1Y5MA

The crystal structure of murine 11b-hydroxysteroid dehydrogenase: an important therapeutic target for diabetes
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
265
structure length
265
Chain Sequence
EEFRPEMLQGKKVIVTGASKGIGREMAYHLSKMGAHVVLTARSEEGLQKVVSRCLELGAASAHYIAGTMEDMTFAEQFIVKAGKLMGGLDMLILNHITQTSLSLFHDDIHSVRRVMEVNFLSYVVMSTAALPMLKQSNGSIAVISSLAGKMTQPMIAPYSASKFALDGFFSTIRTELYITKVNVSITLCVLGLIDTETAMKEISGIINAQASPKEECALEIIKGTALRKSEVYYDKSPLTPILLGNPGRKIMEFFSLRYYNKDMF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Corticosteroid 11-beta-dehydrogenase, isozyme 1
publication title Crystal Structure of Murine 11-Hydroxysteroid Dehydrogenase 1: An Important Therapeutic Target for Diabetes
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 97
structure length 265
sequence length 265
chains with identical sequence B
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2004-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1y5mA00
4IDCA 4I1IA 4Y67A 1V9LA 1AN9A 5I8ZA 3H65A 3KVOA 5TSDA 3EMKA 3DDNA 3ROMA 1N7HA 1OZAA 3EGOA 1XR3A 3ZNPA 4G2NA 4MIYA 1YH3A 4QECA 3S2GA 1PIWA 3L0DA 4OXYA 1C1DB 4B4OA 1PQPA 1JW9B 1UXHA 4L75A 4CM1A 3D4OA 1N1GA 1WZEA 3LF1A 2JFFA 3I5MA 2ZB3A 2PZLA 2R6JA 5ILGA 1R0LA 1V3VA 4CM8B 1E7SA 5DP2A 1YOVA 4HKTA 4WASA 4O1MA 1DFHA 1KVUA 4WK6A 4PZDA 4DLBA 1YWGO 4FOSA 4ALMA 1O8CA 3GR6A 4WOJA 5T6BA 4A26A 1Y5MA 3ZU4A 3QQPA 3HB5X 2VTEA 3N74A 2Q1TA 4HADA 3HG7A 1LEHA 2IEDA 4WUVA 4K26A 2O4UX 2CVQA 2Q1WA 3UFXA 2NQ8A 4MVJH 4DQVA 4EJ6A 5CEEA 4E12A 1X7DA 3UH1A 5DOZA 2GZ3A 4N5NA 5F1PA 4I9UA 4CLDA 3C85A 2WM3A 4FD3A 1UP6A 3SLGA 5LDHA 2Q2WA 1KETA 3A14A 4PLPA 4XYMA 4CLRB 2Z1NA 3JYOA 1SC6A 2NUAA 4YJHB 3FNEA 3H2ZA 4CMGA 1Y9EA 2P9EA 1H9AA 4HV4A 1YBAA 1NHGA 1MUUA 2GN4A 3AM4A 3AY6A 1HTBA 3PZRA 4O0LA 2D8AA 2XXBA 5IXSA 2HRBA 1HE2A 4J0EA 4Y6PA 4D42A 3KM0A 3DEYX 3QSGA 4XD2A 3ZWVA 1EBUA 1GZ3A 4NNJA 1U7HA 4A7PA 5BNTA 3G1TA 1PR3A 4ALJA 1DDOA 2BMAA 3UCEA 1JAXA 1F12A 2FZWA 4Y6SA 1HT0A 4DC1A 5L7TA 4ZQHA 5G4LA 4ALIA 4CR7A 1GZ4A 1BW9B 2GF2A 5CAEA 1LRJA 1QR6A 1X14A 2DBQA 4RVFA 5FYDA 1V0JA 4RZHA 5U1PA 3L4BA 4RQUA 5CPBA 1MG5A 3RSHA 4BNLA 4JGBA 1UXIA 3PEFA 1V3UA 3Q2KA 3WGQA 4OOEA 2DBVO 1NFFA 2X6TA 1OFGA 3BTOA 2WMDA 4QO7A 3OECA 3COSA 2AG5A 4E13A 4GQAA 1R4NB 4A5OA 4F6LA 5ER9A 3GEMA 4YACA 4GPD1 1YQDA 1YRLA 3PGXA 5BSHA 3WGZA 3CINA 1SEVA 4IQGA 5H82A 1R6DA 3RC7A 4AJHA 5KNLA 2XAAA 2CNBA 4FFMA 4F6CA 2P9CA 5JSFA 4IJVA 3AWDA 2DFVA 3WBFA 1V3TA 3KOUA 1PJTA 1XHLA 3LF2A 2G17A 3C3XA 2G1UA 3C1AA 1NR7A 3PJFA 1OBFO 4UEOA 5JAZA 3LZ6A 5JXWA 2X9VA 3AY3A 1U2DA 4CJXA 3PXXA 1DHRA 1GFSA 3DMTC 3U62A 3UVEA 1YDEA 1I3NA 4A2CA 4ESOA 4EYEA 1ZSYA 2HK8A 3PQDA 1M75A 4KP7A 1H6BA 3H3FA 4E2WA 2CDCA 4ZD6A 1P0FA 2FPIA 4DRYA 3HN2A 4YTEA 1BDBA 3OJEA 3SJ7A 1EE9A 3C7DB 3RC1A 4EGFA 1PL6A 3CMMA 2E6UX 3RIHA 3VC7A 4PZEA 5FFFA 1MA0A 1IYZA 3H7AA 1ZUD1 1WZIA 3INGA 3ZWAA 4G5HA 1ZMTA 3NKLA 1FDSA 1YL7A 4D3DA 1KVTA 1C1XB 1N8KA 3DTYA 1T24A 2AE2A 1C0PA 1MC5A 2DU8A 4HNHA 3EK2A 2RHRA 4II3A 3TDKA 3TFQA 1ZVMA 2PGJA 5FEUA 3H5NA 3C8MA 1YB1A 3P19A 4BNFA 4W4TA 3G17A 1UZNA 3WQQA 1LUAA 3TZQA 4CPDA 4NQZA 5K6AC 4FGSA 1TVEA 2IZ0A 1XG5A 1HWYA 1XEAA 3R6DA 3GOHA 3LLVA 1MFZA 1GZ6A 1KVRA 3B1FA 1PGPA 2D3TA 4GLOA 3UHAA 1TA4A 2POQX 1DFGA 4M55A 3RC2A 1QYVA 4MINA 3FNHA 3NRCA 1QORA 4DVJA 3ROPA 1QYDA 1UAGA 5H83A 2JAHA 1FXSA 3VVBA 1A9ZA 3VVCA 4E5PA 4ZN6A 2BELA 4JCOA 3NYWA 2YQ5A 4MO2A 5DDIP 3WLFA 2ZTUA 1NPDA 2VHXA 2WJPA 2VZ0A 4DMLA 3U4CA 1YOVB 1ZK0A 2P5YA 4NFSA 3AJRA 1RYDA 1R15A 4HY3A 1KEUA 1WLYA 2J3HA 3ETEA 4IJUA 4RPGA 3PGJA 1ZEJA 4H3VA 4QUKA 5A1TA 2UVDA 4YAEA 4E4YA 1LNQA 1WAMA 1H6AA 4IMPA 4PLTA 3JQBA 1TI7A 2OO5A 4UVDA 1N92A 1KEPA 3GEGA 2RIRA 2PD3A 3V1TC 4RJTA 1IPFA 3HUDA 2Y1DA 1U28A 5BSEA 3ENNA 2IEBA 4JLWA 3HDHA 1PTJA 1UZMA 1FK8A 2YV2A 4I5EA 2CD9A 3S2FA 2AEJA 3ZNQA 4PZCA 2C82A 5TJ9A 4MIEA 1EVJA 3KTDA 3RKRA 4U5QA 1MGOA 5TC4A 4KTTE 2DPGA 1B0AA 3LT4A 5BNFA 3TZ6A 4YXFA 4BO9A 3K31A 3NUGA 5MGBA 4QSMA 1KC3A 1V8BA 2G0TA 2NSDA 3PLNA 3PVZA 1BGVA 1E92A 2H6EA 3OBBA 1ONNA 4A03A 3CH6A 4LISA 5KJCA 5L53A 1SB8A 4M1QA 4EJ0A 2GO1A 3D0OA 3KSUA 4TQGA 3Q11A 3IJRA 2XPCA 3FI9A 4JQCA 1LDGA 4DC0A 5EN4A 4M54A 3W4KA 3WXBA 5KJ1A 1YQXA 1U4OA 4PRKA 1H2HA 3FNFA 1M67A 2NADA 4UUMA 1H94A 3I9JA 3JQ9A 1EBFA 1YS4A 3AU8A 1LDNA 4GVLA 3ENKA 1B3RA 2OOSA 1WXDA 1E7MA 3PJEA 5F5NA 2VHVA 4LW8A 3V1UA 2PZJA 1TXGA 2OMEA 3R1IA 1HYGA 4FN4A 2HRZA 4ND5A 1XU7A 5JAIA 3BZUA 4HUJA 4LSWA 3JTMA 4ZRMA 1LC0A 1OMOA 1DIAA 2EKQA 3FSRA 4CMCA 3KO8A 1E0DA 3FN4A 3EZYA 3HADA 3KLPX 5JY6A 3RD5A 3L9WA 3R3JA 5DCWA 3K2BA 4UAGA 1VJTA 1ISGA 4GGOA 2GGSA 3TWOA 2W2LD 3PQFA 3JD4A 1ULSA 2Y66A 5T64A 3E5RA 1Z7BA 4WEOA 5GY7A 2GN6A 4XCVA 3WGYA 4XR4A 2EKLA 3JQAD 2NTJA 2JD1A 3OJFA 2NLOA 3I52A 3IJPA 5EQFA 3T4EA 3GPIA 3TZCA 4I9HA 1ZMOA 1P45A 2VT2A 3F5SA 4OL9A 2QZZA 5F1KA 4YAGA 5L4SA 1PX0A 3ZHBA 1GAEO 3KYBA 3ICCA 4YRBA 3FPLA 1KC1A 4AJ1A 2HO5A 2Y99A 4OXKA 3R3SA 3DZHA 4A0SA 1QSGA 4YR9A 2QIOA 1UR5A 1Y81A 4NU5A 4R3WA 3K92A 3WB9A 4YQZA 5B4UA 1NNUA 2O23A 2A94A 3FR7A 1NTOA 9LDTA 2BFAA 4XYEA 1JTVA 4CLHA 4RPLA 4CMJA 2X1HA 4X54A 5A9TA 1WP4A 3WGHA 4IDBA 4WLUA 3IP3A 3GGOA 2G76A 