1Y5BT

Dianhydrosugar-based benzamidine, factor xa specific inhibitor in complex with bovine trypsin mutant
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Understanding binding selectivity toward trypsin and factor Xa: the role of aromatic interactions
pubmed doi rcsb
molecule keywords Trypsin, cationic
molecule tags Hydrolase
source organism Bos taurus
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2004-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1y5bT01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1y5bT02
2P8OC 3U8OH 3PWCA 1J14A 1S81A 1VJAU 4B76A 3ZZCA 4WWYA 2W7SA 3SW2B 1PPZA 3T62A 4E7NA 1HNEE 5JBBS 3GY6A 3FFGA 2BM2A 3NXPA 2KAIA 4CBNA 3VGCB 3E3TA 3D49H 4B2CA 2GTBA 2AMPA 3RC5A 2P59A 2I6SA 4FUDA 2GX4A 3NUMA 3MU5A 4INLA 4JZIA 1FXYA 4FUEA 3P95A 1ZPZA 2ZIQH 1O5BB 2BDGA 5GDSH 2ZDLA 1ANEA 5AHGH 2A5KA 1BRAA 2R2MB 4RN6A 3P17H 1HJAC 1O2OA 1WUNH 2ZQ2A 4RKJB 2CN0H 2XYAA 3RLWH 2D1JA 3SZNA 3RUOA 1K22H 1LKAA 1DLKB 3GISB 1H1BA 4I8HA 1P8VC 4XBDA 1Y3XA 4UONA 5L2ZH 1BTYA 3PLBA 1GHYH 3KQDA 4UEHH 4YTAA 3TK5A 1E38B 2H9HA 1UO6A 3AVZA 3BTGE 3MH5A 1A5GH 1P9SA 2GZ8A 4FU8A 1NFXA 1GBMA 3Q00A 3ZZ4A 1QRXA 2J92A 3ODFA 2ZF0H 1NTPA 4WMDA 5A8XA 1P3EA 1ZLRA 1QQUA 1JIRA 4CR9A 5DP9A 6ESTA 1V2TT 5C20A 1HAGE 2EEKA 3GDSA 1BJVA 3LC3A 1Q3XA 4O03A 1GHAG 1LVBA 1BMLA 8GCHF 4WVPE 1O37A 2FOFA 1O35A 4FUJA 5T6FA 1MTNC 3SU1A 1UTPA 2QC2A 1GHVH 2CF8H 1PQ7A 4AYVB 3Q3XA 3SI4H 1HXEH 4Q7XA 2WPJS 1HAIH 2W26A 1FNIA 4I8GA 1FY3A 3CS0A 3SV9A 3LGVA 2WPMS 5J4SA 1MU8B 5DK1A 2Y80A 4IS5A 4R8TB 1K28D 3PM3A 4NSYA 2VGCB 1F92A 3CENA 1DXPA 1AVGH 6CHAC 4Q7ZA 3KHVA 2RCEA 4MVNA 3VXEH 1SL3A 1QB9A 3MH7A 1OXGA 1J9CH 1QJ6B 1P03A 4ZKNU 1O31A 3BG4B 3BV9B 1HXFH 1CU1A 1W12U 1T8MA 1AKSA 2NU2E 1DOJA 2PWXA 3ELAH 3ZYEA 3TH3H 1C5OH 4Y7BA 1O3BA 2ZHDA 3GCHC 2BD4A 1XKBC 1SGFG 4Q7YA 4AORA 1LQDB 3BTHE 1SB1H 3ZVAA 5ABWA 3C27B 1G2MA 1QIXB 2HRVA 1BBRE 2ZEBA 3P8GA 1SC8U 2H2ZA 2GD4B 1F0TA 2ALPA 4GCHG 3PO1B 4Y8YA 2ZDAH 1P2KA 1RTLA 2FLBH 2H6MA 1V2MT 3ESTA 2IJOB 1GBHA 1NU9A 3E6PH 4DIIH 2PTCE 1GJDB 4K5ZA 4A5TS 2BX3A 4OGYA 1GHXH 3SUFA 1YF4A 2ZZUH 3TGKE 1O38A 2Q6FA 1C4U2 4ZKRU 3BTFE 1S82A 1SLVB 5IDKA 3RXQA 1QFKH 3A8CA 1OX1A 3ATLA 1TPOA 3SUGA 3C1KA 2FMJA 1LHDH 2UUYA 2OC1A 1TOMH 2RA3A 1IHTH 1OWHA 4WF8A 1SMFE 1ESTA 3P8OA 2XCNA 2VJ1A 4YOIA 1O3AA 3M61U 1LHFH 2F9UA 2J34A 1GG6B 1GHBF 2XNIA 4AYYB 2SNVA 2Y7ZA 1VR1H 4ISHH 1UCYE 2C8WB 2OLGA 3IG6B 2PUQH 2BB4A 3O8DA 2VH0A 5FBEA 1B0EA 3F9GA 3VB7A 4H42U 1DWBH 1TPAE 3OTJE 3RXJA 1FMGA 1L0ZA 2Z9JA 2ZU3A 4JCNA 1W11U 3F9FA 1XUIA 4CH8B 3LGWA 2PUXB 1ORFA 2F9OA 4YOGA 4A92A 4BAOB 1GBBA 1Y3UA 5C1YA 1AE8H 2AFQB 2J94A 4ISIH 3K2UA 1GGDB 3RXDA 1GDNA 3BTWE 1ELFA 4YLQH 1NRNH 2V35A 3SOSA 2Z3CA 1EAUA 1QURH 4XDEA 3RC6A 1ARBA 1O2MA 3DFLA 1KXAA 1OPHB 5T6GA 5TJXA 1XXFA 3U69H 1JBUH 2F9BH 5JB8S 1GWAA 6GCHG 1WCZA 2ZGBH 3SJIA 1LDTT 1XM1A 2ZHFH 1V2WT 5BRRE 2ULLA 1FONA 5E2OA 2BDBA 1VITH 3PTBA 4LXBH 1WU1A 2VU8E 2BD9A 2CHAB 1LVYA 2ZU1A 4Y8ZA 2WV5A 4JK6A 2XBVA 3RXTA 1TQ7B 1ZZZA 1L1GA 2D2DA 3L33A 1S83A 5FCRA 1PPHE 4YT7H 1OYTH 3RU4D 4FUCA 4KTUA 3A7WA 3BEIB 2ZU2A 4A6LA 1BDAA 3GOVB 2BD2A 1AGJA 2FS8A 3E0NB 4MDSA 5DP5A 1LVMA 1RRKA 4BNRA 2SGDE 1YBWA 2BY7X 3EDXB 1FLEE 5FPTA 1OWKA 1FY5A 3ZVDA 1PPGE 5EQSA 3UNRA 2Q6DA 4B74A 2ZO3H 1PPEE 2PGQB 1HRTH 2V6NA 1A2CH 2BY5X 1TWXB 1XVOA 1FAKH 1ID5H 1DUEA 4OS7A 3VGCC 1PPCE 1CGIE 2O8MA 1HV7A 5TCCA 4Y7AA 2PSXA 1MAYA 1CA0B 5A0CA 3A7YA 1RIWB 1O3OA 5C5NA 1WQSA 4O3UA 1C5WB 3BIUH 2BD3A 4FXGH 4VGCC 1KDQA 1IOEA 1HGTH 3GDVA 4O3TA 3LIWA 5AVDA 3RXVA 2GCHF 2NU3E 4ZHLU 3A87A 2XTTB 1P12E 1QA7A 3TU7H 1YP9A 1BTUA 2ZCLP 2TGDA 2ZGJA 1DANH 2G55A 1UHBA 1V2QT 4XBBA 2TGTA 3L3TA 1SG8B 1BHXB 4KGAA 3TIUA 1EJNA 5DGJA 1NO9H 3TJNA 1SQAA 1M9UA 2TIOA 3E0PB 1SR5C 2BLWA 3ZVBA 2GMTB 3LJJA 3A88A 2Z9KA 3A83A 1OS8A 4X2YA 3QDZB 4KTCA 1NROH 1S6FA 3KNXA 2G4UA 4MLFB 3V12A 4X6NA 3RXCA 1H9LB 1DE7H 1Y3VA 1MUEB 3GY8A 1BMMH 3A7VA 2XC4A 1FDPA 1O2WA 3UREA 1WV7H 2A4OA 4OS5A 1GL1A 1GBTA 2XBWA 1JWTA 4OS1A 1K21H 1A46H 1CHOG 2Z94A 2FWWA 3S9CA 2ZPRA 1QL8A 1GJ5H 2FESH 5A09A 2AGIX 1OWIA 1C5YB 1YKTA 3QGJA 3M5LA 1QTFA 1C1OA 1O2SA 3TK9A 5EGMA 1SSXA 4CRGA 5JDUB 2YOLA 3NCLA 1D3TB 5FHTA 3RXBA 1DS2E 1OP0A 2V3HH 1EZUC 3FAOA 3FZDA 4IBLH 1TLDA 3MNCA 3T25A 1EATA 1THPB 4Y79A 1C5MD 2ZG0H 4K2YA 1IQKA 2FODA 1OKXA 4E7RG 1NRQH 1QA0A 2A2XH 3SBKA 2VGCC 3D23A 4X1PU 1AHTH 1FN6A 4KELA 1WYKA 3ZVEA 7GCHF 1F0RA 3P8FA 4ZHMU 4AFSA 4B75A 3H7OA 1MD8A 1P04A 1P02A 1IQEA 2FLRH 4BOHA 4X1SU 1K1MA 2C8YB 3CP7A 3Q3KA 4IN1A 3VB6A 1EAWA 3P70B 1EPTC 4ISNA 2A5AA 3BTKE 4HGCA 4H6SB 2ZFSA 1EXFA 2J9NA 2C93B 4DIHH 2GCTB 1K1JA 1YLDA 2GKVE 1MKWK 1S0RA 2QV1A 2O8LA 2RA0A 1YCPK 2ZGHA 3SU2A 3N7OA 2O9QA 1O2GH 2HOBA 2LNCA 5IYTA 4X2WA 3VEQB 2XWAA 4JYUH 3RU4E 2AIPA 1E35B 2ZHWH 2B7DH 4K1SA 2EC9H 1JRSA 1GJAB 1AZ8A 2BYAX 2P93A 2FDAA 1P2OA 4ESTE 2H5CA 1KXBA 1O2HA 2R9PA 2P16A 4MPWA 2WUCA 2ZP0H 3ZZ5A 3M5MA 1G3EA 1TNGA 1O3GA 4TPYA 1RD3B 4FUHA 1H8DH 1NU7B 2OC8A 3PLPA 1EUFA 1GVKB 1L1JA 2VH6A 1GG6C 2Q1JA 1W7GH 2XWBI 4A1TA 4Y11E 1KXFA 5CMXH 1P05A 1O3JA 3I78A 4CHAB 1BQYA 1C1VH 3VB4A 3A81A 