BIUH 3U69H 5JBTA 1IQKA 1AVXA 1PPCE 1VCQA 4FUDA 2SGAA 5FHTA 1CT2E 2CN0H 1HAVB 1FNIA 3GCTG 5A8YA 1TNIA 1ZTKA 4IGDA 1THPB 2VB0A 2CV3A 1AY6H 3ATKA 1OYQA 3LGVA 1OP8A 1TRYA 3SU2A 1YM0A 5EG4A 3ZVCA 3GY7A 2ZDKA 1AKSB 2A4RA 2FZZA 1CE5A 1H8IH 4MQAA 8GCHG 1WOFA 1UCYE 7GCHF 1TGSZ 4IMQA 1EB2A 1W13U 1FY5A 3RXEA 2GP9B 5C1UA 3A7VA 1A5HA 1TONA 1MQ6A 1GBCA 1P09A 2FOEA 5EW1H 1SGYE 3F9GA 4OS7A 4O9VA 5JB9S 1BZXE 7ESTE 1HAHH 2C8ZB 5FCRA 1E35B 2ZDVH 2PSXA 1MH0A 1DM4B 2R3UA 2GCHG 3A87A 1P2QA 1GI5A 3MYWA 1ZSKA 1TBRH 4K3JA 2WINI 5EU8A 4X2WA 5T6FA 4LZ4B 3HK6B 1O2ZA 5G4BA 3U1IB 3GCNA 1TFXA 3V0XA 1RFNA 2GCTC 3EA9A 3KQCA 5EXNA 1C2HA 2Y81A 3DA9B 5AVDA 1LVYA 2BOHB 1IQHA 1ELBA 1L1NA 2ASUB 1K1JA 1LQDB 3QDZB 1ZLRA 3QK1A 1T4VH 2QIQA 1TNKA 1O3OA 2C8XB 3K9XB 2HGTH 2LPRA 1BMLA 1H8DH 2H9HA 3ZZ5A 2W5EA 1UTJA 4UEHH 4INKA 5F8ZA 3M7QA 1TX7A 1UTLM 3KQEA 2B9LA 2PKAA 4AZ2B 3URDA 2GMTB 3G01A 8LPRA 3TVJB 1MAXA 1P9SA 5EQQA 4JMYA 2PTCE 1MKXK 1GMCG 2V0BA 3V13A 1P12E 5C2ZA 1WAYB 2P8OB 2ZPSA 1TLDA 4WMEA 3GDVA 1GCDA 2FOHA 2OQ5A 4FUEA 1BRCE 5IYTA 2HVXA 1ETSH 1FXYA 1MD8A 2AGGX 3BEUA 3BTGE 3U9AH 4BTUB 3RXPA 2ZWLH 1KDQB 1LO6A 4ZROA 2A7HA 3M5OA 3RC5A 3UWJH 3UNRA 3RU4D 2KAIB 2FOFA 2UWPA 5AFZH 3QZRA 4MPXA 2JH0D 1W8BH 2BVXH 4X8TH 4IBLH 4F4OC 1C1TA 1C2KA 1DDJA 1O36A 2RDLA 1IQNA 3O8BA 1JRTA 4X6PA 4DG4A 4JZEH 2A5IA 5FX5A 1C5RA 3E16B 5EOKA 2FI5E 1LPZB 4THNH 2XWBI 4QT8C 3IG6B 1V2PT 1D9IA 3AW0A 3KQBA 1GL0E 1AVGH 2BD9A 3GICB 1V2UT 2AS9A 8ESTE 4RN6A 1L4DA 1L1GA 1O5FH 1RIWB 4ABBA 1ELTA 1RTKA 2FDAA 1AGJA 1C2JA 5T3HA 1GHBF 1TPOA 4CRDA 1V2ST 3M5NA 3PMAB 2ZU4A 3A83A 2AYWA 1GJ4H 4CR5A 2BLQA 1DX5M 3VXFH 3QGNB 1CU1A 4Q2KA 4NCYA 1ID5H 1Z1JA 2Y7ZA 4KTCA 2AMQA 3TK6A 1BTPA 1NC6A 3GCHC 3DD2H 1O5BB 3DHKH 1AFEH 1O33A 1S82A 3PMJA 2IPHA 1UTMA 1QL8A 1O2QA 3C1KA 2P3UB 1S83A 1NRQH 4INLA 1HJAC 2FLBH 9ESTA 1C1RA 3PWBA 2GZ7A 3A7ZA 2FODA 2Z6BD 1O2VA 5FPTA 1SHYA 1HNEE 