4LRSB 2A35A 4XGIA 4Z9YA 5JYDA 4J7XA 3VTZA 4DGSA 3PZBA 5T8KA 1PJSA 4J90A 2AEFA 5KJFA 3BIOA 3SLKA 1Z7EA 4W9NA 4NJMA 2SCUA 2WD7A 1LSUA 1U3WA 4YDRA 3DTTA 2VYND 1NX6A 2I9PA 4IDDA 1ZCJA 2HMTA 3V8BA 4CV2A 4L76A 5ICMA 4BL5A 4L8VA 3FRJA 1QYXA 1RM3A 5JMWA 1Q0QA 3FBGA 3I9OA 1ZXBA 1NVMB 3A28A 4EITA 3DBLA 4EUEA 1DOHA 1LLQA 1HETA 1P0CA 4NK5A 3INTA 4K28A 3AI2A 1ADCA 2NACA 4B4WA 2EKPA 2IXBA 2F1KA 3DWFA 4RZIA 3DO5A 3WICA 1KBZA 4F3YA 1N5DA 4FFLA 5CDYA 5JS6A 5B4VA 2P2SA 1C1DA 1ZFNA 4PRLA 1LRKA 1AGNA 3ZV3A 3QWBA 3GMDA 3I9MA 1WDKA 5BT9A 3ZCXA 2B5WA 2Y1FA 3D5TA 2HSDA 4AJIA 1N7GA 3DB2A 3ONFA 3PYXA 5F21A 1AE1A 2HMWA 2F00A 5KVSA 3PFFA 3ZGYA 1ZO8A 3PI7A 2FSVA 5DP1A 1SOVA 3EUWA 1OAAA 3VTFA 1XELA 3DC2A 3ZWMA 3O38A 3O9ZA 4HXYA 1JDJA 2HMUA 3F47A 1PJBA 2O7QA 2ZQZA 3RI3A 4TKLA 1UXGA 5ITWA 5L4LA 2GR9A 1PZFA 1OI7A 3ABIA 2Q2QA 5U9CA 1LX6A 2G82A 5JNLA 5FI3A 2Y1OA 3JYLA 1HDGO 3W8FA 1XU9A 5T67A 4PLFA 3JSAA 1E7WA 4MP3A 2A92A 2Y1EA 4ZRNA 1EK6A 4TWRA 1Y8RA 4CM9A 1QMGA 3V1YA 2C29D 3ZZNA 1JKIA 1E3IA 4D79A 1DHTA 1IHXA 4Y9DA 1ZKMA 1R0SA 3KETA 3QWAA 5JMPA 3ZWWA 2CUKA 1RM4A 1Q7BA 2GCGA 3QY9A 4B3HA 4LVUA 4MOWA 3V2HA 2EJVA 1UH5A 3F9IA 4W6ZA 3DOOA 3OP4A 2AXQA 3K6JA 4CQMB 1E7YA 5DULA 1O94A 4DIFA 1B8PA 2J3IA 4IDEA 3G3EA 3JQCA 1VSUA 3E9NA 3C24A 2ILTA 4R1SA 4NPCA 3GF4A 1GEEA 1GYPA 4ZA2A 4Q3AA 3V2GA 4U0KA 3W1VA 4UVHA 3A1NA 4NBVA 1NVTA 4ZQEA 2J6IA 1VSVA 3QVTA 3ZWOA 1B7GO 1BW9A 5G0WA 3ZW9A 3RAJA 3GPDG 3EY4A 1LQUA 1HYHA 3RBZA 2OFPA 4E2YA 1JWAB 3K96A 4NI5A 1HZJA 2NNLD 2VWPA 5DCUA 1MFPA 1K5HA 2RBEA 3DXFA 3LVFO 1LSJA 5CEJA 3BMCB 3GVCA 4LK3A 4JNKA 1X15A 3VZPA 4XIJA 4ALLA 4R5HA 3ANNA 3QJ5A 1W8DA 3F3SA 1NFQA 3VZSA 3KYDA 1R4NA 1X1TA 3BHJA 1T2DA 3G0OA 4BNVA 3GA0A 3GMSA 4U6SA 2C07A 4RF2A 2FPGA 3GZNB 2RCYA 2FPPA 3AUUA 4PFJA 2V6MA 1HDCA 4KUGA 3D3WA 2CDBA 4C7JA 1DAOA 4BS9A 4JBGA 3I6QA 5DT9A 4OOFA 3OIFA 3L07A 1VL6A 2FRDA 3I9NA 5TX7A 4DYVA 4R4JA 2Y05A 2XF8A 4NG5A 3UF0A 3ZNOA 1LDEA 1PZEA 1Z74A 4WNCA 3OQBA 4JN6B 5I7EA 1NVGA 1F8GA 1BWSA 1YDWA 4CV3A 3DHEA 2PZMA 2P4HX 2W90A 3WIDA 4RF4A 1JVBA 3VPXA 1IOLA 4OM8A 2J8ZA 1Q0LA 1VL8A 2GD1O 1EQUA 2ZB4A 1X7GA 2Q4BA 3U4IA 4RVSA 4CMAA 4CM7A 1GPDG 3V5NA 3GT0A 4NBWA 5GZ3A 4TRRA 1Z6ZA 2C7VA 4Z0TA 4ITUA 3GN2A 3HZZA 2QZ9A 5L7YA 3UCFA 4PG8A 3H9GA 4R1TA 1LLCA 2ZB8A 5AXCA 5A9SB 5TLSA 5AXAA 1EZ4A 2IODA 5A4DA 1P3DA 1VE9A 4E0BA 4HFJA 3JCZA 2WD7B 3UN1A 4RPKA 1KOLA 3PHJA 1G1AA 4BNTA 5K6AA 4ZVVA 1B26A 3BYZA 1P1KA 2ZTLA 4MP6A 4TRNA 4E33A 2BGMA 4U7WA 2H5LA 4E32A 2WE8A 3GDFA 4KUEA 2VHYA 1F0YA 1M6WA 3UOGA 3DBLB 1XWFA 1PEDA 4BKPA 3M1AA 1BSVA 2HJSA 1QLJA 5IAAA 3AUSA 4DQUA 1GV1A 3KRTA 3WGOA 3DBRA 2JCVA 1E7QA 1XDWA 5L9AA 4FFNA 2AMFA 4RF3A 5IZ4A 4GGPA 2H9IA 4BNMA 3KXDA 4G65A 4PN3A 3IKVA 4FPXA 4D43A 1E1LA 4MVJD 3NEPX 4XYBA 3WYCA 5IN4A 1T1SA 4K1LA 4BNUA 2E48A 1NQAO 1KY4A 2Y0EA 2WSBA 5CG1A 1I5RA 1Z82A 3DQPA 2FOIA 2X0RA 3ZWYA 3QLJA 1YO6A 4FC7A 4ZQBA 4BO5A 2PZKA 4PVCA 3I6IA 4YA6A 3RUIA 4EW6A 2NU7A 4YT8A 4BNJA 3F46A 4WECA 2O2YA 4NFHA 3AFMA 3FTNA 1ZSNA 4HFNA 3F4LA 3MZ0A 4YPOA 2DPHA 1ENPA 5B1YA 3ON5A 2VCYA 1ADFA 3IUSA 5EQDA 1B14A 3D4PA 3FF4A 5I9MA 3WTCA 1A4UA 3OIDA 4PGFA 1O9BA 3VH1A 1ZXLA 3MCVA 3WJAA 3GUCA 1ZK2A 2DVMA 3QWIA 2PWZA 1HYEA 1Y8RB 2VUTA 5ENVA 1ID1A 3P7MA 3W6ZA 2JL1A 4FJ2A 3K5PA 4XYLA 2AQ8A 1R66A 2YJZA 4CMHA 4WLVA 3TOZA 1Z73A 1LRLA 1I8TA 3L9XA 5CFZA 2Y0DA 5JPIA 5ILOA 2BF7A 3RUAA 3WS7A 2X0JA 4Z3KA 1NR1A 2I66A 4XB2A 2J3JA 2UYYA 1DB3A 4E5NA 2DUUA 1HL3A 1GTMA 1LDBA 1X0XA 1T2CA 2YHIB 3HFSA 3O8QA 4E21A 8LDHA 1D1TA 1I33A 4DYDA 3ZDFA 4PVDA 4R01A 3IS3A 1WW8A 4WOKA 1I10A 2OBYA 4OSOA 3PTZA 1HLPA 4I5GA 3WMXA 5C7OO 2A9FA 2ZJ1A 2GLXA 1UXJA 4JP3A 4S1VA 4Q3NA 1S7CA 2I67A 1BMDA 5G0SA 3H9QA 1NPTO 4HX5A 4RGBA 4BKRA 1UP4A 2VYVA 2NQTA 4RLHA 2Q2VA 1QLHA 5COBA 2O3RA 4A27A 2JFHA 5I7SA 1K6IA 2B4TO 5BSGA 1WPQA 4FJ0A 1IPEA 5U4QA 1W4ZA 5L7WA 4NZ9A 1U8XX 3ZU5A 3KYDB 1PJLA 4CUKA 4E30A 5K9ZA 1NWCA 1OC2A 2TMDA 1PQUA 3AI3A 3H5RA 3LC1O 5FF9A 5KVCA 2CSUA 2RH8A 4JBIA 3FHLA 4R9SA 3BTUA 4XYGA 2JKVA 5EJ2A 3GAFA 4CL8A 5TT0A 3VKVA 4DTIA 3DR3A 1VC2A 3D3WB 4I5FA 5DN9A 2H1SA 1ISMA 4IS3A 3TQHA 4BKQA 4XX0A 4CR8A 4OSPA 4XRGA 4EEZA 3GQVA 4J1QA 4KQWA 3GGPA 5JC8A 1CERA 2VNAA 2V65A 4RPJA 3LC2O 3AOEA 1CDOA 1SZJG 2X8LA 4OKIA 2PKQP 3V2UA 4PLYA 1SBYA 1ONOA 1E1KA 2B37A 2VHZA 3JD1A 3Q0EA 4J9UE 4JJIA 4N5LA 3ZHZA 4BMNA 3TRIA 3WNVA 4QQRA 4EI2A 2Q46A 1EMDA 1CIVA 4KQXA 4BNWA 4FS3A 4LRTB 1E1MA 2UUPA 4URFA 4R68A 5A9RA 1YBVA 1QG6A 3NTQA 4XA8A 3OICA 3TOXA 2BD0A 3E03A 1E6UA 4DLAA 2Q4EA 5A06A 2CF5A 4M8SA 1JA9A 3OSUA 2Q49A 2CZCA 4XKJA 1EUDA 2QHXA 3IOYA 5IXYA 2QW8A 4XGKA 5B4TA 3HWRA 3KYCA 1P33A 2NWQA 1GD1O 3MOGA 5KCZA 3RUFA 1T1RA 5EMHA 4UREA 3ANMA 3WLEA 4BO0A 4BO8A 2BH9A 3ETDA 3K73O 4RDHA 4YAIA 2JCXA 3GZ4A 3RASA 5JO0A 4NJOA 3BAZA 4IJWA 5JDCA 3AU9A 5LC1A 3E48A 4QEDA 1EQ2A 3LC7O 2ZYAA 4J1TA 1PJ4A 3N58A 4XQCA 2W98A 3D4NA 3HB4X 1Y6JA 4TZTA 2HUNA 4YB8A 3HDQA 4JROA 1IULA 4JXKA 4FIZA 4FB5A 1ZK1A 3DBRB 5IZCC 3SVTA 2Z1MA 4WLOA 3NJ4A 3GY0A 1DFIA 2RH4A 1FMCA 4U0JA 3ZWXA 1Z45A 2E4AA 3ZV6A 1VLLA 1ZJZA 3WFIA 3VAZA 1X7HA 4WCFC 1UDAA 2O48X 5ITVA 3DHYA 2EF1A 3P5SA 4Q39A 5AXDA 1AUPA 2LDXA 3ZV4A 3TFOA 2PK3A 5T57A 2W2KA 