3RXLA 1C5LH 3FP6E 1A1RA 2BQ6B 5A8YA 2VVUA 1NS3A 1S6HA 3A7ZA 3E1XB 1FY1A 1HAVA 1LQEA 2WUBA 4ZH8A 3S7KB 4D9RA 1GPZA 3VB3A 2G00A 1A0JA 1BMNH 3KQEA 1O2YA 1W2KH 1FJSA 2BTCE 3JZ2B 2XC0A 4E06H 1GGDC 1SGTA 4ABBA 1O3DA 1C2LA 1T7CA 3HK6B 3U1IB 3UPEA 3HPTB 1A4WH 5BPEA 1Z8GA 3DHKH 5I46H 1C1MA 4DVAU 1CO7E 3M7QA 2H9TH 1BJUA 4ZAEA 1NT1A 3PMJA 1C5PA 1GMHG 1AO5A 3LPRA 4YZUA 4ABJA 1BBRK 2JKHA 3F9HA 4CRDA 1IQIA 2ZDKA 1TX8A 4CRCA 1SGFA 1N1LA 2PKAA 1J8AA 2ZC9H 2Z9IA 2O8UA 1YPEH 3SORA 2OD3B 1BTZA 1O2XA 3TLOA 5LPRA 5HYOA 1D3QB 2H9EH 1C5QA 3DT0H 1W0YH 2CHAC 1KIGH 4X2XA 1OOKB 3H5CB 3UWJH 1GI9B 1KXEA 1V2OT 3BTEE 3PWBA 5AFZH 4CBOA 1AE5A 2F9NA 1FZZA 3LOXA 5G4BA 2C8XB 1QY6A 3QK1A 2ZTXA 1GBDA 3LH3A 1MTUA 1SGEE 1CE5A 1UJ1A 2EI8A 3ENSB 3HK3B 1A61H 5ESTE 2EA3A 1O5EH 1GI5A 3EA9A 4WMEA 5FCKA 2HNTC 1QBVH 1ETTH 2W3IA 3V13A 1B0FA 5EU8A 1UCYK 2OBOA 2OQ5A 4ZMAH 1MAXA 2Y81A 2V0BA 1V2RT 4DOQA 2Z9GA 1IQHA 2HPQH 3IITA 2Y5HA 1A0LA 1BRUP 1CA0C 1G32B 1TMUH 3TITA 5EOKA 1K1LA 1RIWC 1VJ9U 1ZSKA 3TPIZ 1FV9A 1C2GA 4AG1A 1TALA 1TRMA 2SGAA 2ZDNA 3E16B 1MZDA 2DUCA 1SPJA 1OP2A 4DJZB 5L2YH 4VGCB 5DP4A 2FI3E 2NU4E 2ZU4A 1WTHD 2PFEA 1K1OA 1ZYOA 3NWUA 3Q3YA 2D8WA 5K0HA 1AVXA 2ZKSA 3MO6A 3EYDA 8LPRA 2JH5D 2QF0A 1D3DB 1UVTH 1S84A 2GMTC 1LO6A 1QRWA 3LKWA 3MU4A 3UNQA 1HYLA 5CHAB 1Z8IB 1ZTLA 3RXHA 5GIBA 3U8RH 3QLPH 3OY5U 5EW2H 1W8BH 5EXLA 2BDCA 3A80A 1RGQA 1SVPA 2JH6D 4M7GA 1GBAA 1ZGVA 4Y76A 3RXUA 3UFAA 3B23B 5H4IB 1O0DH 4AZ2B 1BMAA 1FI8A 3F68H 2XCFA 4Y71A 1O2JA 1J16A 4BAMB 1FQ3A 4GVUA 4WH6A 5GPIB 1ELCA 2PKSB 2BZ6H 1O3EA 3MHWU 4LOYH 1YYY1 1SGQE 1CBWB 2P3FH 4A1VA 4NZQA 1EZQA 1CT2E 1MH0A 3GCTG 2BVRH 2RDLA 1P2IA 5FAHA 3URDA 4B1TA 1ZRKA 5DP3A 5JBCS 2Z6BD 4K1TA 1HAXB 1TRYA 4YESB 1TE0A 2J38A 2C3SA 1F5KU 1MCVA 5C1UA 9ESTA 1HAZB 1UVPA 2HALA 2Y7XA 3SGBE 1BB0B 4K69A 4U32A 1GI8B 2F83A 4NIXA 5T6DA 2CXVA 1YCPM 4NWKA 1Z71A 4Q80A 2ZFRH 1TRNA 3RMLH 2G81E 4X2VA 3ZZBA 1O3IA 3KEEA 3R3GB 1IHSH 4NA7A 3B9FH 3RU4T 2PV9B 2VWMA 1EB1H 3LGYA 4NA8A 1EPTB 1AFQB 1GBLA 1GI0A 2GCTC 4YM9A 2QXHA 6LPRA 3HATH 3EAJA 3AW0A 2GP9B 1C5XB 1AZZA 1BA8B 4OGXA 1SGCA 3BSQA 1PYTD 1GBCA 1XUJA 2A0QB 4UFGH 1GMDF 3A8DA 1YLCA 1HIAB 1NFYA 3GY2A 1SQTA 4IMQA 3M5NA 4FU9A 3NK8A 1T8LA 4OS2A 5PTPA 2F9PA 2HPPH 4YT6H 5HM2A 2UUKB 1ELVA 5B6OA 3MU1A 1Z7KA 2ZCHP 1ZHRA 4BAKB 3VFEA 3HKJB 1GVLA 2ZDVH 4DY7B 1ZSJA 2QAAA 5GWZA 4I8JA 1L4ZA 4INKA 1V2KT 4THNH 3TK6A 5ETXA 1A0HB 1F5LA 3SNDA 1YC0A 1MD7A 1T31A 3TJUA 1FPCH 4TY6A 2YNAA 4CHAC 1GBEA 1PPBH 1YPLH 1NFUA 3KN2A 2H5DA 1BIOA 1V2ST 3EA7A 2BLVA 5AF9H 4BANB 5LGOA 3LGIA 4D9QA 1ELTA 3PTNA 1O30A 1KSNA 4GLYA 2FYRA 5K7RA 2TGPZ 4I8KA 1P2NA 2QIQA 1SGRE 4HZHA 3RLYH 1WTGH 1O3FA 2PW8H 1MKXK 4H4FA 3SJ8A 2P3UB 2G5VA 1VGCC 1E34B 4IC5A 3WY8A 2FEQH 1ZMNA 8GCHG 4X8UH 1D6RA 5J4QA 2HGTH 1HAHH 4B71A 2ZTZA 1O39A 3ODDA 1BRCE 3S9AA 1OP8A 1QQ4A 5EXMA 3RXFA 3ZVFA 2H1UA 3F1SB 1F0UA 1KTTB 4TWYA 1Z1JA 1NESE 4UE7H 1FUJA 2C8ZB 1AVWA 5EW1H 1H8IH 2SGQE 3BTME 2M5TA 1GHWH 1ZJKA 3RM0H 1JRTA 3RP2A 2TBSA 1ZPCA 2ANKH 3MNXA 4IW4E 4JK5A 5HGGA 3RM2H 3ZYDA 7LPRA 3A82A 5DO4H 3AAUA 4I7YH 1OYQA 1KLTA 3ZV8A 4O97A 2WINI 5FX6A 3M7UA 1SGPE 1LPKB 3KGPA 1H4WA 1E37B 1A5IA 4AGJA 4X6MA 1DX5M 2FOGA 3VXFH 1ANBA 1CSOE 4Q2KA 4ASHA 5JYIA 4D76A 1UTLM 3LH1A 1XUGA 1EZXC 1TNHA 2A4QA 3DUXH 3ZV9A 5F8XA 4ABAA 2GDEH 4BXWA 5EXNA 4BAQB 1GI7B 1GVZA 4F49A 3UTUH 1HDTH 3VPKA 4D7FA 7ESTE 3QN7A 1SHYA 1QL9A 3EQ0H 1GJ7B 1MZAA 3S9BA 4D7GA 3SGQE 2TRMA 4X6OA 4CRFA 1PFXC 1GI6A 1WSSH 1WQVH 2TPIZ 3D65E 3SV8A 1C1QA 3MWIU 2FX4A 2QGRA 3U1JB 1AMHA 1RJXB 1T8NA 2ESTE 4X1NU 1DSUA 3BEUA 2R0KA 4UFEH 1AWFH 5LPFA 2ZHEH 4Z6AH 2QYIA 3V3MA 1O2PA 4QT8C 1ESAA 2R3YA 5EQRA 1CGJE 3U9AH 2ZECA 3VB5A 2ZFFH 2QN5T 2HNTE 3SU3A 4NWLA 1GHBG 2DE8A 5CHAC 1K2I1 4XFQA 1O2ZA 3UQOA 1LVOA 2PSYA 4U30A 2TGAA 1KY9A 2G4TA 3URCA 1HAOH 3PMAB 1WOFA 2J2UA 2BXTH 1N8OB 2BY9X 4I32A 1AN1E 1TA2A 5JB9S 2FI5E 5CE1A 1NN6A 2KAIB 2ZQ1A 4KTSA 1HJ8A 1J17T 1TBZH 2PKSC 3P8NA 2ZCKP 3GYLB 4MPUA 3L6PA 2G52A 1IQJA 1TGNA 2B8OH 3SV6A 1CBWC 5F03A 5GCHF 5F6MA 1LHGH 1DUAA 1GJBB 1E36B 2VINA 1Y5BT 1EPTA 5A0AE 3MNBA 1P2JA 1C5VA 1EKBB 1LPZB 4ZUHA 3I77A 5ESBA 2FOMB 1DT2A 5A2MH 2AYWA 4ZKSU 1YPGH 3KCGH 2FPZA 3K6YA 1LMWB 5DP6A 2PGBB 4FVDA 4TYDA 2W5EA 1VITF 2STBE 1O5CB 4RKOB 3W95A 3ZZAA 3DFJA 3QZQA 1O2LA 5HXFA 2GVFA 1D4PB 4DCDA 4MTBA 1KLJH 4H6TA 4IMZA 4MG3A 4K60A 3GCOA 1C1SA 3KL6A 2STAE 3AAVA 1UK2A 1DM4B 1AFQC 2BD7A 2ZDMA 1J15A 2ANWA 2AGGX 4LK4A 1U6QA 1T32A 3P92A 1GJ6A 2VIWA 1JIMA 1SLXB 1O5FH 5T3HA 2F3CE 1C9TA 5C1XA 4WXIA 1GMCF 4X8VH 4WJG2 2W7UA 3BTDE 4FU7A 3SU5A 2ZA5A 2GDDA 1Z6JH 1QGFA 7KMEH 1CHGA 1GBIA 2G5NA 1XXDA 2OC7A 1IQLA 1QBNA 3S69A 3MO9A 2FXRA 4ISOA 3RMMH 2JH0D 5C67A 1KXDA 2W3KA 2BX4A 1W0ZU 4X1RU 3SJ9A 2NU0E 4CREA 3ATKA 3GY7A 2GCHG 1QCPA 2O8WA 3RC4A 2P95A 2O8TA 3KIDU 1G36A 5JBTA 3PMHB 2OINA 2C4FH 1W10U 2THFB 3T26A 3LGTA 3TH2H 1KTSB 4NG9H 1F2SE 2SGEE 2A7JA 1YPJH 2AEIH 1DDJA 1ANCA 2BDAA 1AKSB 4ABEA 1C1RA 1GI2A 2CF9H 1V2LT 3H7TA 3I29A 2OCVB 2QY0B 2QXIA 1Y5UT 3U98H 1ELGA 1W14U 2A1DB 1UMAH 3MYWA 5C3NA 1GBJA 4SGAE 1QBOA 3SUEA 1UTNA 1DY9A 3ZZ3A 4FUIA 1ANDA 2B0FA 1V2UT 1TQ0B 