1MTWA 2XWAA 1YPJH 1NZQH 1AQ7A 3A80A 1BB0B 3ZZ4A 5A09A 1AE8H 2GT7A 4FUBA 1WQVH 1E38B 3SNBA 2VIWA 5DK1A 3RXUA 1O2UA 5AFYH 2FEQH 1O2TA 4BXSA 5ESTE 2OC7A 1M9UA 1GBKA 1O38A 4HTCH 2FWWA 3PTNA 1Q3XA 1GVKB 3DFLA 4TWWA 5J4QA 3CS0A 4YOGA 1GHYH 2PGBB 4CREA 1NS3A 2BD7A 1K21H 4WWYA 2VWLA 1DWBH 2FYRA 5JB8S 5DO4H 5DKMA 3IWMA 1FAKH 4I7YH 4DT7B 2WYJA 4BANB 1RXPA 2HNTF 4MVNA 1C2FA 1TOCB 4A92A 4ABIA 1O3NA 1NTPA 2SNVA 2VIPA 1GI1A 3FVFB 1DFPA 1O34A 2Z9LA 4FUIA 2ANKH 4NIVA 2AGIX 3LDXH 1VGCC 3LKWA 4DIIH 4Q7ZA 2VVVA 1ZHRA 1E36B 1XUJA 1V2TT 3RM2H 4WXIA 1O2NA 2FM2A 1EX3A 1YPLH 1GJBB 2QXGA 5EPYA 1XVMA 1EJNA 2OUAA 3SJOA 2VU8E 1GJ7B 5FBEA 2GKVE 2NU1E 1SQAA 2GCTB 1QY6A 1SGCA 1THSH 2XRCA 4Y6DA 1JOUB 3LGIA 5HMAA 1BMAA 2SGEE 2A45B 3A8CA 1JWTA 3TIUA 2FOMB 3LGYA 2TGTA 2UUJB 4IW4E 1O2YA 1P2NA 4X1NU 1UVTH 4TY7A 5IDKA 2R3YA 1FJSA 1A4WH 3E91A 6ESTA 4KELA 4KKDA 1A61H 1MAYA 3I78A 1YP9A 1A5IA 1GWAA 4OGYA 1G36A 1ARBA 4OS5A 2QAAA 3GYMA 2FS8A 3QLPH 2XBXA 1ORFA 1V2NT 4JK6A 3ZVAA 3Q3XA 4ABFA 1JBUH 3ATLA 1TOMH 3L33A 1LTOA 4TWYA 3T28A 1KLJH 1OWDA 4X6MA 1A3EH 3VEQB 4Y0YE 1H4WA 1ANEA 1YPHC 1T31A 2AGEX 3SNAA 2ZU2A 1ZJKA 4FUFA 1D4PB 1BBRK 1E34B 2DE8A 5CHAB 1SBWA 1WUNH 2VIDA 2FLRH 3SNCA 4FU9A 5A2MH 5L30H 6GCHG 2K1QA 4Y7BA 2FXRA 3UQOA 2ANYA 2Z9KA 1S85A 5BPEA 3RMOH 1QJ7B 4FUCA 4ISHH 1GVLA 3MNCA 2XCNA 4E06H 1K9OE 3D65E 2THFB 2VWOA 1O2SA 2SGDE 4OS6A 1HRTH 1Y5BT 2AIQA 4LK4A 4A5TS 1V2MT 1UHBB 1HAIH 1LQEA 3TJVA 5DGJA 4FUHA 2TGDA 5HM2A 3GY2A 5FBIA 1C1NA 1GL1A 1SLWB 1BTYA 1GPZA 5EODA 3S9AA 5A0AE 2Y80A 4X1QU 3MNSA 3P70B 3OSYA 2BQ7B 1BUIA 2JH5D 4D76A 1OS8A 2P3FH 1G32B 2ZDAH 3OYPA 4UDWH 2HALA 3E3TA 2ODQA 3PYHA 2GV7A 3V7TA 4AFSA 4X6NA 1A0LA 1TMTH 4ABGA 4K8BA 3B8JA 4H4FA 1O5DH 3P8GA 4J1YA 3HGPA 3TK5A 5C1XA 3MO9A 1HGTH 1TPAE 3STIA 2UWOA 1HV7A 1TWXB 4B76A 2TIOA 4Y8XA 3RUOA 1OP2A 5DP5A 3RXRA 2ZCHP 2ZTYA 1GBEA 1HJAB 1OYTH 1O3MA 3A85A 1QNJA 1YCPH 2F83A 