2DT5A 1Y8QA 2DFDA 1V35A 2ZATA 3WJ7A 1M66A 1MXHA 1ARZA 5COQA 5A03A 4WLEA 3OA0A 4J7CA 4D45A 3SXPA 5DBIA 4KZPA 3FNGA 3I23A 1SB9A 2PH3A 4MKRA 4Q3CA 5BSFA 1MV8A 4RCVA 5JE8A 1A5ZA 1WMBA 1BVRA 2Z95A 2GZ2A 4J6FA 2NU8A 2O3JA 3ASVA 2WYUA 5B12A 4ND3A 1CJCA 3M1LA 4UVGA 4BNIA 1NAIA 3U9LA 3K8ZA 5L45A 4RVGA 3D3EA 4CLEA 4YRAA 1X0VA 4WGGA 2JAPA 3OEYA 3H5AA 3SJUA 1O5IA 1E7RA 3HE3A 4NFYA 4Q3DA 4W99A 4RVHA 2HKIA 1GQ2A 3GN1A 1P44A 4HBGA 4XZ3A 2I3GA 1LC3A 3O8QB 4J1SA 3LT0A 4L4SA 2P68A 3LU1A 3ITKA 4GSKA 3U49A 3JQGA 1DIRA 4BNHA 3MJCA 3PPIA 2Y1CA 1E3WA 1V6AA 3ULKA 2NVUA 4MKXA 3RROA 3I4CA 4O5OA 2FHSA 4CM3A 2VRCA 4GWGA 4XDZA 3ZHXA 5C37A 1I3LA 4DXHA 4BKOA 4FJ1A 4FW8A 3RUDA 3W8DA 1AXEA 2ZJ0A 4IS2A 4WNIA 1GUYA 1ZH8A 5JAMA 5JAQA 4CQMA 5CDGA 1HSOA 4JP2A 4YWJA 1RWBA 5KTKA 4IDAA 4NBUA 1I0ZA 3ANLA 4FFOA 4KWHA 4CR6A 2TMGA 3Q6IA 1YB5A 4J1NA 2VT3A 1XA0A 1IUKA 1KIFA 1GV0A 5HA5A 3VPGA 2Q1SA 3NX4A 2DQ4A 1PWXA 1D4FA 5AVOA 2VUSA 5IG2A 4FQ8A 4Q3EA 2HLPA 4DPMA 4EUHA 1W6UA 4A73A 1LBEA 2FP4A 3E1KA 3H2SA 5G0TA 4GKVA 4BGUA 4W7HA 2VWQA 3E5MA 3VPSA 5JCXA 3BMCA 2X22A 1J49A 3JV7A 4FFPA 3KEQA 1J6UA 2EJWA 2BFPA 1F14A 4L4XA 3TZHA 4XIYA 4AJEA 4PCVA 1EDZA 1TB4A 2X9NA 4YBZA 1SAYA 2CDAA 3RFXA 1U5AA 3GRKA 4CM5A 1GL3A 2OZPA 1UDCA 3GZNA 3DZJA 4RDIA 1KERA 4B7UA 4TKMA 4UUNA 4XQGA 3OJOA 3GUYA 5HS6A 3FCOA 5KVQA 2UDPA 5JDIC 5THQA 5TQVA 5AXBA 5TS3A 1H5QA 1E3SA 4CQLA 1C0IA 2Y67A 2ZQYA 4EDFA 3EW7A 4MVJI 4BUCA 5L95A 1EUZA 1QV7A 2IZ1A 3F1KA 1NQTA 5HBRA 4AFNA 1N2SA 3FWZA 3H8VA 2PV7A 1K3TA 2J5QA 3E18A 5ENDA 3TPCA 2X5OA 3KYCB 3CMCO 4KOAA 8ADHA 3HN7A 1E6EA 3D7LA 1AHIA 4NIMA 4ZJUA 3IIEA 3NDJA 4CMBA 5IDWA 1DJNA 2DTXA 4ALNA 3AUAA 3ZV5A 3WGIA 3WFJA 3FPCA 3P2OA 3DZFA 3GVXA 3U4DA 3VKUA 4NBTA 4B8ZA 4PLGA 3ZWNA 2RAFA 4J2HA 2B4RO 2DAPA 3DZBA 1Y7TA 1MB4A 1A27A 2QQ5A 4RLSA 3GHYA 2FZEA 2B36A 2VNSA 5A9SA 3IKTA 4CM4B 2VWHA 1YB4A 3JQFA 4BNZA 3GVIA 2BHLA 3DOJA 2WTBA 3SC4A 5C7IO 3FBTA 4TZKA 4M86A 4YJFA 3W4IA 4QT0A 2FMUA 3T7CA 3ST7A 5JO9A 3H4VA 2C0CA 3OH8A 2R00C 2DTEA 1CQJA 1L7DA 4J3FA 5COAA 3OIGA 5G2OA 2EV9A 4MVJM 1QV6A 2W2KB 3QE3A 1Y8QB 2EEZA 1IHYA 1PQWA 2DBZA 1VJ0A 2YV1A 1O6ZA 5CG2A 1XQ6A 5JCJA 2B83A 2OP0A 5I7FA 2E49A 4XR9A 1GCUA 4CLOA 1KS9A 1ZK4A 3DAFA 4RORA 4D3FA 4BGVA 2PTGA 2YZ7A 2OGUA 1E3JA 2VRBA 1ZZEA 1PZGA 2H63A 1QYCA 3WYBA 3B1JA 3D5QA 1U1IA 3KLMX 2DLDA 2OORA 4W82A 5DZSA 3EHEA 3M2PA 5KOIA 4LCEA 2EERA 3MJEA 1CQIA 2GASA 2IRWA 4J0FA 4XJTA 5KKCA 4PLWA 1ORRA 1ZSVA 3H9UA 4YJGA 1YL6A 3PYMA 4FFRA 4YCAA 4LCJA 1YGYA 5CP8A 1C0KA 4XQEA 1LDMA 4OAQA 4A10A 4BNNA 2P4QA 4E6PA 3VH4A 5L40A 5TIIA 1HE4A 1NP3A 2C20A 3ZWBA 3HSKA 3DZIA 5HWSA 2I6TA 2AEMA 3MJTA 3VZRA 4DIOA 1DC4A 2BGKA 3JQGB 2J3KA 4LMPA 4CODB 2VN8A 1E3WB 1HZZA 2IZZA 3IMFA 3AW9A 4CV1A 2NVUB 2AQIA 4GSLA 2Z5LA 3BMOA 3GDGA 2P5UA 1DAPA 4QXMA 4L9RA 4RF5A 2BFOA 2GZ1A 4MVJE 1U5CA 1NASA 2EIHA 1QKIA 4PIVA 2YHIA 3EC7A 1P9LA 3QVXA 2HMSA 3E9MA 4PG5A 5CPFA 1CRWG 4GL4A 1TT7A 4RVDA 1YQGA 3JD0A 4ND2A 1A7AA 2XXJA 3JQ8B 1PGOA 3B70A 1T4BA 2VOJA 3QV1A 3WIEA 4MDHA 1MLDA 3RFTA 4PG7A 4BO3A 1T25A 1G0OA 2D4AA 4UUOA 3RU7A 4DQXA 3AY7A 4MVJP 3MWEB 1K6JA 2VTDA 2AE1A 4GX5A 2PGDA 3WTBA 3PHHA 3UXYA 1A9YA 1NQ5A 2BGLA 2UAGA 1S6YA 2CFCA 3MJVA 1UXKA 5F1OA 2EWMA 1U3TA 3GNTA 1RPNA 1ZBQA 1ENYA 1DC6A 4AJ2A 4P8RA 3ZI0A 3EVNA 1RYEA 2J5RA 2BLLA 1VM6A 2VUUA 3B1KA 1HKUA 4QTZA 4XDYA 2Q45A 1DEHA 4ZICA 2QYSA 4OKNA 3OHSX 4CLXA 1C14A 3NDIA 1KEWA 4BOYA 1DSSG 3PWZA 2DUWA 1VI2A 1XSEA 2GSDA 3DMTA 4I8XA 1HXHA 3I1JA 1E5LA 5TJHA 4ZGWA 1MP0A 1HEUA 5C5IA 2CMDA 4CQLB 4EJMA 3INRA 4D0SA 1DIHA 2CF6A 2NVBA 3BTSA 3F6YA 4OXNA 4FSHA 3LLSA 1I01A 4OH1A 1EK5A 1GPJA 3IQDB 2JCYA 1EUCA 4MP8A 5TF4A 1UZLA 1D1SA 2V6FA 1P1FA 1WDLA 3UGKA 2QRLA 1ISJA 1VKNA 3Q9NA 1B15A 2R2GA 4GX0A 1O95A 2PFGA 3WOHA 1EFLA 1HLDA 3GDOA 3GHHA 4LN1A 3WDSA 3LT1A 1HE3A 3DHNA 4XRRA 4XWYA 2X0IA 4HFRA 2O7SA 3OM9A 5I8WA 1P31A 3HNPA 1OC4A 1PL8A 4BV9A 1GQQA 1D7OA 4Z6KA 2BKAA 2ZYDA 4ND4A 3U09A 1Q7GA 1U3VA 4NH4A 3T7EA 4DWVA 3QIVA 4R69A 4Y6RA 2HMVA 2I3AA 4R1UA 1W0CA 3ITDA 2CY0A 3DZKA 1CYDA 4IUYA 4RL6A 2ZIZA 1JN0A 1CWUA 3KV3O 2EGHA 2Q99A 4RV9A 3NGLA 4YJFB 4D41A 4BNGA 2ZTMA 1I2ZA 2EP7A 1LXCA 5DBFA 2B35A 3UKOA 2YYYA 1ISHA 1DC5A 1H0KA 3I9LA 2HAEA 1PGQA 3UW3A 1K89A 1UP7A 1P1RA 3PIDA 4DA9A 5IZCA 4UVIA 4IJKA 4OJNA 2DKNA 3DAPA 5IJZA 5IF3A 1G0NA 1VL0A 1PJ2A 3CKYA 1UJMA 4PLHA 4E5KA 4PG4A 2YFQA 1WDMA 4WCFA 2PLAA 4YJDA 4P38A 1LSSA 1PS0A 2UV8A 3RJ9A 4CLOB 3E82A 5T8KC 2NU9A 4J4BA 1XKQA 1FDUA 5A3JA 1WVGA 1A7KA 1K6XA 2QRKA 1B16A 5CDTA 3Q3CA 2QRJA 1G6KA 1DPGA 4CM9D 5B37A 4BV8A 5THKA 1BTOA 4AJ4A 3JQ7A 4RVUA 4Z9FA 1DIBA 2XOXA 1JKJA 3ONEA 4AJPA 5BNIA 1K2WA 3DOCA 1IZ9A 1NHWA 2FR8A 4ALKA 4I08A 4TRMA 1ADBA 2YY7A 3GG2A 2Q3EA 4H7PA 4XEHA 4GWKA 2FY8A 1ADGA 4JJGA 3I4FA 4YJGB 2OL4A 1A72A 1BDMA 2ZCVA 2WDZA 4AVYA 1XYGA 4EZBA 1Y9AA 3DFUA 3PFWO 6ADHA 3T4XA 2WWRA 2B0JA 2QG4A 3G1UA 1EVYA 1AXGA 4INAA 2E82A 1T2FA 4OIMA 1GQYA 1YBMA 3PWKA 4WPGA 4BHTA 2NTNA 3E6AA 2D5AA 2I99A 2PR2A 3NT2A 1BHSA 1E3LA 2C5EA 4K6CA 4NHEA 1XIVA 1YJ8A 2BI7A 2OHXA 3BMOB 3DBHA 5LDGA 3S8MA 4NU6A 4NDNE 1E77A 4P22A 5CHEA 4YT2A 2X4GA 2BRUA 3U5TA 2IYPA 4N7RA 3CE6A 3PDUA 2ZYGA 4BNXA 1YKFA 1YVEI 4J7UA 