4JMYA 3RXPA 1VGCB 1ZHMA 3TVJB 2EI6A 4ABDA 5GJ4B 2XXLA 3BN9A 1EX3A 1E0FD 2FOHA 2OP9A 2V3OH 2ZHQH 1LKBA 1EOLA 2A4GA 3FANA 2XRCA 3MOCA 4NGAH 2FOBA 1LTOA 1QHRB 1GJ4H 1GI3A 1O5DH 3S7HB 3E8LA 1GHAF 1INCA 1JOUB 1PQAA 2OUAA 4DGJA 1O5AB 1VCPA 4J1YA 2AS9A 3TNSA 1NFWA 2Y82A 1G37A 3MU0A 2BLOA 3A85A 5L6NH 1TNIA 2P3TB 1W13U 4I8LA 7GCHG 1O3HA 2D26C 2FI4E 1Z8RA 4PROA 1UTJA 3U8TH 2FOAA 5DKMA 2WPHS 1LHCH 4CH2B 1BZXE 4HI3A 4BXSA 1OSSA 1TMBH 1GDQA 4A1XA 2FP7B 3UUZA 1ELAA 1AB9C 1S5SA 3TJOA 1ELDE 1ARCA 5HM9A 2G51A 1MMJN 1DWCH 1BRBE 1C5RA 4I31A 3QTVH 3SI3H 1DPOA 1V2JT 2BDYA 3M3TA 3ZZ9A 4ZKOU 1LHEH 2VIVA 2HNTF 2Y5GA 2RG3A 1BT7A 1V2VT 1SOZA 1VCQA 3BIVH 4XOJA 1W3CA 1GI1A 1V3XA 1SLUB 2ODYB 3SU4A 2VWLA 5E8EH 3MO3A 3A86A 3UIRA 1H9IE 1X7AC 1UTKA 1C5TA 2ZPQA 4GAWA 4GCHF 1CQQA 3MH4A 4UFFH 2ANYA 1YGCH 2XW9A 2Z9LA 2HLCA 3D62A 4XBCA 1SLWB 1VZQH 1XVMA 2A4RA 1CA8B 1AUTC 4AFUA 1HLTH 2ZU5A 1O2UA 4WMFA 1TFXA 1RXPA 5F8ZA 5A8ZA 1TAWA 4ISLA 1IQMA 5E0JA 8ESTE 3F6UH 4NIVA 1NRRH 3TGJE 4B2BA 1P10A 1O32A 1HAYB 2GZ9A 2BQ7B 3V7TA 3SNAA 5JBAS 1EJAA 1MTVA 1IQGA 1C2JA 4R0IA 2VVCA 8KME2 1TBRH 4CRAA 1JXPA 1O3KA 2WPIS 4GHQA 1TONA 1BHXF 1AWHB 2SFAA 4CR5A 1P09A 3T2NA 1RTKA 3SV7A 1N8OC 2UWOA 3T5FH 3GICB 1GL0E 4UD9H 5DPAA 2OBQA 1SFQB 1BOQA 2ZFQH 3OYPA 1FAXA 4AFZA 1CT4E 1JMOH 3P6ZB 3UOPA 3ITIA 3RXEA 3STIA 1A5HA 1HBTH 1Q31A 2F91A 4ZXXH 5FXLA 4TPIZ 5JPMH 5DG6A 4YOJA 2IN2A 1KDQB 1AU8A 4DW2U 4ABGA 1UTOA 1P01A 4LZ4B 2A2QH 1L2EA 1ZRBA 2PR3A 1K1NA 1C5NH 4Y6DA 1O2QA 1V2PT 1UHBB 1ABJH 1YPHC 4SGBE 1UVUH 2AH4X 3ZVGA 2DE9A 3ATWA 6GCHF 1SGYE 1XKAC 2ASUB 3PV4A 3A84A 2BZAA 4AGKA 1AIXH 1TYNA 2GGVB 1Y3WA 5EG4A 4AOQA 1ESBA 2BD8A 1HB0B 1DY8A 3BG8A 2VIQA 1FIZA 1TX6A 2FTLE 3UOUA 1O3PB 1DWEH 2UUJB 3BTTE 1B7XB 1OWEA 2FTMA 4IC6A 1O3NA 1PQ5A 3ZZ7A 2A7CA 3RXRA 1XUFA 1NRPH 2BHGA 1EAXA 4FUFA 4BTTB 2FZZA 4X1QU 1DWDH 4IN2A 2IOTA 2BY8X 2FM2A 1KLIH 3T28A 3SQEE 4WY3A 2QF3A 2OXSA 1QL7A 1TGBA 3O8CA 4NSVA 1FPHH 1G2LA 1FY8E 2OC0A 1ABIH 5DP8A 1DVAH 3BTQE 2VIOA 2YNBA 1WBGB 4GHTA 4DURA 2R3UA 1C5UA 1C1UH 9LPRA 1MKWH 1UK4A 3A8AA 1YCPH 2XBYA 4U01A 2R2WU 1THRH 3GDUA 3GY5A 1C1PA 1GBFA 5E0HA 2Z7FE 4JZDH 5C2ZA 1P3CA 1QR3E 1TGCA 3SNEA 3TJVA 1O36A 2J4IA 3ZZ8A 1YM0A 3KF2A 4AX9H 1BTWA 3A89A 3O8BA 1N6YA 2A5IA 3W94A 2VWOA 1TGSZ 1D9IA 1TNKA 3SU0A 1HFDA 2Z3DA 2SGPE 1UK3A 2EI7A 1AD8H 1CGHA 1UVOA 1ELEE 4UDWH 1BTXA 3RXMA 1ZSLA 4HFPB 1C2IA 1P2QA 1Y5AT 1BTHH 4ZROA 1LCYA 2HWLB 2ODPA 1OWJA 1FY4A 1N6XA 3SN8A 4AG2A 3MU8A 1Z8JB 1ELBA 1EQ9A 5L30H 4K8BA 1EP6A 1AUJA 3QGNB 1C4V2 1DFPA 2I6QA 1EJMA 4Y10E 1QB6A 2FIRH 1ZPBA 3MNSA 1P06A 3PLKA 4ABFA 2XC5A 1CHOF 1T8OA 1Y59T 3SNCA 3ATMA 1G3BA 3SNBA 1AY6H 2ZGCA 1SI5H 1ZJDA 1MQ6A 1ZTJA 3B8JA 4Y0YE 4BTUB 3MH6A 4TWWA 1EZSC 1NC6A 2ZFTA 3Q76A 1MTWA 1GDUA 1SGIB 1UVSH 4NCYA 1BBRH 1C2KA 1GBKA 3FZZA 4JYVH 2BQWB 4MNVA 4HTCH 2BY6X 4MNYA 1Y8TA 1ACBE 1C1TA 1NY22 1ETRH 1MQ5A 1Z6EA 2G8TA 1GCTB 1HJ9A 2UWLA 2AMDA 3GY4A 1DITH 1HAVB 2FX6A 4KP0A 1SGDE 3SJOA 4NIWA 1O3LA 1DICA 2K1QA 1EAIA 1XUHA 1IQNA 1GI4A 4UFDH 1GJCB 4WXVA 3DD2H 1F5RA 3LT3A 4MNXA 5EPYA 2OQUA 2FOEA 2FS9A 1AB9B 1NPMA 1RFNA 1VCWA 2BDIA 3CS7A 2WYGA 2CV3A 2AGEX 2FYQA 4FVBA 1GMDG 2JETB 1G3CA 2B9LA 1EASA 1ZOMA 3HKIB 2PKAB 1PQ8A 3UNSA 3M3VA 4DT7B 3IWMA 3M5OA 1EP5A 2P8OB 3LU9B 2ZI2H 1A3BH 1GCDA 3MI4A 1C2DA 3SHCH 1S85A 1UCYH 4GPGA 5C5OA 2BLQA 1C2EA 4K3JA 3UQVA 4MNWA 5FBIA 1TABE 3K65B 3NKKA 4FUBA 3A8BA 2CGAA 3PYHA 1F0SA 1C5ZB 5HMAA 1C4Y2 3QO6A 1ZR0A 4NZLA 1DXWA 3BF6H 2WPLS 3M37A 2AERH 2A7HA 3ZZDA 3K9XB 1P11E 4INHA 4Z0KA 1HJAB 1LPGB 2AMQA 3QTOH 4J2YB 2GV7A 4E05H 3ATIA 1D6WA 1FIWA 2BOKA 5EQQA 2Q6GA 3R0FA 1K1PA 4XSKU 2VVVA 4GSOA 1TMTH 1B5GH 3AW1A 1G30B 1BCUH 4OS6A 3SGAE 4DG4A 4NA9H 4AB8A 1MTSA 2PTNA 1O2NA 3RMNH 1T4UH 4ABIA 1P2MA 1XUKA 3Q77A 3SV2H 3NPSA 3LONA 1TNLA 3OY6U 3JZ1B 3RXAA 1H9HE 3TGIE 3M3SA 2PHBA 3MFJA 4RSPA 2CJIA 3EA8A 2WYJA 2FO9A 3HGNA 1DSTA 3DA9B 1TNJA 1MBMA 3OX7U 1O33A 3E90B 1QB1A 1KYNA 1SHHB 3A7TA 3GCNA 3RXSA 1OWDA 2QXJA 1THSH 2SNWA 1O3MA 3STJA 2BVXH 2BOHB 3GY3A 1GMHF 3ZVCA 1DLEA 2P94A 2Z3EA 4FUGA 4Y8XA 1IQFA 1BUIA 4MPXA 3MTYA 1HIAA 5DP7A 5EPNA 4ZXYH 1Q2WA 1O2IA 1MTNB 3SU6A 4YLUA 1TB6H 3TNTA 2VB0A 4KKDA 1C2MA 1S0QA 2F9VA 1UTQA 4D8NA 2QXGA 1TOCB 1TIOA 1HPGA 2BXUH 3SQHE 1RS0A 5EODA 1TPSA 1O2RA 1Z1IA 1A7SA 3FVFB 2ZWLH 1RTFB 2ODQA 3G01A 3RXGA 5I25A 4F4OC 2BDHA 4TY7A 3PROA 1ZTKA 2UWPA 4K8YA 1SQOA 2A32A 6CHAB 3M7TA 3KQCA 3BG4C 1XMNB 4O9VA 4JZFH 3QWCH 3SO3A 4YO9A 1CT0E 4U2WA 1XX9A 3S0NA 2NWNA 2QCYA 1O34A 2VNTA 5E2PA 4XE4A 2PLXA 1EOJA 1SBWA 3GCHB 4CRBA 3FP8E 3EGKH 1BTPA 1SGNE 1W7XH 3M36A 4X6PA 3PO1C 5FPYA 5LH8A 1QJ1B 1YPHE 2OTVA 1TX7A 1NRSH 1TBQH 2BVSH 4BAHB 1V2NT 3V0XA 1G9IE 1WAYB 5FX5A 1O2TA 1ZHPA 1QJ7B 3MMGA 3RMOH 1GJ9B 4K1EA 1C5SA 2SGFE 5TCAA 4X8TH 2GV6A 2A45B 1P57B 3RXOA 3SJKA 1BITA 2GT7A 1QRZA 2J95A 1QNJA 2A31A 1PJPA 1ZMJA 3F9EA 4MQAA 3UY9A 1AFEH 1MU6B 2HVXA 4Y0ZE 1NM6A 2IPHA 2BD5A 2R0LA 5F8TA 5AFYH 1TPPA 4JZEH 1P9UA 3LGUA 3SHAH 5LPEA 5DJ7A 1MBQA 2QA9E 1YPKH 1O3CA 5A0BA 1O5GH 2NU1E 1SFIA 1ZGIA 4X8SH 3UR6A 1CVWH 1D3PB 1G3DA 2WV4A 2VWNA 3EE0B 2C90B 1Y3YA 2LPRA 1TA6A 2ANMH 