3P8FA 2EI6A 2AFQB 1ZPBA 2FX6A 1C4Y2 9LPRA 1ESTA 1TGNA 5FAHA 1LHFH 1TBQH 4GHQA 4K60A 4WXVA 1D3QB 2DUCA 1GJDB 1XMNB 1W0YH 3U1JB 3GCTF 1LHDH 5GCHG 1FI8A 2Z7FE 2BY6X 3BG8A 3K65B 1KXEA 1O35A 1QIXB 1V3XA 1V2QT 1LDTT 1BTHH 1RTFB 4ZUHA 8GCHF 2VH0A 4K5ZA 1G3EA 2PHBA 2Z9GA 1BTXA 1UCYK 1GJ5H 3PLKA 2Y5FA 4ABHA 3S9BA 1SGDE 1T32A 2R0KA 2W3IA 4NWKA 2FOCA 1IOEA 4X1RU 4CH8B 4DW2U 3AW1A 2BDYA 3GY6A 1W14U 5GDSH 1KTSB 1DXWA 1TGBA 1K2I1 3K6ZA 2UWLA 1LKAA 1S0RA 4JYVH 1GHWH 1TPPA 2CJIA 1GBHA 2GCHF 1TGTA 1H1BA 1VGCB 5E2PA 4ABDA 3EA7A 2P8OC 1N1LA 1AE5A 2YNAA 2D2DA 2VWMA 1IQIA 3EQ0H 1HFDA 1GMHG 1HUTH 2ZNKH 4ZKRU 2VIOA 4D7FA 3BV9B 3VFEA 1UTQA 2FOGA 3TK9A 1O0DH 2AERH 4K1SA 5JYIA 2CXVA 1ELVA 1SSXA 3SN8A 4Y11E 3UY9A 5LPRA 1D3DB 1QBOA 2G00A 4ESTE 2ZCKP 4BAKB 1DS2E 1HJ8A 1SLUB 1W7XH 2BDHA 4X2XA 3BIVH 4FUJA 1Y3XA 2H1UA 3ZZ9A 3FZZA 3B9FH 1S84A 2A4QA 1IQEA 2F9VA 5E0JA 1A5GH 2Y7XA 1C5VA 1GHZA 2W7SA 1A3BH 3LGTA 3RXSA 3ZZDA 1TAWA 2BLWA 3UQVA 1RIWC 2OTVA 4X2VA 1EKBB 1O3GA 3PLPA 5K7RA 1KXBA 1B5GH 1GMCF 1LVOA 1O3HA 1O31A 3ZVBA 4FU8A 1TE0A 2BXUH 1PPZA 2OLGA 1LPGB 1CHGA 2JH6D 2F3CE 1Z7KA 3AVZA 2Q6GA 3DFJA 4H6TA 3GY8A 1MKWK 5EXLA 1QRXA 3SU0A 4ABAA 4AORA 3QWCH 4Y79A 1DY9A 1BIOA 2SFAA 3BF6H 2RA0A 3I29A 1B0FA 3FP8E 1P03A 4ZKSU 2VVUA 3MOCA 1HAVA 3FZDA 3BTWE 1FPCH 1QL9A 5JBBS 3LH1A 3TGIE 2C93B 4Z6AH 1CA0C 2R9PA 4HZHA 2W7UA 3RC4A 1AKSA 1NFUA 5HM9A 1C5WB 1S81A 3PM3A 3H7TA 3SHAH 1AMHA 1WBGB 3ITIA 3BSQA 5C3NA 1HAXB 3H7OA 3I77A 1TQ7B 3SGQE 4XDEA 1P05A 3QO6A 1Q31A 1FDPA 1XUGA 5EW2H 3LU9B 1HYLA 2WUBA 4YTAA 4GCHG 1EZUC 1GBLA 2VINA 1O3KA 2ZECA 3NXPA 1S6FA 2UUKB 2J95A 4B2BA 1LHGH 1ZRKA 1W3CA 4BXWA 5ETXA 1IQMA 3MTYA 1EB1H 1YF4A 2GX4A 1FY1A 5AF9H 1GMDF 4NA8A 3VB3A 4E7NA 3GCOA 1A0HB 1DWEH 2GT8A 2OC1A 3EYDA 2P16A 2SGPE 1ZHMA 2O8UA 3P95A 2GV6A 3ZZCA 2CHAC 1XUFA 2J4IA 2TGPZ 1AZ8A 1J9CH 2VWNA 1G37A 1VJAU 1P2MA 5DP7A 1O3JA 1ZJDA 1BRUP 4NIXA