3S55A 4JX8A 2JHFA 5G4KA 4OO3A 2C54A 3OJ0A 3QW2A 1C0LA 5F5LA 2PKQO 1I3MA 3IP1A 4PG6A 5EESA 1NXQA 4GLLA 1U8FO 1LA2A 3HDYA 2EP5A 1PR9A 3WGTA 1MC4A 2D5CA 1GDHA 2D2IA 2GN9A 1F17A 3Q9UA 2O3QA 4YEDA 5TNXA 3QVWA 3I9KA 2ZCUA 1B2LA 1MG0A 1YXMA 2GDZA 1DRVA 2O50A 3VPFA 4HNGA 4IDGA 4NK4A 4Q3BA 1GUFA 1LJ8A 3AUTA 3GFBA 1U4SA 3RQSA 3JYPA 4BO4A 4NBRA 3NDRA 4DPKA 3VDRA 4IXTA 1PJQA 4Z0PA 1KY5A 4BB6A 3JYNA 2HQ1A 4ONEA 4D3SA 4FGWA 5JC1A 3GGGA 4YT5A 3A4VA 4BQRA 2IDZA 1Y5RA 2VZ8A 1FJHA 4KUHA 4B4UA 4TVBA 4BO7A 1KYQA 4BGIA 5ADHA 1U3UA 4CMIA 2D1YA 2AW5A 2Y93A 5GMOA 4TRJA 4YQYA 3VZQA 3PJGA 4I5DA 1WMAA 1HRDA 1PWZA 3CSDA 3IC5A 5EINA 3CTMA 1SO8A 3MJ4A 3WBBA 3AI1A 3ADPA 1JLLA 4AG3A 1PU2A 4R1NA 4TVOA 2EXXA 1R16A 5JDIA 2A4KA 2PA3A 4RQTA 4QO8A 3ZW8A 1U9JA 2WEKA 2EW8A 2FSSA 4GBJA 1E6WA 3SEFA 2Q1UA 3IAHA 3N7UA 5L4NA 5ER6A 1IE3A 5AOVA 3VH3A 3ZN2A 3HFGA 1TEHA 2GRAA 3TN7A 4IMRA 3PDJA 3ZHYA 3WG9A 2Y0CA 1GU7A 1UAYA 4DMMA 1RM0A 1SEPA 1JQBA 4J9VA 2WYVA 1XCBA 4KDFA 3IL2A 4D7AA 5BR7A 3W6UA 2PD6A 4II2A 4CMEC 3VOSA 3PRJA 5J23A 4LVCA 1A4IA 5T5QA 4IDFA 2X7HA 4IY1A 3PJDA 4J43A 2FR1A 3GK3A 4TMFA 4OHUA 1XLTA 3BXXA 2DC1A 1FDTA 4AJNA 3EZLA 2GERA 1VKOA 3L6OO 4WCDA 3PHLA 4UVEA 1J5PA 5HTOA 2JHGA 4E3ZA 1IL0A 1N9GA 4I9NA 1GY8A 4NMHA 1ZJYA 3NV9A 3W8EA 4YVFA 2X23A 3QA9A 3UUWA 5EERA 2P9GA 4JJFA 4J91A 3QWHA 4FOOA 5KJ6A 3BMNA 4KMSA 4CM4A 1Y1PA 4K6FA 4U8GA 1ZEMA 3L6EA 5AYVA 2W2LA 2R00A 1RM5A 3ICPA 1NQOA 3KUXA 2X5KO 1ZIDA 3L6DA 5ICSA 4WCFB 3TJRA 2AQKA 5A3VA 2VQ3A 2GYYA 2NU6A 1DLJA 4KDEA 3SBOA 3MTJA 3JQAA 2I65A 5TGDA 3Q1LA 5JW6A 4CUJA 3G49A 1RJWA 4IM7A 4ROSA 1M76A 3PP8A 1BXGA 1HF3A 3QRWA 2C2XA 2GNAA 2AG8A 5HRUA 1TT5B 2DM6A 4OYRA 4RO0A 3F1LA 3JQ7B 1LLUA 4MKZA 4OQYA 5GZ6A 4DLLA 4ILKA 4F46A 2ZKLA 3H6KA 4N18A 5LCXA 5GZ1A 3PHIA 1QYWA 3GC6A 1GEGA 1JU9A 3F5QA 4DL9A 1I2CA 1T26A 2NV6A 4FBGA 4HWKA 1K0UA 4Z0HO 3X2FA 1I24A 1FF9A 3RBVA 1B8VA 2YHUA 5A5FA 2PD4A 3A9WA 1EE2A 3L77A 1DRUA 5KJEA 2PNFA 3WWZA 3EVTA 4J16A 4IXWA 3ZWCA 3GAZA 3H9JA 1H6CA 1HDXA 3EYWA 3CUKA 3RFVA 4AJJA 4YYZA 2CVZA 3H3JA 4AJLA 5JFOA 5A05A 3KB6A 3ORFA 2Y68A 2VYVD 4UUPA 2X86A 3OF2A 4CM6A 2O3UA 3WSVA 4R9RA 5F3RA 2W8ZA 3TF5A 4L74A 3DBHB 5H81A 2C7GA 1IB6A 3WQRA 4CV0A 2PKRA 4YRDA 3FWNA 4IZHA 3IDSA 5DCYA 3B20A 2VYNA 3I3OA 3SC6A 5G4KB 5C7LO 1HDYA 3X2EA 1BVUA 1EDOA 4BMSA 3KSZO 4E2XA 1I3KA 1I32A 4G81A 2IE0A 1PJCA 1PS9A 1DLIA 4R51A 1VRWA 1MXFA 2VZ9A 4GMFA 3LYLA 1F8FA 4KWIA 3KSDO 3PLRA 4IINA 3MJSA 1R4MA 1EEHA 2GN8A 4D46A 1FDVA 3AK4A 1B3BA 1HDZA 2GUGA 2BFMA 5A02A 3VPHA 2EG9A 3ONDA 1LU9A 3RU9A 3I83A 4C7KA 3RC9A 3KEOA 1NYTA 4Y8VA 1BXKA 1B8UA 3JQ8A 1LDYA 4Z9XA 3KHUA 4S3MA 5EIOA 4MVJG 1PL7A 3LT2A 2PH5A 3C1TA 4GMGA 1ISFA 3ROKA 4B79A 4BQPA 3WR5A 4LMRA 4CMIB 3E9QA 1QXSA 2WYWA 4O63O 4IGEA 3WMWA 5A5EA 3PQEA 1ZK3A 4GAEA 1YL5A 5FWNA 5I9NA 4OQZA 1KEVA 2NTVA 4GH5A 1Z75A 3UAGA 1P1JA 3JQDA 3JQEA 4GX1A 1UDBA 3NT4A 1DXYA 3G79A 4HFMA 1L1FA 1M6HA 3BTVA 4KTVE 3L4BC 5KIAA 4YAKA 2G5CA 1F06A 4ZQGA 1PJ3A 2VWGA 1NM5A 3QP9A 1IZ0A 1JVSA 3WYEA 3GEDA 5IDXA 1I30A 4CMKA 1NBOA 2V7PA 3TSCA 4UULA 2HK9A 2YDXA 3DL2A 4N54A 1A71A 3UCXA 1AHHA 3OQ1A 2LDBA 3RKUA 4Z3DA 3D1LA 2ZK7A 5JY1A 5TT1A 2OUIA 2YUTA 4RPHA 4UEJA 4L0QA 4GI2A 1EVZA 3L4SO 4WLFA 1PS8A 3GNQA 4F45A 2FR0A 2I5PO 2FN7A 1VPDA 3HJAA 3VHRA 1DBVO 4WJZA 1KVQA 2QX7A 2EW2A 4N5MA 4AL4A 4J4TA 3GG9A 1BRMA 1TLTA 3NGXA 4P4LA 4TSKA 3ZWPA 3AOEC 3MEQA 3QWFA 4XQ9A 4BKUA 3WSWA 5HM8A 2O4CA 4BO6A 1BXZA 3DAGA 4ND1A 3RUHA 4AICA 2WE7A 4XJSA 2IYOA 5DNAA 3AFNA 2AA3A 4BGEA 1GUZA 1X1EA 1N9GB 4EEXA 2OXIA 3BHMA 4DPLA 4B7XA 1J0XO 1O0SA 2B4QA 4IQ8A 3RCBA 3U3XA 1P77A 2O2SA 2HJRA 4OGWA 3BMNB 4IIVA 3K2EA 2JFGA 2JD2A 5IDYA 5CDUA 4BO2A 2PY6A 1JKFA 4Q9NA 5BQFA 1GR0A 3NJ8A 3GVHA 3JQAB 3BMQA 3K30A 1D3AA 3O03A 5K0ZA 4K9DA 1R12A 4J2OA 2JJYA 4WEQA 2E37A 4P4GA 5IFLA 4J49A 1NPYA 1BXGB 2D59A 3LQFA 2HK7A 4AJKA 3O4RA 4QFDA 2ZTVA 3O26A 1ENZA 1OOEA 2X0NA 7MDHA 3ETGA 4WLNA 3C7AA 4AJOA 1XQ1A 5JDCC 5AQ1A 4IQ0A 4DREA 5C3MA 4H16A 3RUCA 3R0IA 4BIIA 2X5JO 1LI4A 1ENOA 3OA2A 3CEAA 3OMLA 3ROQA 2WD8A 2BI8A 1NWHA 3K9QO 1KVSA 4BMVA 3E8XA 1R0KA 3MWDB 3GNSA 1ML3A 3W4JA 4ZHSA 1CF2O 2AHRA 3DZGA 3CIFA 3LDHA 1DRWA 1E1NA 3PK0A 2NVWA 4C4OA 1D8AA 1GADO 4D44A 2C59A 5EL0A 2YW9A 2VRCD 5FI5A 1U2GA 4QX6A 3C7CB 2EGGA 3EDMA 1T2EA 4IGFA 4E5YA 1P74A 4IIUA 4DBZA 1QRRA 3JYQA 3NT5A 4ID9A 4CQMD 3WX0A 1ISIA 1O89A 3GFGA 3LSYA 3DONA 4QFCA 3TL3A 1NAHA 5KKAA 1DIGA 3VH2A 3OETA 1U7TA 4MVJF 1NFRA 4CM8A 2OP1A 4J4HA 1DJQA 4DIBA 3OQ6A 2V6GA 4CUZA 3B6ZA 2CVOA 4PLZA 4BNYA 5KVVA 4YT4A 4FC6A 1SMKA 2B5VA 3QHAA 4U6QA 4PLCA 4HP8A 4B7CA 3JQBC 1SPXA 4NR0A 1P1HA 2FWMX 2YV3A 4LGVA 5KWEA 3PYLA 4B8WA 2D0IA 3WNQA 4R3NA 2V6BA 2IXAA 3VDQA 4E5MA 4M49A 3BA1A 2DBRA 3GRPA 1FDWA 1R4MB 4B3JA 4E31A 3AM5A 3TNLA 2NM0A 3STHA 9LDBA 3CPSA 1ZNQO 3NTOA 5IN5A 1DO8A 2HCTA 1T2AA 3JD3A 2YDYA 3Q2IA 4ZU3A 3JQ6A 4B3IA 1L7EA 4MVJA 3UICA 4WKGA 7ADHA 2C5AA 4CLRA 4TROA 5DBGA 2YQ4A 1H2BA 4YJHA 1BG6A 1GYQA 2P91A 3OJLA 3TL2A 4B4VA 5A04A 4FR5A 2RHCA 4PLVA 3RBXA 3H9EO 3U4HA 1PSDA 1WWKA 3D64A 4UEKA 4MIOA 1JWBB 4H15A 1Q7CA 3C1OA 1LQTA 3GLQA 4OMUA 3S2IA 4LSMA 1ONPA 4DBVO 5MDHA 1SOWA 4MJLA 2QYTA 3S1LA 3RJ5A 1C3VA 1P1IA 1GCOA 