4ZHAA 4B2AA 1A3EH 5E0GA 1C2FA 3T27A 3T29A 1AQ7A 1T4VH 4WH8A 4AN7A 4MPVA 1V6DA 2WPKS 3RDZA 3LDXH 3HGPA 3GYMA 1GJ8B 1NZQH 3RXIA 5GCHG 1HCGA 1K1IA 1IAUA 3LJOA 3OU0A 2ZFPH 1C9PA 2GT8A 1C2HA 2ZPSA 2CMYA 4ABHA 1AI8H 3FP7E 3LC5A 4JYTA 4NFEA 3OSYA 2AIQA 2FOCA 1PPFE 1MKXH 3RXKA 2GZ7A 1C1WH 2VIDA 3PMBB 4NFFA 3QX5H 3ZZ6A 1O2KA 2UUFB 1MCTA 3E91A 4I33A 2B5TB 3TH4H 2XBXA 2Y6TA 1KXCA 1VITG 1P0SH 1SOTA 3GCTF 4GUXA 3BEFB 2ILNA 3QUMP 3SUDA 1L4DA 4OS4A 1GCTC 1TGTA 3NZIA 4B73A 1HUTH 2ZNKH 1EB2A 3PB1E 3AASA 1GHZA 1UTMA 3QZRA 3UR9A 2ZGXH 1HAPH 1C1NA 1F7ZA 3KQBA 2Y5FA 3O8RA 2ALVA 1FN8A 1ETSH 1K9OE 3UWIA 4JZ1A 3M35A 4IGDA 5FPSA 4AFQA 4NIYA 2BMGB 1L1NA 1GMCG 4X0WU 4AB9A 2VIPA 4A7IB 1O2VA 2JETC 1ZMLA 1PYTC 2ZTYA 4BTIB 5GXPA 5SGAE 1YPMH 3K6ZA 4LZ1H 3A7XA
chains in the Genus database with same CATH superfamily
2P8OC 3U8OH 3PWCA 1J14A 1S81A 1VJAU 4B76A 3ZZCA 4WWYA 2W7SA 3SW2B 1PPZA 3T62A 4E7NA 1HNEE 5JBBS 3GY6A 3FFGA 2BM2A 3NXPA 2KAIA 4CBNA 3VGCB 3E3TA 3D49H 4B2CA 2GTBA 2AMPA 3RC5A 2P59A 2I6SA 4FUDA 4ACAA 2GX4A 3NUMA 3MU5A 4INLA 4JZIA 1FXYA 4FUEA 3P95A 1ZPZA 2ZIQH 1O5BB 2BDGA 5GDSH 2ZDLA 1ANEA 5AHGH 2A5KA 1BRAA 2R2MB 4RN6A 3P17H 1HJAC 1O2OA 1WUNH 2ZQ2A 4RKJB 2CN0H 2XYAA 3RLWH 2D1JA 3SZNA 3RUOA 1K22H 1LKAA 2XOKD 1DLKB 3GISB 1H1BA 4I8HA 1P8VC 4XBDA 1Y3XA 4UONA 5L2ZH 1BTYA 3PLBA 1GHYH 3KQDA 4UEHH 4YTAA 3TK5A 1E38B 2H9HA 1UO6A 3AVZA 3BTGE 1YWUA 3MH5A 1A5GH 1E1QD 1P9SA 2GZ8A 2LP6A 4FU8A 1NFXA 1GBMA 5IK2D 3PV5A 3Q00A 3ZZ4A 1QRXA 2J92A 3ODFA 3F0PA 2ZF0H 1NTPA 4WMDA 3FKSD 5A8XA 1P3EA 1ZLRA 1SQRA 1YY3A 1QQUA 1JIRA 4CR9A 5DP9A 6ESTA 1V2TT 5C20A 1HAGE 2EEKA 3GDSA 1BJVA 3LC3A 1Q3XA 4O03A 1GHAG 1LVBA 1BMLA 8GCHF 4WVPE 1O37A 1WDIA 2FOFA 1O35A 4FUJA 5T6FA 1MTNC 3SU1A 1UTPA 2QC2A 1GHVH 2CF8H 1PQ7A 4AYVB 3Q3XA 3SI4H 1HXEH 4Q7XA 2WPJS 1HAIH 1UW7A 2W26A 1FNIA 4I8GA 1FY3A 3CS0A 3SV9A 3LGVA 2WPMS 5J4SA 1MU8B 5DK1A 2Y80A 4IS5A 4R8TB 1K28D 3PM3A 4NSYA 2VGCB 1F92A 3CENA 1DXPA 1AVGH 6CHAC 4Q7ZA 3KHVA 2RCEA 4MVNA 3VXEH 1SL3A 1QB9A 3MH7A 1OXGA 1J9CH 1QJ6B 1SKYE 1P03A 4ZKNU 1O31A 3BG4B 3BV9B 1HXFH 1CU1A 1W12U 1T8MA 1AKSA 2KZ4A 1DOJA 2NU2E 2PWXA 3ELAH 3ZYEA 3TH3H 5HKKD 1C5OH 4Y7BA 1O3BA 2ZHDA 3GCHC 2BD4A 1XKBC 1SGFG 4Q7YA 4AORA 1LQDB 3BTHE 3N7DA 1SB1H 3DSGA 3ZVAA 5ABWA 3C27B 1G2MA 1QIXB 2HRVA 1BBRE 2ZEBA 3P8GA 2XNDD 1SC8U 2H2ZA 2GD4B 1F0TA 2ALPA 4GCHG 3PO1B 4Y8YA 2ZDAH 1P2KA 1RTLA 2FLBH 2H6MA 1V2MT 3ESTA 2IJOB 1GBHA 1NU9A 3E6PH 4RT0A 4DIIH 2PTCE 1GJDB 4K5ZA 4A5TS 2BX3A 4OGYA 1GHXH 3SUFA 1YF4A 2ZZUH 3TGKE 1O38A 2Q6FA 1C4U2 4ZKRU 3BTFE 1S82A 1SLVB 5IDKA 1H8ED 3RXQA 1QFKH 3A8CA 1OX1A 3ATLA 1TPOA 3SUGA 3C1KA 2FMJA 4YXWD 1LHDH 2UUYA 2OC1A 1TOMH 2RA3A 1IHTH 1OWHA 4WF8A 1SMFE 1ESTA 3P8OA 2XCNA 2VJ1A 4YOIA 1O3AA 3M61U 1LHFH 2F9UA 2J34A 1GG6B 1GHBF 2XNIA 4AYYB 1S6LA 2SNVA 2Y7ZA 1VR1H 4ISHH 1UCYE 2C8WB 2OLGA 3IG6B 2PUQH 2BB4A 3O8DA 2VH0A 5FBEA 1B0EA 4HG6A 3F9GA 3VB7A 4H42U 1DWBH 1TPAE 3OTJE 3RXJA 1FMGA 3OAAD 1L0ZA 2Z9JA 2ZU3A 4JCNA 1W11U 3F9FA 1XUIA 4CH8B 3LGWA 2PUXB 1ORFA 2F9OA 5C0UA 4YOGA 4A92A 4BAOB 1GBBA 1Y3UA 5C1YA 1AE8H 2AFQB 2J94A 4ISIH 3K2UA 1GGDB 3RXDA 1GDNA 3BTWE 1ELFA 4YLQH 1NRNH 2V35A 3SOSA 2Z3CA 1EAUA 1QURH 4XDEA 3RC6A 1ARBA 1O2MA 3DFLA 1KXAA 1OPHB 5T6GA 5TJXA 1XXFA 3U69H 1JBUH 2F9BH 5JB8S 1GWAA 6GCHG 1WCZA 2ZGBH 3SJIA 1LDTT 1XM1A 2ZHFH 1V2WT 5BRRE 2ULLA 1FONA 5E2OA 2BDBA 1VITH 3PTBA 4LXBH 2KCYA 1WU1A 2VU8E 2BD9A 2CHAB 1LVYA 2ZU1A 4Y8ZA 2WV5A 4JK6A 2XBVA 3RXTA 1TQ7B 1ZZZA 4F48B 1L1GA 2D2DA 3L33A 3UB0A 1S83A 5FCRA 1PPHE 4YT7H 1OYTH 3RU4D 4FUCA 1W0JD 4KTUA 3A7WA 3BEIB 2ZU2A 4A6LA 1BDAA 2M2AA 4Q4LA 3GOVB 2BD2A 1AGJA 2FS8A 3E0NB 4MDSA 5DP5A 1LVMA 1RRKA 4BNRA 2SGDE 1YBWA 2BY7X 3EDXB 1FLEE 5FPTA 1OWKA 1FY5A 3ZVDA 1PPGE 5EQSA 2QE7D 3UNRA 2Q6DA 4B74A 2ZO3H 1PPEE 2PGQB 1HRTH 2V6NA 1A2CH 2BY5X 1TWXB 1XVOA 1FAKH 1ID5H 1DUEA 4OS7A 3VGCC 1PPCE 1CGIE 2O8MA 1HV7A 5TCCA 4Y7AA 2PSXA 1MAYA 1CA0B 5A0CA 3A7YA 3NRLA 1RIWB 1O3OA 5C5NA 1WQSA 4O3UA 1C5WB 3BIUH 5F53A 2BD3A 5EJ1A 4FXGH 4VGCC 1COWD 1IOEA 1KDQA 1HGTH 3GDVA 4O3TA 3LIWA 5AVDA 3RXVA 2GCHF 2NU3E 4ZHLU 3A87A 2XTTB 1P12E 2IJD1 1QA7A 3TU7H 1YP9A 1BTUA 2ZCLP 2TGDA 2ZGJA 1DANH 2G55A 1UHBA 1V2QT 4XBBA 2TGTA 3L3TA 1SG8B 1BHXB 4KGAA 3TIUA 1EJNA 5DGJA 1NO9H 3TJNA 1SQAA 1M9UA 2TIOA 2KCAA 1SR5C 2BLWA 3E0PB 3ZVBA 2GMTB 3LJJA 3A88A 2Z9KA 1YLNA 3A83A 1OS8A 4X2YA 3DCLA 3QDZB 4KTCA 3F2HA 1NROH 1S6FA 3KNXA 2G4UA 4MLFB 3V12A 4X6NA 3RXCA 1H9LB 1DE7H 1Y3VA 1MUEB 3GY8A 1BMMH 3A7VA 2XC4A 1FDPA 1O2WA 3UREA 1WV7H 2A4OA 4OS5A 1GL1A 1GBTA 2XBWA 1JWTA 4OS1A 1K21H 3KYGA 1A46H 1CHOG 2Z94A 2FWWA 3S9CA 2ZPRA 1QL8A 1GJ5H 2FESH 5A09A 2AGIX 1OWIA 1C5YB 1YKTA 3QGJA 1NBME 3M5LA 1QTFA 1C1OA 1O2SA 3TK9A 5EGMA 1SSXA 4CRGA 5JDUB 2YOLA 3NCLA 1D3TB 5FHTA 3RXBA 1DS2E 1OP0A 2V3HH 1EZUC 3SYJA 3FAOA 3FZDA 4IBLH 1TLDA 3MNCA 3T25A 1EATA 3CNRA 1THPB 4Y79A 1C5MD 2YMSB 2ZG0H 4K2YA 1IQKA 2FODA 1OKXA 4E7RG 1NRQH 1QA0A 2A2XH 3SBKA 2VGCC 3D23A 4X1PU 1AHTH 1FN6A 4KELA 1WYKA 3ZVEA 7GCHF 1F0RA 3P8FA 4ZHMU 3WWFA 4AFSA 4B75A 3H7OA 1MD8A 1P04A 1P02A 1IQEA 2FLRH 4BOHA 4X1SU 1K1MA 2C8YB 3CP7A 3Q3KA 4IN1A 3VB6A 1EAWA 