3AOGA 3BHIA 3DMYA 5G0VA 4D0RA 1T4DA 3AM3A 3ZH2A 2ET6A 1N1EA 4R16A 1CEQA 1EVIA 2GPTA 3MOIA 1IY8A 3MTGA 4GX2A 4O6VA 5L3ZA 4W7IA 3U0BA 1WNTA 1SCUA 3JQ9C 4DUPA 1HDOA 1I36A 4JBHA 4EBFA 4IZIA 3FD8A 4Y98A 1YJQA 5EPOA 3LK7A 4WE3A 1VJ1A 4R54A 2PGLA 2X58A 5CEFA 2AQHA 2Q50A 2O3TA 4P4NA 3GH3A 2DTDA 3WQSB 1QP8A 1X13A 3A06A 2HDHA 5I7VA 4R5MA 1LSOA 5G0UA 1W73A 2JD0A 2B69A 3HDJA 1PGNA 3NTRA 1H9BA 4R41A 1M2WA 4L73A 1Q2XA 1E5QA 6LDHA 3QVSA 4ZQFA 4BNKA 5JLAA 4BVAA 4GVXA 3EAGA 3M2TA 1Q1NA 1R37A 3CXRA 3CZMA 1HDRA 1LTHR 3SX2A 3ADOA 4M89A 4IBOA 2VOEA 2OBNA 3ZU2A 4CMEA 1CETA 4EUFA 1E3EA 1PGJA 1ZW1A 4FCCA 4JIGA 4JK3A 3FR8A 4BB5A 4BO1A 1HSZA 2I76A 4M87A 4XGNA 3RUEA 1RKXA 2YFHA 5L51A 3PWSA 4IPTA 5JCJD 1Q0HA 3GVPA 3ZNNA 2C2YA 5ES3A 3KZVA 1I2BA 4E2ZA 3M6IA 2EHDA 5JBIA 3IUPA 5I9LA 5CDSA 4YAJA 3NAQA 4GKBA 1XGKA 4CL3A 3QVOA 3KBOA 3DFZA 1ULUA 3BMQB 3FTPA 1HE5A 2Y1GA 3ZU3A 1EFKA 2W4QA 5TRTA 3DBVO 3F4BA 3JD2A 3RWBA 1JAYA 3CZRA 3WGGA 4O59O 3TZKA 3S2EA 1MX3A 1DC3A 3HHPA 1UUFA 3OFSA 1J4AA 1LLDA 1C1XA 1H6DA 2VHWA 5DOVA 1PZHA 3OEWA 5JYEA 4NJMB 2J5KA 1H93A 4L4RA 5IDQA 1SNYA 3HQ4O 4XB1A 5DF1A 5HS4A 3WWYA 2O3SA 1GYRA 4MPDA 2HU2A 3ASUA 3JQFC 2ZB7A 4FDAA 4W9NC 3P2YA 3PHGA 1YE3A 3RVDA 1TT5A 2UUOA 1YONA 2X9GA 3PIIA
chains in the Genus database with same CATH superfamily
3DDUA 3UJDA 4I1IA 4IILA 5TF0A 2EFCB 1W1IA 2XD9A 3AR4A 4FXPA 5D3KA 4MPRA 1OFHA 1J2YA 1I0LA 4QGAA 1AGXA 1T0PA 2IPNA 1CZOA 1N7HA 3H2IA 4LZZA 5AOBA 4P7KA 2PGNA 2Q27A 4G2NA 4H1HA 3UAYA 4FSDA 3H2JA 3UKJA 4JELA 3AINA 2V7GA 3DUFB 3LM8A 3DOUA 4POAA 4XWOA 5ICCA 4C6RA 4CF6A 2VNIA 4S04A 1X92A 4ASUD 1AQIA 3DAOA 3OEHD 4L3VA 4QHYA 2QX9A 4RACA 1B0UA 4YRRA 5CDHA 4ZALA 5LDDC 2F62A 1M54A 1WZEA 4ND6A 4QA9A 5HIIA 4TVKA 1VHTA 1YI0A 2PZLA 3GEBA 4OMFG 3GP3A 1A8PA 3OU2A 1R10A 2ZYVX 4OFBA 3HJUA 1Y1QA 2QPLA 1JFFA 1QOPB 5EIBC 5TPWB 3BFXA 2C97A 4M0CA 1VLVA 2IK8A 4WK6A 4ZTUB 4PZDA 4B09A 5AMXA 4BQQA 1UWKA 4HLCA 1H65A 4ALMA 3EXAA 5T41A 1OWLA 3PEVA 4Q34A 2FNAA 2CL5A 4ZAFA 5JAHA 1KO1A 1ZH6A 1YJAA 4ZAWA 1G7TA 3IQZA 2Y3IA 3PD0A 3NEJA 2I6GA 2ZBVA 2WD9A 3SHOA 2EATA 3P2JA 3HB5X 2BC9A 3O73A 1FS5A 1YQTA 2OHGA 4K26A 2XZOA 5FOQA 3UFXA 5CEEA 3G02A 3CJTA 1T13A 3VNQA 2G7ZA 3Q10A 2GZ3A 5DOZA 2YXNA 5CCBA 1B0ZA 3FOWA 3MLEA 1SD5A 2P40A 2X13A 3VYSB 3VSEA 5FT9A 2GPAA 3RTGA 2Q2WA 2C9YA 1CUGA 4UU7A 3JYOA 1RFGE 3C2QA 5KTPA 4PHGA 4YJHB 3VHLB 2COUA 5KNBH 3THYB 1N0UA 4CMGA 1P9OA 1H4SA 1WIWA 3FMPB 4X85A 4QUGA 1RZUA 2JFXA 3G8AA 1B93A 3KR0A 1CUFA 5ALMA 1GNSA 3LY9A 2GM3A 3OQNA 1TCAA 3AY6A 1HTBA 3E05A 4O0LA 3A27A 1Y33E 1DAHA 3OOWA 4JKIA 4PQFA 4M8LA 5JJBA 3ETCA 3QVMA 3MTQA 2UZ0A 4Y6PA 2IIPA 3KM0A 1TJPB 1OV6A 4IF6A 3QSGA 3PNQA 5K09A 5A4AA 2PAFA 4A7PA 1K8RA 3P32A 2Z9DA 3C4QA 4P7GA 3T5AA 1ZRHA 1H0SA 1KO7A 3NP7A 1Z2OX 3KJHA 4ALJA 1RQXA 5HEKA 1UT8A 1MJ5A 4LFAB 1O94C 2CXTA 4RHYA 1P81A 4XD7A 3IX7A 2NG1A 2OB1A 1CJSA 4ZQHA 3W5UA 5K8LA 2DQYA 1BW9B 3B85A 2GF2A 1J99A 3DMPA 4KRXA 1JV2B 1QQ7A 2DBQA 4RFVA 3LWBA 1N9KA 1SQGA 1V0JA 3TLMA 3L4BA 3O2NA 1GPKA 1UM8A 4FE7A 5H59A 1BWPA 1NKSA 3HWWA 2QG6A 3PC6A 2I2AA 1V3UA 3PEFA 3Q2KA 3QOXA 4X93A 2OC4A 3LX5A 1F4PA 4JLPA 2W48A 4C06A 4DLYA 3RK0A 5CEJA 1KK2A 1C7ZA 2X6TA 3OHMA 4M7OA 2ORYA 4M83A 1OGJA 3NATA 4XLTA 3VDXA 3U19A 1F2UA 4A5OA 2GKOA 4O8ZA 1TW3A 3HO8A 4YACA 1WY5A 1NXPA 3DWEX 2F3SA 2OKGA 5BSHA 2YOHA 1CW2B 4YRIA 4IQGA 5BOVA 2GAJA 3B5IA 4GR9A 5H82A 3RC7A 2ECKA 4AJHA 5A6VA 3ZX4A 1M1YA 2XAAA 4FFMA 1G8GA 4DV6B 3ZZ1A 1GNVA 2PUCA 3EVEA 4HC4A 4FR2A 2P30A 2DFVA 5LZ2A 3RJTA 1DWQA 2VQ6A 3TLXA 4C4SA 1O87A 3AEKA 3KCQA 3KOUA 3HDVA 4MPPA 1PJTA 3A70A 3CO0S 2CLFB 1UOOA 4OP2A 1UPUA 4RK4A 1T5BA 2LTAA 3DKPA 1JE1A 1NR7A 3PJFA 1OFTA 3S29A 2RE8A 4UEOA 3K8YA 4IDPA 1G5HA 1ZRNA 3U7IA 3SD7A 1U2DA 3REOA 5BP7A 3DOIA 3DMTC 1GFSA 2JC3A 3AUJB 3GEIA 4YIHA 5BVGB 1EJBA 2JFQA 4I1UA 2PJZA 3H9BA 2ON6A 1PDWA 4FEYA 3R9IA 4RL4A 3PQDA 2L0XA 1ZUIA 1T8SA 1G1MA 1FNCA 3LC0A 5FLKA 5E1DA 2CDCA 2FMHA 4ZD6A 3AERA 2WIFA 4ZI3A 4E5UA 4MB0A 1P19A 2FPIA 3QBJA 3CUUA 4Y7DA 4UD2A 3LQ1A 2AVNA 3A05A 3OJEA 1FS6A 3ND8A 3C7DB 3EN0A 4PC7A 1S01A 1SD1A 5FBKA 3QEMA 4ZCPA 3RC1A 4ZI7A 3UPUA 2ODQA 3CMMA 3DVQX 4LWPA 2ORIA 3G5MA 3REGA 1BQ4A 1FLVA 1A5TA 1MA0A 2DH6A 2ID9A 4ZOEA 3WRYC 4ZZIA 5IANA 4E08A 1ZUD1 4MJXA 2HLDD 4NSNA 2D1QA 1UJ6A 1XZFA 3OTIA 1YL7A 2H4WA 4G5HA 3UWOA 3ZWAA 3QKIA 4EAQA 1TKRA 2P2GA 5K01A 4KNVA 1BOFA 1CR1A 3K8QA 1IVYA 4MO9A 4Q4JB 4DRZA 1YFLA 2AI1A 3FYDA 4AK9A 1Y34E 4O02B 4QYTA 4GR4A 2RHRA 2XYGA 3OZIA 4HDAA 4UDNA 3SSNA 5LQNA 2G5GX 2B9EA 5AW2A 1V5FA 4HZUA 1Q15A 1NXVA 3H5NA 1EIZA 5CX1A 1XZJA 2BEJA 2QUKA 4XVUA 3TLYA 4F6RA 1GL6A 2P1ZA 5EMMA 2V4UA 4ZC1A 1BIFA 4BNFA 4LZPA 3NNSA 3TR5A 3NHMA 5IAEA 1ADYA 4TM8A 5JYEA 1SHJA 1UK6A 1TPZA 4NQZA 5K6AC 2XUDA 4C4RA 1HWYA 5HBGA 2NZWA 1ODJA 4DDKA 3R40A 5LP6F 4LNAA 1V8PA 3AP3A 1UBUS 1MFZA 3FYUC 3F49S 1GZ6A 3EUAA 3ZI4A 1PGPA 2P65A 1Z83A 1DFGA 4G0OA 4EVQA 4BQSA 4DIKA 4Q18A 5ALUA 4U00A 4BFLA 2XHZA 3LFUA 3OCJA 1QORA 2XWQA 1H4TA 3L01A 1TJNA 4NNPA 4YECA 1QYDA 2F3UA 3ROPA 5H83A 3NHPA 3EQ7A 1CEXA 4QUDA 1FXSA 1RJ9B 3DG9A 3E61A 5H16A 3ZIAD 4EGJA 1OX6A 2BELA 3ET5A 3MUNA 4JCOA 3NYWA 4KQGA 2OHVA 4MO2A 1YZKA 2G0AA 5DDIP 4EF6A 