3P70B 1EPTC 4ISNA 2A5AA 3BTKE 4HGCA 4H6SB 2ZFSA 1EXFA 3F3BA 2J9NA 2C93B 4DIHH 2GCTB 2VBCA 1K1JA 1YLDA 2GKVE 1MKWK 1S0RA 2QV1A 2J98B 2O8LA 2RA0A 1YCPK 2ZGHA 3SU2A 3N7OA 2O9QA 1O2GH 2HOBA 2LNCA 5IYTA 4X2WA 3VEQB 2XWAA 4JYUH 3RU4E 2AIPA 1E35B 2ZHWH 2B7DH 4K1SA 2EC9H 1JRSA 1GJAB 1AZ8A 2BYAX 2P93A 2FDAA 1P2OA 4ESTE 2H5CA 1KXBA 1O2HA 2R9PA 2P16A 4MPWA 2WUCA 2ZP0H 3ZZ5A 3M5MA 1G3EA 1TNGA 1O3GA 4TPYA 1RD3B 4FUHA 1H8DH 2KCOA 1NU7B 2OC8A 2HLDD 3PLPA 1EUFA 1GVKB 1L1JA 2VH6A 1GG6C 2Q1JA 1W7GH 2XWBI 5C94A 4A1TA 4Y11E 1KXFA 5CMXH 1P05A 1O3JA 3I78A 4CHAB 1BQYA 1C1VH 5GNDA 3VB4A 3A81A 3RXLA 1C5LH 3FP6E 1A1RA 2BQ6B 5A8YA 2VVUA 1NS3A 1S6HA 3A7ZA 3E1XB 1FY1A 1HAVA 1LQEA 2WUBA 4ZH8A 3S7KB 4D9RA 1GPZA 3VB3A 2G00A 1A0JA 1BMNH 3KQEA 1O2YA 1W2KH 1FJSA 2BTCE 3JZ2B 2XC0A 4E06H 1GGDC 1SGTA 4ABBA 1O3DA 1C2LA 1T7CA 3HK6B 3U1IB 3UPEA 3HPTB 1A4WH 5BPEA 1Z8GA 3DHKH 5I46H 1C1MA 4DVAU 1CO7E 3M7QA 2H9TH 1BJUA 4ZAEA 1NT1A 5B6LA 3PMJA 4RT1A 1C5PA 1GMHG 1AO5A 3LPRA 4YZUA 4ABJA 1BBRK 2JKHA 3F9HA 4CRDA 1IQIA 2ZDKA 1TX8A 4CRCA 1SGFA 1N1LA 2PKAA 1J8AA 2ZC9H 2Z9IA 2O8UA 1YPEH 3SORA 2OD3B 1BTZA 1O2XA 3TLOA 5LPRA 5HYOA 1D3QB 2H9EH 1C5QA 3DT0H 1W0YH 2CHAC 2J97A 1KIGH 4X2XA 1OOKB 4FETA 3H5CB 3UWJH 1GI9B 3PRDA 1KXEA 1V2OT 3BTEE 3PWBA 3KQ5A 5AFZH 4CBOA 1AE5A 2F9NA 1FZZA 3LOXA 5G4BA 2C8XB 1QY6A 3QK1A 2ZTXA 1GBDA 3LH3A 1MTUA 1SGEE 1CE5A 1UJ1A 2EI8A 3ENSB 3HK3B 1A61H 5ESTE 2EA3A 1O5EH 1GI5A 3EA9A 4WMEA 5FCKA 2HNTC 1QBVH 1ETTH 2W3IA 3V13A 1B0FA 5EU8A 1UCYK 2OBOA 2OQ5A 2LELA 4ZMAH 1MAXA 2Y81A 2V0BA 1V2RT 4DOQA 2JIZD 2Z9GA 1IQHA 2HPQH 3IITA 2Y5HA 1A0LA 1BRUP 1CA0C 1G32B 1TMUH 3TITA 5EOKA 2WSSD 1K1LA 1RIWC 1VJ9U 1ZSKA 3TPIZ 2F4LA 1FV9A 1C2GA 4AG1A 1TALA 1TRMA 4FOUC 2SGAA 2ZDNA 3E16B 1MZDA 2DUCA 1SPJA 1OP2A 4DJZB 3FO8D 2PP6A 5L2YH 4VGCB 5DP4A 2FI3E 2NU4E 2ZU4A 1WTHD 2PFEA 1K1OA 1ZYOA 3NWUA 3Q3YA 2D8WA 4Q63A 3OEHD 5K0HA 1AVXA 2ZKSA 3MO6A 3EYDA 8LPRA 2JH5D 2QF0A 1D3DB 1UVTH 1S84A 2AHME 2GMTC 1LO6A 4Z1MD 1QRWA 3LKWA 3MU4A 3UNQA 1HYLA 5CHAB 1Z8IB 1ZTLA 3RXHA 5GIBA 3U8RH 3QLPH 3OY5U 2GJGA 5EW2H 1W8BH 4B6EA 5EXLA 2BDCA 3A80A 1RGQA 1SVPA 2JH6D 4M7GA 1GBAA 1ZGVA 4Y76A 3RXUA 3UFAA 3B23B 5H4IB 1O0DH 4AZ2B 1BMAA 4XD7D 1FI8A 3F68H 2XCFA 4Y71A 1O2JA 1J16A 4BAMB 1FQ3A 4GVUA 4WH6A 5GPIB 1ELCA 2PKSB 2BZ6H 1O3EA 3MQKC 3MHWU 4LOYH 1YYY1 1SGQE 1CBWB 2P3FH 4A1VA 4NZQA 1EZQA 1CT2E 1MH0A 3GCTG 2BVRH 2RDLA 1P2IA 5FAHA 5DN6D 3URDA 2YMSC 4B1TA 1ZRKA 5DP3A 5JBCS 2Z6BD 2J98A 4K1TA 5DSFA 1HAXB 1TRYA 4ASUD 3PV2A 4YESB 1TE0A 2J38A 2C3SA 4F55A 1F5KU 1MCVA 5C1UA 9ESTA 1HAZB 1UVPA 2HALA 2Y7XA 3SGBE 1BB0B 4K69A 4U32A 1GI8B 2F83A 4NIXA 5T6DA 2CXVA 1YCPM 4NWKA 1Z71A 4Q80A 2ZFRH 1TRNA 3RMLH 2G81E 4X2VA 3ZZBA 1O3IA 3KEEA 3R3GB 1IHSH 4NA7A 3B9FH 3RU4T 2PV9B 2VWMA 1EB1H 3LGYA 4NA8A 1EPTB 1AFQB 1GBLA 1GI0A 2GCTC 4YM9A 2QXHA 6LPRA 3HATH 3EAJA 3AW0A 2GP9B 1C5XB 1AZZA 1BA8B 4OGXA 1SGCA 3BSQA 2K8IA 1PYTD 1GBCA 1XUJA 2A0QB 4UFGH 1GMDF 3A8DA 1YLCA 1HIAB 1NFYA 3GY2A 1SQTA 4IMQA 3M5NA 4FU9A 3NK8A 1T8LA 4OS2A 5PTPA 2F9PA 2HPPH 4YT6H 5HM2A 2UUKB 1ELVA 5B6OA 3MU1A 1Z7KA 2ZCHP 1ZHRA 4BAKB 3VFEA 3HKJB 1GVLA 2ZDVH 4DY7B 1ZSJA 2QAAA 5GWZA 4I8JA 1L4ZA 1OHHD 4INKA 1V2KT 3UAIC 4THNH 3TK6A 5ETXA 1A0HB 1F5LA 3SNDA 1YC0A 1MD7A 1T31A 5CHBA 1FPCH 3TJUA 4TY6A 2YNAA 4CHAC 1GBEA 1PPBH 1YPLH 1NBMD 1NFUA 3KN2A 2H5DA 1BIOA 1V2ST 3EA7A 2BLVA 5AF9H 4BANB 5LGOA 3LGIA 4D9QA 1ELTA 3PTNA 1O30A 1KSNA 3ZIAD 4GLYA 2FYRA 5K7RA 2TGPZ 4I8KA 1P2NA 2QIQA 1SGRE 4HZHA 3RLYH 1WTGH 1O3FA 2PW8H 1MKXK 4H4FA 3SJ8A 2P3UB 2G5VA 2RFKC 1VGCC 1E34B 4IC5A 3WY8A 2FEQH 1ZMNA 8GCHG 4X8UH 1D6RA 5J4QA 2HGTH 1HAHH 4B71A 2ZTZA 1O39A 3ODDA 1BRCE 3S9AA 1OP8A 1QQ4A 5EXMA 3RXFA 3ZVFA 2H1UA 3F1SB 1F0UA 1KTTB 4TWYA 1Z1JA 1NESE 4UE7H 1FUJA 2C8ZB 1AVWA 5EW1H 1H8IH 2SGQE 3BTME 2M5TA 1GHWH 1ZJKA 3RM0H 1JRTA 3RP2A 2TBSA 1ZPCA 2ANKH 3MNXA 3DSPA 4IW4E 4JK5A 5HGGA 3RM2H 3ZYDA 7LPRA 3A82A 5DO4H 3AAUA 3N99A 4I7YH 3U28C 1OYQA 1KLTA 3ZV8A 4O97A 2WINI 5FX6A 3M7UA 3WWBA 5KECA 1SGPE 1LPKB 3KGPA 1H4WA 1E37B 1A5IA 4AGJA 4X6MA 1DX5M 2FOGA 3VXFH 1ANBA 1CSOE 4Q2KA 4ASHA 5JYIA 4D76A 1UTLM 3LH1A 1XUGA 1EZXC 1TNHA 2A4QA 3DUXH 3ZV9A 5F8XA 4ABAA 5C17A 2GDEH 4BXWA 5EXNA 4BAQB 1GI7B 1GVZA 4F49A 3UTUH 1HDTH 3VPKA 4D7FA 7ESTE 3QN7A 1SHYA 1QL9A 3EQ0H 1GJ7B 1MZAA 3S9BA 4D7GA 3SGQE 2TRMA 4X6OA 4CRFA 1PFXC 1GI6A 1WSSH 1WQVH 3KYFA 2TPIZ 3D65E 3SV8A 1C1QA 3MWIU 2FX4A 2QGRA 3U1JB 1AMHA 1RJXB 1T8NA 2ESTE 4X1NU 1DSUA 3BEUA 2R0KA 1H8HD 4UFEH 1AWFH 5LPFA 2ZHEH 4Z6AH 2QYIA 3V3MA 1O2PA 4QT8C 1ESAA 2R3YA 5EQRA 1CGJE 3U9AH 2ZECA 3VB5A 2ZFFH 3FN8A 2QN5T 2HNTE 3SU3A 4NWLA 1GHBG 2DE8A 5CHAC 1K2I1 4XFQA 1O2ZA 3UQOA 1LVOA 2PSYA 4U30A 2TGAA 1KY9A 2G4TA 3URCA 1HAOH 3PMAB 1WOFA 2J2UA 2BXTH 1N8OB 5KEDA 3N7EA 2BY9X 4I32A 3PRBA 1AN1E 1TA2A 5JB9S 2FI5E 5CE1A 1NN6A 2KAIB 2ZQ1A 4KTSA 1HJ8A 1J17T 1TBZH 2PKSC 3P8NA 2ZCKP 3GYLB 4MPUA 3L6PA 2G52A 1IQJA 1TGNA 4AC9A 2B8OH 3SV6A 1CBWC 5F03A 5GCHF 5F6MA 1LHGH 1DUAA 1GJBB 1E36B 2VINA 4B6FA 1Y5BT 1EPTA 5A0AE 3MNBA 1P2JA 1MABB 1C5VA 1EKBB 4ACBA 1LPZB 4ZUHA 3I77A 5ESBA 2FOMB 1DT2A 5A2MH 2AYWA 4ZKSU 1YPGH 3KCGH 