4YRMA 3G2JA 1F1JA 2MSDB 1EFRA 4OSEA 2VZ0A 5F76A 2R7KA 4DMLA 2ZBDA 4E7OA 4EJFA 2P5YA 2YINC 3PSHA 1JEEA 1VI5A 4NFSA 2WSSA 1KEUA 2IOQA 3LYUA 3QJGA 4AZSA 3MNFA 5A7HA 1A8SA 3GIDA 2J3HA 5CD9A 1YT5A 2YZGA 3R5JA 4RPGA 3N07A 3WAJA 1PDVA 3P71T 1H5NA 4LYJA 1SJ9A 3TQQA 1I7NA 2YXPX 3KKEA 4K03A 4LOHA 1XRNA 2X77A 4PBRA 5CT9A 1H6AA 3ZVLA 4WZAA 5D84A 4EZIA 1JHVA 5JADA 4C3VA 3VNAA 2I2BA 2R4TA 4S12A 1VMKA 5HCIA 4R6WA 3LUJA 4ZODA 2RIRA 1UFKA 1BS1A 1A9QA 1SZPA 1YJBA 2VT7A 3V1TC 3L1JA 4X44A 5I9IA 4RSMA 4TMYA 5EVJA 2GT1A 1Y98A 3HXPA 3PGVA 3IE0A 1E1QD 1UZMA 1FK8A 2VXCA 4NYJQ 2B82A 2XITA 3B3GA 2QPOA 4ROTA 2ZBUA 1BHO1 2AEJA 1ODFA 3S2FA 4PZCA 3KOYA 2C82A 3NM6B 4DV4B 2JLAA 4MIEA 1PT5A 4BTEA 1EVJA 3KTDA 4LF9B 4PW0A 4U5QA 3NMUF 3W2GA 1B0AA 4LI0A 1HYBA 2MU1A 4R98A 4DR1B 2BKLA 2VHUA 2BGWA 2ZPUA 3QG1A 4L4ZA 4QQKA 2CLMB 1GR1A 4BO9A 5J3JA 3BAFA 3RVJA 1V8BA 2NT3A 4UDOA 2H2HA 2IH2A 2A1UA 3PVZA 3OZDA 1E92A 3QPAA 2JGLA 3B9PA 4FMCF 2V4MA 3OBBA 3LMKA 4FT2A 4G4SO 4JI7B 1UDXA 5E9AA 4A03A 2IPXA 2JCSA 1PR2A 2W42A 1SB8A 2ZIXA 3JARA 4HAIA 1R9NA 2ZTHA 4MV6A 2GO1A 3RGGA 3AL3A 5CAEB 3HBNA 3LUCA 2NO7A 4YC7A 3HNRA 2RGCA 2BM1A 2VP2A 4MWSA 2PBFA 3UO8B 3ZKWB 4DC0A 1OFIA 4M54A 4DV5B 5KJ1A 1DG3A 4S05A 1WV0A 2ZIGA 1MJGA 3Q8LA 4G0UA 3EWIA 1E99A 2QL5A 1L8LA 5MN5A 2O8VA 1H2HA 1UBRS 4N5HX 5EA2A 2WHRA 4UUMA 1K6MA 2DETA 2WJVA 5LU9A 1H94A 1OI2A 1TJ3A 2D1FA 3I9JA 1PN3A 1YS4A 1NVWQ 2PN1A 3N2EA 2BHRA 1B3RA 3PJEA 4KLZA 1E7MA 3UFBA 4BASA 4BU1A 3EVCA 1KZYC 2O20A 4CDRA 2H54A 2R68A 2PZJA 1TXGA 3R41A 4U2KA 4PQGA 1HYGA 2J0SA 1QANA 5BSKA 4MVCA 1CY1A 2H2WA 2PLNA 2A33A 4MLPA 3ZH9B 2FZLA 5C8YA 3UV3A 1AS0A 2OQVA 3H9CA 3NTLA 1XU7A 1JAZA 2ZSJA 1DWUA 4O4IF 3TNDA 5JAIA 1W52X 1CF9A 3EXIB 5TGTA 1XMSA 2A5GA 2CLDX 5M34A 1DIAA 4CMCA 4ZI2A 3O4VA 1MRSA 3KHTA 2A4MA 3FN4A 3EZYA 5CFMA 2VAPA 2A86A 3CEPB 3K2QA 3KOZA 4Y0NA 4UAGA 4GGOA 5AKYA 5AM0A 5K1ZA 3MWFA 3TWOA 5JSUA 1W0KD 3PQFA 3SS8A 4YONB 2NV2B 1JR3A 1Z7BA 1DQYA 1KI8A 2EGUA 4R9UC 1SIBE 3WGYA 4AKGA 1L4NA 1U6JA 3EEFA 4NICA 2UU9B 5JNWA 1CC1S 3FUTA 2Q7DA 3I52A 4D56A 1J97A 1V37A 3T4EA 2JAWA 2A0YA 3GBVA 4JOQA 4C0SA 1KYVA 2WA2A 3EX7C 1OXMA 3K2IA 4BJ6A 2P3OA 3F5SA 4D9KA 4M1YA 5EVCA 5F1KA 1PX0A 1P60A 1GAEO 1W88A 3EEBA 5D8DA 1SIWA 2QR5A 4Q9HA 4LC1A 1O08A 2Y99A 4IAOA 2OA0A 3M3HA 4FOPA 2GXQA 4OXKA 4RD0A 1EXWA 3ROZA 5K0CA 5KDOA 1LK7A 3L6UA 3X3HA 1J21A 4C6HA 3D7NA 4HRVA 1RZVA 1VCHA 1F38A 3GFSA 4NU5A 1O8BA 3K92A 4UCFA 4MULA 3UXEA 4YQZA 1NNUA 1V8DA 4KXQA 3UK0A 4CKBB 4B6JA 1SCQA 2VJMA 3HA7A 1Q16A 5HKKA 4DIUA 2HDOA 1JDNA 1HO3A 2ETVA 3U7QB 2J9XB 4INOA 2O1SA 1M2HA 2PL3A 3AFGA 3MLAA 4YP9A 2FJPA 4QKQA 1RABA 3GUZA 5C2JB 1A9XB 2XBUA 3BF8A 4C21A 2CJPA 4JITA 5CB4F 4OL0A 2G76A 3BE4A 4Z9YA 2F17A 2DEUA 1YF3A 1NE7A 2Q3DA 1CFJA 2REBA 3GXBA 4DGSA 1GNTA 2EFYA 1M0TA 2O5VA 3PZBA 1HQYE 3RB8A 3IUJA 3SOPA 4EY3A 2JHAA 1KU6A 1W4AA 4M9QA 3V80A 2C5FA 5I45A 2RGRA 2YZMA 3TQCA 2Q3CA 2SCUA 1G5PA 2L17A 3HLKA 4YDRA 2YNMC 4HQLA 1M10A 2GUWA 3GLHB 1DTWB 3EBLA 1NX6A 2I9PA 4IDDA 3V8BA 2RJOA 2WG1A 4J1TC 1MIOA 3CRZA 4Z1MA 5LJLA 4BL5A 1NZFA 2YZ2A 1PCXA 2R3SA 1FDIA 1W5AA 4BE7B 5JH7B 2JJQA 1NVMB 1D5CA 4EITA 3DBLA 2G1PA 3JRWA 5BO5A 2REXB 2HC9A 4R05A 1OBVA 3T3IA 3TUJC 1HETA 1YZFA 4N3CA 5J4KA 1H66A 4NE7A 3INTA 5CNMA 1P18A 1GA1A 1BX0A 1WMFA 2NACA 4BFSA 5CJJA 3TPFA 3BRWD 3WICA 2WSMA 4C5CA 4K0KB 1N5DA 2WUWE 4FFLA 2VEOA 4QTTB 1KGSA 3EXHC 3TQOA 3UMFA 5E4TA 4J0DA 2FLKA 3QVLA 1E18A 2VTBB 4UM8B 4JP8A 4N9WA 1C1DA 3EWSA 4PRLA 5DEOA 1E66A 3E53A 3CZQA 1C3XA 5JXJA 4LXIA 4KO1S 5BT9A 2OCAA 5LA6A 3RNOA 3I8OA 3PRHA 3D5TA 3FJYA 4TOIA 1FQWA 1N7GA 1PT6A 4H31A 2MINB 2WVAA 4MA4A 3ZXXA 4LHYA 2GZAA 3I58A 3ELDA 5AW5A 1Y82A 2WOOA 5DP1A 2WHPB 2QK4A 4MQBA 4N0PA 3SVTA 2V8BA 1UFVA 3FE2A 3DC2A 5J4VA 2IEAA 2GDJA 3A0UA 3ZVRA 3RI3A 2HMUA 1VKHA 1AB6A 3KJEA 2PRJA 2FG5A 3DQZA 4TKLA 2DCUA 1O0BA 3KYIB 3W5SA 5L4LA 4J16C 3J81k 3BIXA 3CLTD 3S7ZA 2PANA 2GR9A 3JXEA 4R7GA 1PZFA 1VE7A 3W7AA 4LRXA 1FLNA 1X2BA 4MCHA 3V4VB 4JT2A 2R4UA 4Y6GB 2W43A 1FQKA 1AD2A 4GOJA 5H02A 1F1BA 3R6WA 3W2EA 2F8TA 3IPYA 2Y1OA 1R1DA 1HDGO 3QNMA 1HURA 3V4OA 4PLFA 3W8FA 5LIRA 1MVNA 3H8WA 3JSAA 5KNDA 3ZE9A 4EEKA 4GOOD 2JGKA 4MLCA 1Y8RA 2YYSA 4ZGBA 1HEIA 1XI2A 2F64A 2Z6UA 2PJUA 4WXEA 5BSTA 1E3IA 2JRLA 1FJ2A 3QE4A 4KU4A 1OXUA 5EUMA 2GJ4A 5DM0A 4FFWA 3RG2A 4QTXA 3VYWA 1AGYA 1BGWA 1R0SA 3W5VA 4COOA 3Q15C 3QX8A 2D5IA 3ZWWA 2CUKA 2Q8NA 1Q7BA 3QY9A 3EMBA 4RX1A 4RQAA 4LVUA 1N4DA 2HF8A 2AI3A 4TL9A 4UHKA 3ZQ6A 2ALJA 4Q03A 1MV5A 4IUCS 1UH5A 3DZDA 2JGNA 2JS7A 4W6ZA 1ZUHA 3OP4A 3U3DA 3K6JA 1O94A 4DIFA 1M6YA 4KK4A 1B8PA 2C9OA 2XE7A 4MW6A 2H85A 2J3IA 4RD6A 4ZMRA 1UBEA 1VSUA 3FRIA 5FO0A 3C74A 2L18A 3OZEA 1HY3A 4NPCA 1GEEA 1GYPA 4Y1FA 4ZA2A 3R3HA 5DTIA 4Q3AA 5FFMA 1M6VB 5TMBA 1FNNA 2XGGA 2V7EA 3NG1A 4ANFA 4QUBA 5ITSA 5AVWA 1YDHA 1ZGBA 4F2HA 1VSVA 3VPBA 2FDXA 3QVTA 3VU3A 4QOGA 3NAMA 3DDZX 3NCTA 5HDBB 4C08A 1DKLA 4F3TA 1S2MA 4C01A 3ZW9A 5KOHA 2ZRFA 1QOQB 1XJ0A 2FQQA 1HYHA 3VZCA 3WLIA 3RIGA 1EAMA 2VDWA 1HZJA 2NNLD 3B7PA 4RSGA 1MFPA 4DA0A 3ENQA 3LVFO 1LSJA 3DNPA 1L4LA 3BMCB 3HVHA 3OZTA 4LK3A 3BDVA 3WIVA 4JNKA 3LUGA 3GJYA 3C4JA 4QODA 1EGMB 2C8JA 2WJIA 3WL3A 3ZYCA 1B2RA 1RCFA 2V7TA 3ANNA 4KPGA 4N3GA 4R5HA 4YHBA 2NYAA 5J9FA 1E79D 3VZSA 1E6KA 1X1TA 3AQ4A 4DR2B 1M5UA 3AVXA 1UBHS 3L7CA 4GLJA 4X5OA 1T0HB 1MO5A 1Q2UA 3DCIA 4QBHA 2O8EB 3E0QA 3MD9A 1S3FA 3KJNA 4LF7B 4YMGA 1DNPA 4PFJA 2V6MA 3FPSA 4P80A 1M7HA 3CFYA 3VI3B 4AZ3B 1NM5C 1VJ5A 4C7JA 1DAOA 2G80A 4KDCA 4NXMB 4JBGA 3I6QA 4FYWA 5F4BA 3I62A 3OIFA 4CEIB 4QVGA 1VL6A 4X91A 5K3SA 2FE4A 4UDXX 2UKDA 3IBSA 4R4JA 3AI7A 1YRQA 2ONJA 4RFSB 1TKCA 4NPHA 4B6RA 1P6UA 1PZEA 2JGRA 3VBCA 2ACVA 4LJ8A 1NVUQ 1AQUA 4RCZA 2B92A 2WFAA 3Q3EA 3TTSA 4PINA 3ZD9A 3AP1A 3WIDA 4W5JA 1JVBA 3WGJA 5BOSA 2ZT8A 3SK0A 4GP7A 5DLYA 2A1IA 5EWMB 1IOLA 3QELA 1VL8A 2J8ZA 4OM8A 3TPZA 4D98A 1CJBA 4Z8YA 4ZCMA 3PLAE 1IK6A 1EQUA 4N3BA 3WRYA 2ZB4A 1B74A 1PYDA 2OO7A 2Q4OA 2J08A 2K4MA 4J3JA 4RVSA 5KAMA 3M70A 1ECLA 4NBWA 4P5DA 2XMBA 1YULA 3O82A 1JIUA 4Z0TA 3KZ1E 4TPKA 5K4AA 1KMHB 4ZCSA 5FQNA 2XE6A 1CIPA 4FDTA 4G1MB 4DT1B 1FUUA 3KHKA 5L7YA 1RBMA 4GOMD 1LLCA 4R1TA 1HM5A 1F2TB 3FAKA 3QKTA 4CT0A 5AXAA 1Z4IA 4DR4B 2JATA 4CKZA 3U4GA 3MRXA 2PPVA 5A4DA 1ZNWA 1QK3A 3BBLA 4IZOA 4IDQA 2GMWA 5K4HA 3HXMA 3UV6A 2IHKA 4K40A 2BHTA 3LY8A 2Q4TA 3CF4G 3UN1A 3EPLA 2GBFA 1G1AA 5K6AA 1JDTA 3O1HB 4Z4QA 421PA 2HSJA 3LKZA 4YGXB 1K7SN 3NWJA 4IIYA 1P1KA 4IQFA 4KWEA 4ZZ0A 2XWJI 2PKYX 3HHEA 4FK8A 4MP6A 2BGMA 3U6KA 2VJKA 3FYUA 4DARA 4E32A 4EHIA 3PENA 1L5HB 5BVHB 5CBKA 1M6WA 2MMGA 3ZCVA 3UWMA 1XWFA 2AK3A 4BKPA 4B3TB 2RAUA 1FX1A 4L0DA 4LMAA 2QMZA 5GAJA 2RHGB 3EF1A 4CHTA 1FFEA 1GRVA 2AX4A 2F1IA 3HEMA 4RE6A 5DI3A 4UTNA 4W1QA 2MDTA 1DO0A 1PJZA 1LGYA 1Q0PA 2XE8A 2P9YA 3KD3A 1GARA 3KRTA 5TQ0A 4EFMA 4WBNB 2M6SA 3ER9A 2YHBA 2HTFA 4RM3A 4PO8A 1BGXT 1OPXA 3KIPA 5ERGB 5FWYB 1HGXA 1NVXQ 3UK6A 1OF1A 2J9RA 1HX7A 6YASA 4V1CA 1SXJE 4K6OA 1II9A 3CRVA 2PUVA 4LZWA 4MV8A 3U5ZB 3NBFA 2CVFA 1T1SA 3L82B 3SKXA 3FCUB 4UPVA 2MR5A 2OV3A 1UC4B 5KKNB 1E8MA 5B1SA 1ZAKA 3UATA 4I4NA 5CG1A 5G1OA 1Z82A 3DQPA 2X0RA 1GIAA 1YO6A 2PSSA 1F48A 3IR7A 3O93A 4QBKA 3TW8A 4PVCA 4EW6A 2D7DA 4CL0A 4BNJA 3DV2A 3VR1A 1XQVA 3BN3A 4GZ6A 2O2YA 2WJZB 1ZSNA 4DUGD 1AO3A 1I7PA 1COZA 3F4LA 2IGBA 3DMHA 4YPOA 4L2IA 2DPHA 2W6OA 4XM2A 3GA5A 3BBPA 3NHLA 2AJLI 3IUSA 2QF7A 2ZWAA 3D4PA 3VHXB 1MNAA 3FCEA 3BORA 3OIDA 5EIAA 3WTCA 2W2QA 1ZIYA 4DA7A 3WXMA 1XD2B 1O9BA 4KIWA 2GWRA 3AUXA 3BMXA 2X0KA 5HJ5A 3WJAA 3QWIA 4QUAA 2PWZA 1SHZA 3X1MA 2O59A 1L5MA 1FYVA 3P7MA 4RE5A 3RRBA 2J0UB 3T3HA 3K5PA 3TZLA 3W6ZA 3ZKAA 2ZI6A 1KAHA 1MF7A 3TOZA 3QKWA 2R1VB 3EOBI 3M34A 3CLHA 4MI9A 3PR3A 5ILOA 4LF6B 4IKPA 4L02A 3PHBE 3RUAA 1VFPA 1NR1A 3HCPA 5AVXA 3AJDA 2FPMA 4P98A 1DB3A 2I3ZA 3PCXA 3QPDA 4E5NA 8AT1A 3HFSA 4E21A 2CE7A 5MFZA 1D1TA 3GLTA 2ZDHA 2L82A 3BOSA 1O6CA 3DBOB 3OWOA 1JG7A 3EHDA 3BJEA 2IVFA 1I10A 2OBYA 2QUJA 2X6RA 3PTZA 4O29A 5C7OO 4ZZ1A 1BE6A 3HU1A 4O4JF 5HF5A 4IMIB 4B45A 1CHNA 1KFEB 1T9DA 2WTNA 3C3DA 1XP8A 2X4IA 5BN5A 3QXSA 5A4MS 3H9QA 2R9VA 3ORYA 1MJHA 1DL5A 3JVIA 1G3RA 4Q82A 1NPTO 3F5FA 2RHWA 3OESA 4HX5A 5GM2A 4HVLA 2NQTA 2ZS8A 3COYA 4RLHA 3H04A 1TMKA 2YIJA 2VF8A 4D6XA 3DLTA 5J1TB 1R9MA 1FP4A 1U8YA 3DO6A 5J2UA 1SKYB 3BQNB 1K6IA 4QBFA 4FJ0A 1IPEA 1KDRA 1NSYA 1U8XX 2GBLC 3WMFA 4E30A 3GFFA 2P4UA 5ITZA 1V48A 2PUHA 2TMDA 4ZIRA 5K7SA 5KVCA 2R7MA 1S8AA 2RH8A 3AP2A 4HVTA 1VQ1A 5HGXA 3U7GA 1JJVA 4MWEA 1G2IA 2N0SA 2VQEB 4R9SA 3DT9A 3BTUA 3PC7A 2JKVA 4DNFA 5LKAA 3EVAA 3T8YA 2FPPB 2GEUA 2EU8A 3VKVA 3WGNA 1XTJA 1YZYA 5ED0A 1YZVA 1T8UA 3TW6A 1WF6A 3O2SB 2NAPA 4L3OA 1Z25A 3VC1A 4F3RA 3TQHA 3B13B 1JECA 1GLGA 2R60A 2ZRDA 1KJYA 1NOIA 3GGPA 4KQWA 1VSBA 2VNAA 2J07A 1V39A 2V65A 2Q5IA 3KDSE 2XCIA 4Q05A 5DWDA 3FLEA 1ZC3A 3OO0A 3Q0EA 4PLYA 1E1KA 1JSZA 1O6BA 4ZHQF 1JB1A 1DKMA 2R25B 4N9QA 3VKWA 1MC1A 3PDIB 3KOOA 4EI2A 4ZJZA 4MZDA 3OZWA 4KQXA 1KO5A 2DR0A 2V5VA 3ESBA 3JALA 3K4QA 4WXRA 4DLPA 2UUPA 1NY5A 3GQBB 2OZEA 4R68A 1YBVA 3NTQA 4QGBA 2GFIA 2ZETA 3IGFA 3HXKA 5KUTA 1KYIA 2VHQA 4F5YA 5JWRA 3AVVA 4Q7KA 5AM5A 5IM5A 5CYGA 3DHWC 1E6UA 1QR2A 3CIOA 3E03A 4QFBA 2Q4EA 3FKSA 1XJ5A 4M8SA 4P1ZA 1JA9A 3OSUA 2Q49A 4EIWA 1PT7A 1EUDA 1LD3A 1V1MB 1NUUA 2LBPA 3BWBA 3D31A 1L5LA 3LHKA 1K66A 2KLHA 1K1EA 1P33A 3R7DA 4IL5A 5JRZA 2W6IA 3RUFA 1I4EB 3OX1A 2BVNA 3MUFA 5EMHA 2YJ3A 4AXXA 4D81A 2IPLA 1CV2A 3ANMA 4BO0A 3VJLA 3PTAA 4X41A 4OHFA 1U11A 2JCXA 3GZ4A 4UTZA 3SEQA 1DCMA 2DZDA 3C0KA 5AVSA 1DUIA 4ZYWA 3Q5EA 3INYA 3EMDA 4DJ5X 5JDCA 1OT3A 3OT5A 2V3WA 1QJCA 3F8WA 3NHAA 1T43A 3KALA 1HRKA 4P35A 4XDGA 4AN4A 1FSPA 5IARA 3C5WP 2C9DA 1A4RA 3FOEC 4J1TA 2ZYTX 1P72A 3AR5A 5DVZA 4DZTA 1X8LA 4RHUA 1GTG1 3NH9A 1IEWA 3RS9A 1U63A 1SG9A 4HWOA 1Z12A 3AFOA 2WF6A 4NAVA 1TDJA 1W76A 3HDQA 4FW9A 3TH5A 4FIZA 3ADBA 3DBRB 1P1BA 2QJTA 1JBEA 1E9CA 2H5JA 2YCLA 2Z5VA 3KZMA 3NJ4A 4ZK6A 4U0JA 5EQTA 1MX9A 5L3QB 4OY3A 2ZDQA 3EPJA 4ZOLB 1CJUC 3ABQB 5EZSA 3WFIA 4TMWA 4C30A 3VAZA 5ITVA 3B1YA 1XNHA 3LA6A 3NOQA 3R5XA 1TZCA 3EXHA 4OXQA 8GPBA 5UKDA 1BQ3A 3O6VA 1JA0A 3FFWA 5T57A 1Y8QA 7ABPA 1AUOA 3PE6A 2BI4A 3L5OA 1SXIA 3GBSA 4E7PA 5KDDA 1ARZA 5A03A 2QVXX 4MQFA 1KJNA 3QUCA 1WXHA 2OLEA 3D02A 4F1WA 5K6TA 2FWRA 1WEHA 5C3UA 3UG7A 4CIVA 1F8XA 1II8A 2VDKB 3SXPA 5DBIA 1D0VA 3VVLA 3I23A 3B6JA 3E9ZA 3T35A 2UZIR 5IKOA 5K8UA 1SB9A 3QE9Y 4QJ3A 4Q3CA 4YRZA 2IHZA 