2FPZA 3K6YA 2JDID 1LMWB 5DP6A 2PGBB 4FVDA 4TYDA 2W5EA 1VITF 2STBE 1O5CB 4RKOB 3W95A 3ZZAA 2HVYB 3DFJA 3QZQA 1O2LA 5HXFA 2GVFA 1D4PB 4DCDA 4MTBA 1KLJH 4H6TA 4IMZA 4MG3A 4K60A 1W0KD 3GCOA 1C1SA 3KL6A 2STAE 3AAVA 1UK2A 1DM4B 1AFQC 2BD7A 2ZDMA 1J15A 2ANWA 2AGGX 4LK4A 1U6QA 1T32A 3P92A 1GJ6A 2VIWA 2KX4A 1JIMA 1SLXB 1O5FH 5T3HA 2F3CE 1C9TA 5C1XA 4WXIA 1GMCF 4X8VH 4WJG2 2W7UA 3BTDE 4FU7A 3SU5A 2ZA5A 2GDDA 1Z6JH 1QGFA 7KMEH 1CHGA 1GBIA 2G5NA 1XXDA 2OC7A 1IQLA 1QBNA 2JJ2D 3S69A 3MO9A 2FXRA 4ISOA 3RMMH 2JH0D 5FL7D 1KXDA 5C67A 2W3KA 2BX4A 1W0ZU 4X1RU 3SJ9A 5CDFE 2NU0E 4CREA 3ATKA 3GY7A 1WXRA 2GCHG 1QCPA 2O8WA 3RC4A 2P95A 2O8TA 3KIDU 1G36A 5JBTA 3PMHB 2OINA 2C4FH 1W10U 2THFB 3T26A 3OEED 3LGTA 3TH2H 1KTSB 4NG9H 1F2SE 2SGEE 2A7JA 1YPJH 2AEIH 1DDJA 1ANCA 2BDAA 1AKSB 4ABEA 1C1RA 1GI2A 2CF9H 1V2LT 3H7TA 3I29A 2CK3D 2OCVB 2QY0B 2QXIA 1Y5UT 3F2FA 3U98H 1ELGA 1W14U 2A1DB 1UMAH 5HIZA 3MYWA 5C3NA 1GBJA 4SGAE 1QBOA 3SUEA 1UTNA 1DY9A 3ZZ3A 4FUIA 1ANDA 2B0FA 1V2UT 1TQ0B 4JMYA 3RXPA 1VGCB 1ZHMA 3TVJB 2EI6A 4ABDA 2QF5A 5GJ4B 4P02A 2XXLA 3BN9A 1EX3A 1E0FD 2FOHA 2OP9A 2V3OH 2ZHQH 1LKBA 1E79D 1EOLA 2A4GA 3FANA 2XRCA 3MOCA 4NGAH 2FOBA 1LTOA 1QHRB 1GJ4H 1GI3A 1O5DH 3S7HB 3E8LA 1GHAF 1INCA 1JOUB 1PQAA 2OUAA 4DGJA 1O5AB 1VCPA 4J1YA 2AS9A 3TNSA 1NFWA 2Y82A 1G37A 3MU0A 2BLOA 3A85A 5L6NH 1TNIA 2P3TB 1W13U 4I8LA 7GCHG 1O3HA 2D26C 2FI4E 1Z8RA 4PROA 1UTJA 3U8TH 2FOAA 5DKMA 2WPHS 1LHCH 4CH2B 1EFRD 1BZXE 4HI3A 4P00A 4BXSA 1OSSA 1TMBH 1GDQA 4A1XA 2FP7B 3UUZA 1ELAA 1AB9C 1S5SA 3TJOA 1ELDE 1ARCA 1FX0B 3VG8A 5HM9A 2G51A 1MMJN 1DWCH 1BRBE 1C5RA 4I31A 3QTVH 3SI3H 1DPOA 1V2JT 2BDYA 3M3TA 3ZZ9A 4ZCNA 4ZKOU 1LHEH 2VIVA 2HNTF 2Y5GA 2RG3A 1BT7A 1V2VT 1SOZA 1VCQA 3BIVH 4XOJA 4DT4A 1W3CA 1GI1A 1V3XA 1SLUB 2ODYB 2W6JD 3SU4A 2VWLA 5E8EH 3MO3A 3A86A 3UIRA 1H9IE 1X7AC 1UTKA 1C5TA 2ZPQA 4GAWA 4GCHF 1CQQA 3MH4A 4UFFH 1KMHB 2ANYA 1YGCH 2XW9A 2Z9LA 2HLCA 3D62A 4XBCA 1SLWB 1VZQH 1XVMA 2A4RA 1CA8B 1AUTC 4AFUA 1HLTH 2ZU5A 1O2UA 4WMFA 1TFXA 1RXPA 5F8ZA 5A8ZA 1TAWA 4ISLA 1BMFD 1IQMA 5E0JA 8ESTE 3F6UH 4NIVA 1NRRH 3TGJE 4B2BA 1P10A 1O32A 1HAYB 2GZ9A 2BQ7B 3V7TA 3SNAA 5JBAS 1EJAA 1MTVA 1IQGA 1C2JA 4R0IA 2VVCA 8KME2 1TBRH 4CRAA 1JXPA 1O3KA 2WPIS 4GHQA 1TONA 1BHXF 1AWHB 2SFAA 4CR5A 1P09A 3T2NA 1RTKA 3SV7A 1N8OC 2UWOA 3F0OA 3GICB 3T5FH 1GL0E 4UD9H 5DPAA 2OBQA 1SFQB 1BOQA 2ZFQH 3OYPA 1FAXA 4AFZA 1CT4E 1JMOH 2QF4A 3P6ZB 3UOPA 3ITIA 3RXEA 1E1RD 4TSFD 3STIA 1A5HA 1HBTH 2WV9A 1Q31A 2F91A 4ZXXH 5FXLA 4TPIZ 5JPMH 5DG6A 4YOJA 2IN2A 1KDQB 1AU8A 4DW2U 4ABGA 1UTOA 5EJZA 1P01A 4LZ4B 2A2QH 1L2EA 2KFWA 1ZRBA 3DSOA 2PR3A 1K1NA 5T1VA 1C5NH 4Y6DA 1O2QA 2KR7A 1V2PT 1UHBB 1ABJH 1YPHC 3W1EA 2J5UA 4SGBE 1UVUH 2AH4X 3ZVGA 2DE9A 3ATWA 6GCHF 1SGYE 1XKAC 2ASUB 3PV4A 3A84A 2BZAA 4AGKA 1AIXH 1TYNA 2GGVB 3OTPA 1Y3WA 5EG4A 4AOQA 1ESBA 2BD8A 1HB0B 1DY8A 3BG8A 2VIQA 1FIZA 1TX6A 2FTLE 3UOUA 1O3PB 1DWEH 2UUJB 3BTTE 1B7XB 2WHXA 1OWEA 2FTMA 4IC6A 1O3NA 1PQ5A 3ZZ7A 2A7CA 3RXRA 1XUFA 1NRPH 2BHGA 1EAXA 4FUFA 4BTTB 2FZZA 4X1QU 1DWDH 4IN2A 2IOTA 2BY8X 2FM2A 1KLIH 3T28A 3SQEE 4WY3A 2QF3A 2OXSA 1QL7A 1TGBA 3O8CA 4NSVA 1FPHH 1G2LA 1FY8E 2OC0A 2JJ1D 1ABIH 5DP8A 1DVAH 3BTQE 2VIOA 2YNBA 1WBGB 4GHTA 4DURA 2R3UA 1C5UA 1C1UH 9LPRA 1MKWH 1UK4A 3A8AA 1YCPH 2KM0A 2XBYA 4U01A 2R2WU 1THRH 3GDUA 3GY5A 1C1PA 1GBFA 5E0HA 2Z7FE 4JZDH 3SZEA 5C2ZA 1P3CA 1QR3E 1TGCA 3OFND 3SNEA 3TJVA 1O36A 2J4IA 1VKYA 3ZZ8A 1YM0A 3KF2A 4AX9H 1BTWA 3A89A 3O8BA 1N6YA 2A5IA 3W94A 2VWOA 1TGSZ 4OM9A 1D9IA 1TNKA 4TT3D 3SU0A 1HFDA 2Z3DA 2SGPE 1UK3A 2EI7A 1AD8H 1CGHA 1UVOA 1ELEE 4UDWH 1BTXA 3RXMA 1ZSLA 4HFPB 1C2IA 1P2QA 1Y5AT 1BTHH 4ZROA 1LCYA 2HWLB 2KCPA 2ODPA 1OWJA 1FY4A 1N6XA 3SN8A 4AG2A 3MU8A 1Z8JB 1ELBA 1EQ9A 5L30H 1K0HA 4K8BA 1EP6A 1AUJA 3QGNB 1C4V2 1DFPA 2I6QA 2W6ID 1EJMA 4Y10E 1QB6A 2FIRH 1ZPBA 3MNSA 1P06A 3PLKA 4ABFA 2XC5A 1CHOF 1T8OA 1Y59T 3SNCA 3ATMA 1G3BA 3SNBA 1AY6H 5EJLA 2ZGCA 1SI5H 1ZJDA 1MQ6A 1ZTJA 3B8JA 1QZ8A 4Y0YE 4BTUB 3MH6A 4TWWA 1EZSC 1NC6A 2ZFTA 3Q76A 1MTWA 1GDUA 1SGIB 1UVSH 4NCYA 1BBRH 1C2KA 1GBKA 3FZZA 4JYVH 2YMSD 2BQWB 4MNVA 4HTCH 2BY6X 4MNYA 1Y8TA 1ACBE 1C1TA 1NY22 4XRNA 1ETRH 1MQ5A 1Z6EA 2G8TA 1GCTB 3WW7A 1HJ9A 2UWLA 2AMDA 3GY4A 1DITH 1HAVB 2FX6A 4KP0A 1SGDE 3SJOA 4NIWA 1O3LA 1DICA 2K1QA 1EAIA 1XUHA 1IQNA 1GI4A 4UFDH 1GJCB 4WXVA 3DD2H 1F5RA 3LT3A 4MNXA 5EPYA 2OQUA 2FOEA 2L74A 5HIYA 2FS9A 1AB9B 5C0TA 1NPMA 1RFNA 1VCWA 2BDIA 3CS7A 2K0QA 2WYGA 2CV3A 2AGEX 2FYQA 4FVBA 1GMDG 2JETB 1G3CA 2B9LA 1EASA 1ZOMA 3HKIB 2PKAB 1PQ8A 3UNSA 3M3VA 3OE7D 4DT7B 3IWMA 3M5OA 1EP5A 2P8OB 3LU9B 2ZI2H 1A3BH 1GCDA 3MI4A 1C2DA 3SHCH 1S85A 1UCYH 4GPGA 5C5OA 2BLQA 1C2EA 4K3JA 3UQVA 4MNWA 5FBIA 1TABE 3K65B 3NKKA 4FUBA 2EY4C 3A8BA 2CGAA 3PYHA 1F0SA 1C5ZB 5HMAA 1C4Y2 3QO6A 1ZR0A 4NZLA 1DXWA 3BF6H 2WPLS 3M37A 5EIYA 2AERH 2A7HA 3ZZDA 3K9XB 1P11E 4INHA 4Z0KA 1HJAB 1LPGB 2AMQA 3QTOH 4J2YB 2GV7A 4E05H 3ATIA 1D6WA 1FIWA 2BOKA 5EQQA 2Q6GA 3R0FA 1K1PA 4XSKU 2VVVA 4GSOA 1TMTH 1B5GH 3AW1A 1G30B 1BCUH 4OS6A 3SGAE 4DG4A 4NA9H 4AB8A 1MTSA 2PTNA 1O2NA 3RMNH 2EQNA 1T4UH 4ABIA 1P2MA 1XUKA 3Q77A 3SV2H 3NPSA 3LONA 