4RCVA 1A5ZA 1V45E 1WMBA 1HT2E 3TSYA 1ECCA 3ML1A 4MEAA 1MJGM 2NU8A 4NJEA 4GZLA 4KR0A 4JJ8A 3MTDA 1ZGAA 3H97A 3WO0A 4UVGA 2PSJA 4DWOA 1V8OA 3UHJA 2UYOA 1BOOA 1H42A 4BX2A 2GF0A 3QLEA 4V3CA 1P2GA 2W93A 3CB4A 4RVGA 1T6BY 2NN3C 4X1KA 1WCYA 3U1TA 3SZGA 4CLEA 4YRAA 1A82A 5KI6A 1QO9A 3OEYA 3LCRA 4HQ6A 1O5IA 3CZAA 3HE3A 5JSHA 5TS2A 3MFYA 4Q3DA 4RVHA 3DF9A 3C39A 1M8PA 5DSZA 3LDFA 1E9VA 4MKHA 2HHAA 1XDZA 4DM3A 3VKGA 3T6KA 4D2IA 2H65A 3AYXB 2XV1A 4HBGA 4HH0A 5JMOA 1FMJA 1P5ZB 4BU0A 2QN3A 3TK1A 1Q21A 1S8NA 1JQDA 2I3GA 2BZ0A 4EA7A 1LS1A 3LT0A 3DZ8A 4K8OA 3MBIA 5AVRA 4B4KA 1PX2A 3JQGA 1DIRA 5IJXA 3MJCA 3OT1B 3WNBA 1V5GA 3A1VA 3FW1A 4MKXA 2CNWA 2DQZA 2XF2A 4O5OA 2FHSA 2J31A 2R6FA 1R5NA 5CNIA 4KHZA 3KQOA 4O2AF 5I7WA 4GT1A 3MRTA 1XDUA 3DFKA 1MH9A 1UKZA 3I32A 1GVHA 4FLFA 3HYTA 4J0JA 1JILA 3RUDA 1RT9A 2OQRA 2O1XA 2F9LA 2VDQB 3MB5A 3PTLA 3I5YA 2KW5A 2JVKA 1PZXA 4ZXFA 3VR2A 3ANLA 1TIKA 3AONB 3MWKA 5F9HA 3DKKA 4TZ6A 1TAGA 1FIUA 3HKCA 2X2PA 1REQA 2ADFA 1BFDA 2E7ZA 2IEZA 2GILA 1MO6A 1RYYA 4TXNA 1AH2A 1GV0A 3VPGA 4JT4A 4CCYB 3FZQA 2AEEA 2O52A 3IQGX 4N41A 2FLVA 5IC6A 1PWXA 3C8DA 1PG5A 4EGFA 1IBMB 3UANA 5D00A 2JIRA 5IG2A 4FQ8A 1E1RD 1SQ6A 2HLPA 2C9CA 1XNGA 1DV2A 4D5GA 3DFMA 4UCWA 3MWEA 4YCBA 1GZ5A 1LBEA 1MGPA 2QM3A 3H4MA 4NDAA 5KHLB 5LMCA 2E21A 2VWQA 2YVAA 3VPSA 3VO2A 4EG0A 1FS4A 3ZVMA 3S5JA 3V4FA 2ZRKA 5T4EA 1WB6A 2JFYA 2EJWA 3A3OA 4O4HF 5CW2A 5A2QA 1Z2CA 3RS3A 3O47A 1ST2A 3R9XA 4ENUA 1J0CA 1IQPA 1TB4A 2X9NA 1SAYA 1VKZA 3P4YA 3ESCA 1K75A 3GRKA 3OE7A 4CM5A 2PRZA 1ESNA 2BGUA 3SIPA 2VDOB 2X4DA 2HLNA 3BGDA 2H8GA 3DZJA 3GZNA 4YCSA 1UPXA 1ZVKA 3QUAA 4IDHA 4MR7A 2QMQA 4XQGA 5HS6A 3GUYA 3MD0A 1LLFA 1FJXA 2NUBA 3L79A 4ENTA 1A96A 4DJTA 1GPUA 3KZKA 3R8XA 4DJJA 3ZTTA 2IOFK 1V6CA 1DCKA 2Z2KA 3LCMA 1RMQA 5T7BA 1C1HA 4OHXA 3DVAB 3IPLA 2GM9A 1AKWA 2D7CA 2PUJA 3CH5A 3QIAA 4M1TA 3WC4A 4BLWA 4Z7NB 2NMVA 3PFCA 3EW7A 5B3KA 5ALLA 4BUCA 5AVJA 5E6UB 3JAKB 4KQ9A 2I2WA 3F1KA 3RSFA 2YASA 2PV7A 1K3TA 2J5QA 4H59A 3TPCA 2IHYA 5IUKC 1US8A 1YIDA 4HXEB 2NZUG 3WP0A 5BN4A 2YIVX 1JB9A 4E15A 4MSUA 3NDJA 4M1OA 3KL2A 3CVYA 2HM7A 1UEJA 4GLBA 4UMEA 3AUAA 3ZV5A 5DBOA 3BT7A 2HIHA 3FPCA 3P2OA 3WO1A 1M34A 3VKUA 3KFLA 1F8YA 4B8ZA 2IEYA 5LUAA 3KQVA 2OAEA 4QOSA 4NPAA 4AZTA 2GPSA 2QBYA 4G5XA 3H16A 4W8HA 2DAPA 2JJ2A 3HUUA 4PZYA 2ATVA 4RLSA 4BLOA 2VJYA 3AESB 3GHYA 2B36A 3KFVA 2Z9BA 1FYWA 1BFKA 3IE2A 1GPH1 2BEUA 5BORA 5AM3A 5ED4A 3HCOA 1WQ1R 1P9RA 4EY4A 1ECFA 3RSGA 3D2CA 1E0KA 2FEMA 2XWBF 2RI6A 3HABA 3SC4A 1NN1A 2BR5A 3TRFA 4ZKDA 1EAYA 4M86A 2W0SA 4TZKA 4UZFA 3W4IA 3TNFA 4QT0A 1NNSA 4P33A 5KOJA 1BEUB 3PT9A 4DQ0A 4YXWA 1TLLA 4QL3A 2DKOA 2PWBA 4UUQA 1WUJS 3OH8A 3VU9B 4KGDA 5D86A 5AUOB 2PUFA 1EXVA 1VPTA 1L7DA 1KYYA 2XMSA 3AFIA 4V0OA 1P75A 2EW1A 3QBTA 1WABA 2F6RA 2YIMA 3RH0A 2DOKA 2A6PA 4BJHB 5G2OA 1YHZA 3JASA 5A4JA 3RRNA 4BYGA 2W2KB 2RGXA 3DZCA 1FTSA 1IHYA 2PO7A 1VJ0A 2YV1A 1O6ZA 1VYHA 4FTWA 1MRZA 1Z17A 1XQ6A 5PNTA 5LMUB 2OP0A 3HA2A 5I7FA 4EK9A 3DYBA 4XR9A 1GCUA 2YV4A 4DNXA 3FY4A 5BYAA 1QE0A 2G70A 4MWTA 2AR0A 4V38A 4E07A 6NULA 1QQBA 3RAPR 4QDOA 4D3FA 2OGUA 1E3JA 3KT6A 3KWJA 1QKJA 4LYGA 5HX7A 1KAOA 5LQAA 1QYCA 2I8LA 3NUQA 1DELA 4HQKA 4S2UA 4R7ZA 4DCJA 4W1SA 2GEFA 1VG9B 2AZMA 3H5OA 3MJDA 1DRJA 2FSUA 1EFHA 2R8XA 5KOIA 5IBRA 2G06A 4AQ7A 5LXTA 1ZGCA 1VYUA 4P7BA 3E2PA 1GTSA 3K9GA 1WSWA 1U0OC 1FY2A 4KE8A 1ORRA 5DNDA 5ADWA 1I4WA 4OJKA 3AUKA 4YJGA 5E7IA 3I2IA 1XMQB 3PYMA 4G84A 3N6XA 3ZOKA 4ABTA 4LCJA 1YGYA 2P79A 2ENUA 5CP8A 4A10A 4BNNA 5BWMA 1SXQA 1EGAA 4FCTA 5DTQA 3EIEA 2GK3A 1T8WA 1KFJB 1HE4A 1NP3A 1QVVA 2TRSB 2WNHA 1VKJA 4NC9A 4PBSA 4PPQA 4U3JB 4MUGA 5HOEA 3ZWBA 3HSKA 3IBGA 3GLFE 2W8BA 4K86A 2I6TA 2AEMA 2O6LA 2X41A 3QTTA 5K3FB 1F5NA 2W2OA 3IULA 5LYJF 2JGDA 4R0NA 4F8YA 1DAMA 1RAEA 2CFOA 2QY9A 3VZRA 1H1LB 1DC4A 1L4BA 4TTJA 3ZBUA 1Z35A 2J3KA 4DIOA 2PU7A 3C98A 1K27A 1E3WB 2IZZA 4G5OA 4WKOA 3K05A 3WLMA 4TVSA 3P0IA 4OQLA 2P5UA 2IWRA 3AT1A 1SRRA 5DHFA 5CCDA 4IFBA 5DK6A 3SHVA 4MVJE 3E7WA 1NKTA 5FUMA 1D6SA 1JMYA 1U5CA 3MTIA 4IIEA 5EP2A 1NASA 3L5KA 3S27A 3F7NA 2JDID 4NOLA 4PIVA 1RAIA 1JEYA 3R75A 1E2HA 3GARA 1AZWA 4ASUA 1WE2A 2KLBA 2AFVA 4IYJA 3OEHA 3SICE 5AW3A 3HV2A 4PSKA 4UHHA 4X3OA 3A0RB 4KH0A 4LX0A 3WLPA 1YQGA 5LKRA 1VGRA 1XA4A 4XVCA 3IBFA 2XXJA 1PHRA 3QI7A 1PGOA 3B70A 1GZSA 3RYIA 1HNWB 2A9PA 521PA 8ABPA 3WIEA 1SURA 4MDHA 1TA9A 4MGYR 4MMZB 3I92A 1ESZA 1VE6A 3B51X 4CF7A 5IYZA 2CWWA 2D4AA 4UUOA 4QASA 5T4HA 5A1JA 1FDRA 4KSBA 4F4HA 4UNRA 2TECE 3JQQA 3UV7A 4F71A 2GBLA 2FP4B 2VTDA 1T5LA 2AE1A 3DPSA 4V1CI 4GX5A 2PGDA 2QTAA 1QCZA 4GYYA 3ID6C 4H3SA 1PEAA 3UXYA 2BBSA 1NQ5A 2EBFX 1XDSA 2ZYIA 3DDSA 3UQZA 1DOZA 2YJ4A 4C6SA 2OWDA 1QVAA 4KFCA 2OFWA 4IO1A 4ND8B 1NLUA 1QBKC 1SCDA 1DC6A 3GZJA 4MHSA 1ZVJA 3F8SA 4LHSA 4P8RA 3EVNA 1E20A 3PQ5A 2NVOA 1G4HA 3K70B 4QTZA 2KBEA 1W2GA 1DEHA 4DTCA 4ZICA 5K3OA 1KRWA 4BXOA 3W5BA 1JJFA 1TRKA 2TMKA 4REQB 2G5PA 2FW1A 3W2FA 5A4IS 3HR7A 4DNPA 3CX3A 5JI3E 2ODBA 2DUWA 2PSHA 5JSKA 1HFKA 2OYCA 1SOUA 4CKCB 2VK8A 2EZTA 3RS0A 2VT6A 4HB0A 4L07A 1DXHA 1HEUA 4JLAA 4N0MA 1VJGA 2TMYA 5IHXA 2GAFA 4LPKA 5KYWA 2O8DB 1Y7IA 1QUEA 5I8PA 3LLSA 3ZCTA 3IPXA 2ROQA 2WP0A 3IQDB