1TNLA 3OY6U 3JZ1B 3RXAA 1H9HE 3TGIE 3M3SA 2PHBA 3MFJA 4RSPA 2CJIA 3EA8A 2WYJA 2FO9A 3HGNA 1DSTA 3DA9B 1TNJA 1MBMA 3OX7U 1O33A 3E90B 1QB1A 1KYNA 1SHHB 3A7TA 3GCNA 3RXSA 1OWDA 2IPQX 2QXJA 2WZQA 1THSH 2SNWA 1O3MA 3STJA 2BVXH 2BOHB 3GY3A 1GMHF 3ZVCA 1DLEA 2P94A 2Z3EA 4FUGA 4Y8XA 1IQFA 1BUIA 4MPXA 3F2GA 3MTYA 1HIAA 5DP7A 5EPNA 4ZXYH 1Q2WA 1O2IA 3FOAA 1MTNB 3SU6A 4YLUA 1TB6H 3TNTA 2VB0A 4KKDA 1C2MA 1S0QA 2F9VA 1UTQA 4D8NA 2QXGA 1TOCB 1TIOA 1HPGA 2BXUH 2F43B 3SQHE 1RS0A 5KGOA 5EODA 1TPSA 1O2RA 1Z1IA 1A7SA 3FVFB 2ZWLH 1RTFB 2ODQA 3G01A 3RXGA 5I25A 2RDEA 4F4OC 2BDHA 4TY7A 3PROA 1ZTKA 2UWPA 4K8YA 1SQOA 2A32A 6CHAB 3M7TA 3KQCA 3BG4C 1XMNB 4O9VA 4JZFH 3QWCH 3SO3A 4YO9A 1CT0E 4U2WA 1XX9A 3S0NA 2NWNA 2QCYA 1O34A 2VNTA 5E2PA 4XE4A 2OK5A 2PLXA 1EOJA 1SBWA 3GCHB 4CRBA 3FP8E 3EGKH 1BTPA 1SGNE 1W7XH 3M36A 4X6PA 3PO1C 5FPYA 5LH8A 1QJ1B 1YPHE 2OTVA 2V3MA 1TX7A 1NRSH 1TBQH 2BVSH 4BAHB 1V2NT 3V0XA 1G9IE 1WAYB 5FX5A 1O2TA 1ZHPA 1QJ7B 3MMGA 3RMOH 1GJ9B 4K1EA 1C5SA 2SGFE 5TCAA 4X8TH 2GV6A 2A45B 1P57B 3RXOA 3SJKA 1BITA 2GT7A 1QRZA 2J95A 1QNJA 2A31A 1PJPA 1ZMJA 3F9EA 4MQAA 3UY9A 1AFEH 1MU6B 2HVXA 3AK5A 4Y0ZE 1NM6A 2IPHA 2BD5A 2R0LA 5F8TA 5AFYH 1TPPA 4JZEH 1P9UA 3LGUA 3SHAH 5LPEA 5DJ7A 1MBQA 2QA9E 2WPDD 1YPKH 1O3CA 5A0BA 1O5GH 2NU1E 1SFIA 1ZGIA 4X8SH 3UR6A 1CVWH 1D3PB 1G3DA 2WV4A 2VWNA 3EE0B 2C90B 4M9FA 1Y3YA 2LPRA 1TA6A 2ANMH 4ZHAA 4B2AA 1A3EH 5E0GA 1C2FA 3T27A 3T29A 1AQ7A 1T4VH 4WH8A 4AN7A 4MPVA 1V6DA 2WPKS 3RDZA 3LDXH 3HGPA 3GYMA 1GJ8B 1NZQH 3RXIA 5GCHG 1HCGA 1K1IA 1IAUA 3LJOA 3OU0A 2ZFPH 4RI0A 1C9PA 3GS9A 2GT8A 1C2HA 2ZPSA 2CMYA 4ABHA 1AI8H 3FP7E 3LC5A 4JYTA 4NFEA 3OSYA 2AIQA 2FOCA 1PPFE 1MKXH 3RXKA 2GZ7A 1C1WH 2VIDA 3PMBB 4NFFA 3QX5H 3ZZ6A 1O2KA 2UUFB 1MCTA 3E91A 4I33A 2B5TB 3TH4H 2XBXA 2Y6TA 1KXCA 1VITG 1P0SH 1SOTA 3GCTF 4GUXA 3BEFB 2ILNA 4I86A 3QUMP 3SUDA 3H09A 1L4DA 4OS4A 1GCTC 1TGTA 3NZIA 4B73A 1HUTH 2ZNKH 1EB2A 3PB1E 3AASA 1GHZA 1UTMA 3QZRA 3UR9A 2ZGXH 1HAPH 1C1NA 1F7ZA 3KQBA 2Y5FA 3O8RA 2ALVA 1FN8A 1ETSH 1K9OE 3UWIA 4JZ1A 3M35A 3EE7A 4IGDA 5FPSA 4AFQA 4NIYA 2BMGB 1L1NA 1GMCG 4X0WU 4AB9A 2VIPA 2V7QD 4A7IB 1O2VA 2JETC 1ZMLA 2L6OA 1PYTC 2ZTYA 4BTIB 5GXPA 5SGAE 1YPMH 3K6ZA 4LZ1H 3A7XA
chains in the Genus database with same CATH topology
2P8OC 3U8OH 3PWCA 1J14A 1S81A 1VJAU 4B76A 3ZZCA 4WWYA 2W7SA 3SW2B 1PPZA 3T62A 4E7NA 1HNEE 5JBBS 3GY6A 3FFGA 2BM2A 3NXPA 2KAIA 4CBNA 3VGCB 3E3TA 3D49H 4B2CA 2GTBA 2AMPA 3RC5A 2P59A 2I6SA 4FUDA 2GX4A 3NUMA 3MU5A 4INLA 4JZIA 1FXYA 4FUEA 3P95A 1ZPZA 2ZIQH 1O5BB 2BDGA 5GDSH 2ZDLA 1ANEA 5AHGH 2A5KA 1BRAA 2R2MB 4RN6A 3P17H 1HJAC 1O2OA 1WUNH 2ZQ2A 4RKJB 2CN0H 2XYAA 3RLWH 2D1JA 3SZNA 3RUOA 1K22H 1LKAA 1DLKB 3GISB 1H1BA 4I8HA 1P8VC 4XBDA 1Y3XA 4UONA 5L2ZH 1BTYA 3PLBA 1GHYH 3KQDA 4UEHH 4YTAA 3TK5A 1E38B 2H9HA 1UO6A 3AVZA 3BTGE 3MH5A 1A5GH 1P9SA 2GZ8A 4FU8A 1NFXA 1GBMA 3Q00A 3ZZ4A 1QRXA 2J92A 3ODFA 2ZF0H 1NTPA 4WMDA 5A8XA 1P3EA 1ZLRA 1QQUA 1JIRA 4CR9A 5DP9A 6ESTA 1V2TT 5C20A 1HAGE 2EEKA 3GDSA 1BJVA 3LC3A 1Q3XA 4O03A 1GHAG 1LVBA 1BMLA 8GCHF 4WVPE 1O37A 2FOFA 1O35A 4FUJA 5T6FA 1MTNC 3SU1A 1UTPA 2QC2A 1GHVH 2CF8H 1PQ7A 4AYVB 3Q3XA 3SI4H 1HXEH 4Q7XA 2WPJS 1HAIH 2W26A 1FNIA 4I8GA 1FY3A 3CS0A 3SV9A 3LGVA 2WPMS 5J4SA 1MU8B 5DK1A 2Y80A 4IS5A 4R8TB 1K28D 3PM3A 4NSYA 2VGCB 1F92A 3CENA 1DXPA 1AVGH 6CHAC 4Q7ZA 3KHVA 2RCEA 4MVNA 3VXEH 1SL3A 1QB9A 3MH7A 1OXGA 1J9CH 1QJ6B 1P03A 4ZKNU 1O31A 3BG4B 3BV9B 1HXFH 1CU1A 1W12U 1T8MA 1AKSA 2NU2E 1DOJA 2PWXA 3ELAH 3ZYEA 3TH3H 1C5OH 4Y7BA 1O3BA 2ZHDA 3GCHC 2BD4A 1XKBC 1SGFG 4Q7YA 4AORA 1LQDB 3BTHE 1SB1H 3ZVAA 5ABWA 3C27B 1G2MA 1QIXB 2HRVA 1BBRE 2ZEBA 3P8GA 1SC8U 2H2ZA 2GD4B 1F0TA 2ALPA 4GCHG 3PO1B 4Y8YA 2ZDAH 1P2KA 1RTLA 2FLBH 2H6MA 1V2MT 3ESTA 2IJOB 1GBHA 1NU9A 3E6PH 4DIIH 2PTCE 1GJDB 4K5ZA 4A5TS 2BX3A 4OGYA 1GHXH 3SUFA 1YF4A 2ZZUH 3TGKE 1O38A 2Q6FA 1C4U2 4ZKRU 3BTFE 1S82A 1SLVB 5IDKA 3RXQA 1QFKH 3A8CA 1OX1A 3ATLA 1TPOA 3SUGA 3C1KA 2FMJA 1LHDH 2UUYA 2OC1A 1TOMH 2RA3A 1IHTH 1OWHA 4WF8A 1SMFE 1ESTA 3P8OA 2XCNA 2VJ1A 4YOIA 1O3AA 3M61U 1LHFH 2F9UA 2J34A 1GG6B 1GHBF 2XNIA 4AYYB 2SNVA 2Y7ZA 1VR1H 4ISHH 1UCYE 2C8WB 2OLGA 3IG6B 2PUQH 2BB4A 3O8DA 2VH0A 5FBEA 1B0EA 3F9GA 3VB7A 4H42U 1DWBH 1TPAE 3OTJE 3RXJA 1FMGA 1L0ZA 2Z9JA 2ZU3A 4JCNA 1W11U 3F9FA 1XUIA 4CH8B 3LGWA 2PUXB 1ORFA 2F9OA 4YOGA 4A92A 4BAOB 1GBBA 1Y3UA 5C1YA 1AE8H 2AFQB 2J94A 4ISIH 3K2UA 1GGDB 3RXDA 1GDNA 3BTWE 1ELFA 4YLQH 1NRNH 2V35A 3SOSA 2Z3CA 1EAUA 1QURH 4XDEA 3RC6A 1ARBA 1O2MA 3DFLA 1KXAA 1OPHB 5T6GA 5TJXA 1XXFA 3U69H 1JBUH 2F9BH 5JB8S 1GWAA 6GCHG 1WCZA 2ZGBH 3SJIA 1LDTT 1XM1A 2ZHFH 1V2WT 5BRRE 2ULLA 1FONA 5E2OA 2BDBA 1VITH 3PTBA 4LXBH 1WU1A 2VU8E 2BD9A 2CHAB 1LVYA 2ZU1A 4Y8ZA 2WV5A 4JK6A 2XBVA 3RXTA 1TQ7B 1ZZZA 1L1GA 2D2DA 3L33A 1S83A 5FCRA 1PPHE 4YT7H 1OYTH 3RU4D 4FUCA 4KTUA 3A7WA 3BEIB 2ZU2A 4A6LA 1BDAA 3GOVB 2BD2A 1AGJA 2FS8A 3E0NB 4MDSA 5DP5A 1LVMA 1RRKA 4BNRA 2SGDE 1YBWA 2BY7X 3EDXB 1FLEE 5FPTA 1OWKA 1FY5A 3ZVDA 1PPGE 5EQSA 3UNRA 2Q6DA 4B74A 2ZO3H 1PPEE 2PGQB 1HRTH 2V6NA 1A2CH 2BY5X 1TWXB 1XVOA 1FAKH 1ID5H 1DUEA 4OS7A 3VGCC 1PPCE 1CGIE 2O8MA 1HV7A 5TCCA 4Y7AA 2PSXA 1MAYA 1CA0B 5A0CA 3A7YA 1RIWB 1O3OA 5C5NA 1WQSA 4O3UA 1C5WB 3BIUH 2BD3A 4FXGH 4VGCC 1KDQA 1IOEA 1HGTH 3GDVA 4O3TA 3LIWA 5AVDA 3RXVA 2GCHF 2NU3E 4ZHLU 3A87A 2XTTB 1P12E 1QA7A 3TU7H 1YP9A 1BTUA 2ZCLP 2TGDA 2ZGJA 1DANH 2G55A 1UHBA 1V2QT 4XBBA 2TGTA 3L3TA 1SG8B 1BHXB 4KGAA 3TIUA 1EJNA 5DGJA 1NO9H 3TJNA 1SQAA 1M9UA 2TIOA 3E0PB 1SR5C 2BLWA 3ZVBA 2GMTB 3LJJA 3A88A 2Z9KA 3A83A 1OS8A 4X2YA 3QDZB 4KTCA 1NROH 1S6FA 3KNXA 2G4UA 4MLFB 3V12A 4X6NA 3RXCA 1H9LB 1DE7H 1Y3VA 1MUEB 3GY8A 1BMMH 3A7VA 2XC4A 1FDPA 1O2WA 3UREA 1WV7H 2A4OA 4OS5A 1GL1A 1GBTA 2XBWA 1JWTA 4OS1A 1K21H 1A46H 1CHOG 2Z94A 2FWWA 3S9CA 2ZPRA 1QL8A 1GJ5H 2FESH 5A09A 2AGIX 1OWIA 1C5YB 1YKTA 3QGJA 3M5LA 1QTFA 1C1OA 1O2SA 3TK9A 5EGMA 1SSXA 4CRGA 5JDUB 2YOLA 3NCLA 1D3TB 5FHTA 3RXBA 1DS2E 1OP0A 2V3HH 1EZUC 3FAOA 3FZDA 4IBLH 1TLDA 3MNCA 3T25A 1EATA 1THPB 4Y79A 1C5MD 2ZG0H 4K2YA 1IQKA 2FODA 1OKXA 4E7RG 1NRQH 1QA0A 2A2XH 3SBKA 2VGCC 3D23A 4X1PU 1AHTH 1FN6A 4KELA 1WYKA 3ZVEA 7GCHF 1F0RA 3P8FA 4ZHMU 4AFSA 4B75A 3H7OA 1MD8A 1P04A 1P02A 1IQEA 2FLRH 4BOHA 4X1SU 1K1MA 2C8YB 3CP7A 3Q3KA 4IN1A 3VB6A 1EAWA 3P70B 1EPTC 4ISNA 2A5AA 3BTKE 4HGCA 4H6SB 2ZFSA 1EXFA 2J9NA 2C93B 4DIHH 2GCTB 1K1JA 1YLDA 2GKVE 1MKWK 1S0RA 2QV1A 2O8LA 2RA0A 1YCPK 2ZGHA 3SU2A 3N7OA 2O9QA 1O2GH 2HOBA 2LNCA 5IYTA 4X2WA 3VEQB 2XWAA 4JYUH 3RU4E 2AIPA 1E35B 2ZHWH 2B7DH 4K1SA 2EC9H 1JRSA 1GJAB 1AZ8A 2BYAX 2P93A 2FDAA 1P2OA 4ESTE 2H5CA 1KXBA 1O2HA 2R9PA 2P16A 4MPWA 2WUCA 2ZP0H 3ZZ5A 3M5MA 1G3EA 1TNGA 1O3GA 4TPYA 1RD3B 4FUHA 1H8DH 1NU7B 2OC8A 3PLPA 1EUFA 1GVKB 1L1JA 2VH6A 1GG6C 2Q1JA 1W7GH 2XWBI 4A1TA 4Y11E 1KXFA 5CMXH 1P05A 1O3JA 3I78A 4CHAB 1BQYA 1C1VH 3VB4A 3A81A 3RXLA 1C5LH 3FP6E 1A1RA 2BQ6B 5A8YA 2VVUA 1NS3A 1S6HA 3A7ZA 3E1XB 1FY1A 1HAVA 1LQEA 2WUBA 4ZH8A 3S7KB 4D9RA 1GPZA 3VB3A 2G00A 1A0JA 1BMNH 3KQEA 1O2YA 1W2KH 1FJSA 2BTCE 3JZ2B 2XC0A 4E06H 1GGDC 1SGTA 4ABBA 1O3DA 1C2LA 1T7CA 3HK6B 3U1IB 3UPEA 3HPTB 1A4WH 5BPEA 1Z8GA 3DHKH 5I46H 1C1MA 4DVAU 1CO7E 3M7QA 2H9TH 1BJUA 4ZAEA 1NT1A 3PMJA 1C5PA 1GMHG 1AO5A 3LPRA 4YZUA 4ABJA 1BBRK 2JKHA 3F9HA 4CRDA 1IQIA 2ZDKA 1TX8A 4CRCA 1SGFA 1N1LA 2PKAA 1J8AA 2ZC9H 2Z9IA 2O8UA 1YPEH 3SORA 2OD3B 1BTZA 1O2XA 3TLOA 5LPRA 5HYOA 1D3QB 2H9EH 1C5QA 3DT0H 1W0YH 2CHAC 1KIGH 4X2XA 1OOKB 3H5CB 3UWJH 1GI9B 1KXEA 1V2OT 3BTEE 3PWBA 5AFZH 4CBOA 1AE5A 2F9NA 1FZZA 3LOXA 5G4BA 2C8XB 1QY6A 3QK1A 2ZTXA 1GBDA 3LH3A 1MTUA 1SGEE 1CE5A 1UJ1A 2EI8A 3ENSB 3HK3B 1A61H 5ESTE 2EA3A 1O5EH 1GI5A 3EA9A 4WMEA 5FCKA 2HNTC 1QBVH 1ETTH 2W3IA 3V13A 1B0FA 5EU8A 1UCYK 2OBOA 2OQ5A 4ZMAH 1MAXA 2Y81A 2V0BA 1V2RT 4DOQA 2Z9GA 1IQHA 2HPQH 3IITA 2Y5HA 1A0LA 1BRUP 1CA0C 1G32B 1TMUH 3TITA 5EOKA 1K1LA 1RIWC 1VJ9U 1ZSKA 3TPIZ 1FV9A 1C2GA 4AG1A 1TALA 1TRMA 2SGAA 2ZDNA 3E16B 1MZDA 2DUCA 1SPJA 1OP2A 4DJZB 5L2YH 4VGCB 5DP4A 2FI3E 2NU4E 2ZU4A 1WTHD 2PFEA 1K1OA 1ZYOA 3NWUA 3Q3YA 2D8WA 5K0HA 1AVXA 2ZKSA 3MO6A 3EYDA 8LPRA 2JH5D 2QF0A 1D3DB 1UVTH 1S84A 2GMTC 1LO6A 1QRWA 3LKWA 3MU4A 3UNQA 1HYLA 5CHAB 1Z8IB 1ZTLA 3RXHA 5GIBA 3U8RH 3QLPH 3OY5U 5EW2H 1W8BH 5EXLA 2BDCA 3A80A 1RGQA 1SVPA 2JH6D 4M7GA 1GBAA 1ZGVA 4Y76A 3RXUA 3UFAA 3B23B 5H4IB 1O0DH 4AZ2B 1BMAA 1FI8A 3F68H 2XCFA 4Y71A 1O2JA 1J16A 4BAMB 1FQ3A 4GVUA 4WH6A 5GPIB 1ELCA 2PKSB 2BZ6H 1O3EA 3MHWU 4LOYH 1YYY1 1SGQE 1CBWB 2P3FH 4A1VA 4NZQA 1EZQA 1CT2E 1MH0A 3GCTG 2BVRH 2RDLA 1P2IA 5FAHA 3URDA 4B1TA 1ZRKA 5DP3A 5JBCS 2Z6BD 4K1TA 1HAXB 1TRYA 4YESB 1TE0A 2J38A 2C3SA 1F5KU 1MCVA 5C1UA 9ESTA 1HAZB 1UVPA 2HALA 2Y7XA 3SGBE 1BB0B 4K69A 4U32A 1GI8B 2F83A 4NIXA 5T6DA 2CXVA 1YCPM 4NWKA 1Z71A 4Q80A 2ZFRH 1TRNA 3RMLH 2G81E 4X2VA 3ZZBA 1O3IA 3KEEA 3R3GB 1IHSH 4NA7A 3B9FH 3RU4T 2PV9B 2VWMA 1EB1H 3LGYA 4NA8A 1EPTB 1AFQB 1GBLA 1GI0A 2GCTC 4YM9A 2QXHA 6LPRA 3HATH 3EAJA 3AW0A 2GP9B 1C5XB 1AZZA 1BA8B 4OGXA 1SGCA 3BSQA 1PYTD 1GBCA 1XUJA 2A0QB 4UFGH 1GMDF 3A8DA 1YLCA 1HIAB 1NFYA 3GY2A 1SQTA 4IMQA 3M5NA 4FU9A 3NK8A 1T8LA 4OS2A 5PTPA 2F9PA 2HPPH 4YT6H 5HM2A 2UUKB 1ELVA 5B6OA 3MU1A 1Z7KA 2ZCHP 1ZHRA 4BAKB 3VFEA 3HKJB 1GVLA 2ZDVH 4DY7B 1ZSJA 2QAAA 5GWZA 4I8JA 1L4ZA 4INKA 1V2KT 4THNH 3TK6A 5ETXA 1A0HB 1F5LA 3SNDA 1YC0A 1MD7A 1T31A 3TJUA 1FPCH 4TY6A 2YNAA 4CHAC 1GBEA 1PPBH 1YPLH 1NFUA 3KN2A 2H5DA 1BIOA 1V2ST 3EA7A 2BLVA 5AF9H 4BANB 5LGOA 3LGIA 4D9QA 1ELTA 3PTNA 1O30A 1KSNA 4GLYA 2FYRA 5K7RA 2TGPZ 4I8KA 1P2NA 2QIQA 1SGRE 4HZHA 3RLYH 1WTGH 1O3FA 2PW8H 1MKXK 4H4FA 3SJ8A 2P3UB 2G5VA 1VGCC 1E34B 4IC5A 3WY8A 2FEQH 1ZMNA 8GCHG 4X8UH 1D6RA 5J4QA 2HGTH 1HAHH 4B71A 2ZTZA 1O39A 3ODDA 1BRCE 3S9AA 1OP8A 1QQ4A 5EXMA 3RXFA 3ZVFA 2H1UA 3F1SB 1F0UA 1KTTB 4TWYA 1Z1JA 1NESE 4UE7H 1FUJA 2C8ZB 1AVWA 5EW1H 1H8IH 2SGQE 3BTME 2M5TA 1GHWH 1ZJKA 3RM0H 1JRTA 3RP2A 2TBSA 1ZPCA 2ANKH 3MNXA 4IW4E 4JK5A 5HGGA 3RM2H 3ZYDA 7LPRA 3A82A 5DO4H 3AAUA 4I7YH 1OYQA 1KLTA 3ZV8A 4O97A 2WINI 5FX6A 3M7UA 1SGPE 1LPKB 3KGPA 1H4WA 1E37B 1A5IA 4AGJA 4X6MA 1DX5M 2FOGA 3VXFH 1ANBA 1CSOE 4Q2KA 4ASHA 5JYIA 4D76A 1UTLM 3LH1A 1XUGA 1EZXC 1TNHA 2A4QA 3DUXH 3ZV9A 5F8XA 4ABAA 2GDEH 4BXWA 5EXNA 4BAQB 1GI7B 1GVZA 4F49A 3UTUH 1HDTH 3VPKA 4D7FA 7ESTE 3QN7A 1SHYA 1QL9A 3EQ0H