1Y5MA

The crystal structure of murine 11b-hydroxysteroid dehydrogenase: an important therapeutic target for diabetes
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
265
structure length
265
Chain Sequence
b'EEFRPEMLQGKKVIVTGASKGIGREMAYHLSKMGAHVVLTARSEEGLQKVVSRCLELGAASAHYIAGTMEDMTFAEQFIVKAGKLMGGLDMLILNHITQTSLSLFHDDIHSVRRVMEVNFLSYVVMSTAALPMLKQSNGSIAVISSLAGKMTQPMIAPYSASKFALDGFFSTIRTELYITKVNVSITLCVLGLIDTETAMKEISGIINAQASPKEECALEIIKGTALRKSEVYYDKSPLTPILLGNPGRKIMEFFSLRYYNKDMF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Corticosteroid 11-beta-dehydrogenase, isozyme 1
publication title Crystal Structure of Murine 11-Hydroxysteroid Dehydrogenase 1: An Important Therapeutic Target for Diabetes
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 97
structure length 265
sequence length 265
chains with identical sequence B
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2004-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1y5mA00
4XR4A 4Y9DA 5KJ6A 3KOUA 3DQPA 4GLLA 4CQLB 1P44A 4E32A 5KJEA 2WYWA 3MWEB 1MXFA 4YAIA 4ZQEA 1NWHA 1PJCA 3QRWA 4R1UA 1JTVA 4WNIA 4RQTA 3FNGA 3WYBA 2VN8A 4NDNE 1I8TA 1DLIA 1YONA 2JD0A 4P4NA 2LDBA 3VHRA 4Q3BA 3VZSA 4A27A 1EQ2A 2OUIA 3NDIA 1DFHA 1YBVA 2BLLA 1C1DA 3JTMA 4G5HA 4L0QA 3PJFA 1QV6A 3WDSA 1A7AA 3VZPA 4AL4A 1LI4A 1PEDA 5TLSA 4ONEA 3P2YA 3LYLA 3ZNNA 2R00C 4W9NA 1EDOA 4CQMD 1U5CA 1BXZA 4CR8A 1N7GA 3WFIA 1LLQA 2BKAA 3E82A 3JYPA 2XF8A 3H3FA 4PLFA 3PJDA 4FN4A 2Q3EA 4XRGA 1U8FO 4CM7A 2GLXA 4BO4A 4ZA2A 1JN0A 1HDZA 2AXQA 2IYPA 3JYNA 3H3JA 4FPXA 1PJBA 3K2EA 1U3VA 4DGSA 2D59A 5ES3A 3KSUA 2PLAA 1PWXA 1J4AA 3AUAA 2RBEA 1B3BA 2GDZA 2FR8A 1AUPA 1V3VA 3MJVA 4KOAA 4L73A 4RGBA 2O48X 2JKVA 3FR7A 4NJMB 3IC5A 1T24A 2CF6A 4WPGA 1X0VA 1P0FA 1ZSVA 2CF5A 3GZNB 3OEYA 5DN9A 3TZHA 4DQXA 4IUYA 2I6TA 2Q4BA 3IOYA 3AOEA 4NZ9A 3VTFA 3QHAA 3PHLA 3V1TC 3Q3CA 2WD7A 1T2FA 4JP2A 3GPDG 2BELA 4CLHA 4AJKA 3NDJA 1K89A 4TVBA 2ZB3A 4J4BA 3D4PA 4RPKA 4BO5A 3IIEA 1G6KA 4BB5A 4ALKA 1JKJA 3NV9A 5L53A 4PVCA 3HG7A 3SXPA 3DL2A 5ITWA 2DTEA 2X7HA 1PS9A 3BA1A 3L4BC 3H2ZA 1U4OA 1Z6ZA 5HS4A 2QIOA 4M89A 5ER9A 4ALNA 3EVNA 3BMNA 4E2XA 1IL0A 4MPDA 2W98A 3HDJA 2UAGA 3C3XA 4UUOA 2R00A 3JYLA 1Y8QA 3FN4A 1B7GO 4YJDA 1XWFA 3L4SO 3ICPA 2YHIA 3DZGA 4J4TA 3WMWA 4J4HA 4BGUA 3OA2A 1GCOA 2CY0A 4WLUA 3HDHA 1I3MA 1E1MA 5JS6A 1P33A 3ANMA 2R6JA 3U49A 1EVZA 2J5RA 1WAMA 3NT5A 1Z7EA 3V2UA 4WLFA 1V3TA 4MKXA 3GMDA 1JVSA 1C1DB 2P9GA 1VPDA 1SMKA 1TI7A 3VH3A 2JL1A 3PWSA 4GLOA 4IPTA 1Z73A 1DAOA 4FDAA 2E48A 4PG7A 4PRKA 2WE8A 2G5CA 3V2HA 2C7VA 1I2BA 4AICA 1PIWA 2FPIA 2AE2A 3C24A 3EDMA 4DMMA 3E9QA 9LDBA 3N58A 5IFLA 3G1UA 4QTZA 5ILOA 2FZEA 2X9VA 4YACA 3ROMA 4DLBA 2JAPA 4YQZA 4B3HA 1B8UA 3AW9A 1L1FA 4Q3EA 1ISMA 4I8XA 5COAA 3QJ5A 4ZQHA 3H4VA 2W4QA 3JQ6A 1ULSA 3WGZA 4FJ1A 2O3UA 4J2OA 3SEFA 1LTHR 1JKFA 4BO8A 4RV9A 1M2WA 2HMUA 1H2HA 3DONA 3PQEA 4OMUA 3X2FA 3L4BA 2E49A 3H65A 3HUDA 2X9NA 4MOWA 1DRVA 3U4DA 3DOOA 1NNUA 1HDGO 1K5HA 4QUKA 1EFLA 4QXMA 3JV7A 3MZ0A 5CAEA 3KYCA 3LT4A 3DBRA 4RCVA 4AJJA 1SEVA 3A1NA 2WD7B 1IZ9A 1JAXA 2GGSA 2VT2A 1HE5A 3GNTA 3JQGA 4CMKA 3PRJA 4NI5A 3ZV4A 3TZCA 3PJEA 1E7RA 4B7UA 1KY4A 2ILTA 5KVCA 1QYXA 4YCAA 1LJ8A 2BD0A 2HK9A 4IJKA 2O3RA 4FD3A 5BSEA 2DUWA 3AY6A 3PWKA 4LN1A 2EJWA 5F5LA 1MGOA 2CDCA 4PLHA 5IDWA 4NHEA 4E30A 5G2OA 4DLAA 5EESA 1MP0A 3GAZA 1Y8QB 4E2WA 4K6FA 1A5ZA 1MC4A 2WYUA 4OJNA 3OJLA 2YHIB 1PJTA 4UVGA 4GVLA 5IXYA 3PJGA 3IDSA 5B37A 2EP7A 3CTMA 4O59O 2VUTA 1PWZA 1QYDA 3RJ9A 2W90A 4CLXA 4IGFA 5JNLA 4MVJA 2OP0A 2DBRA 3Q2IA 3NGXA 4URFA 1OMOA 1IPFA 2VTEA 4PFJA 1YJQA 1H6CA 4IZIA 4CMGA 4JN6B 4XR9A 1EMDA 2AEJA 4IDCA 4A03A 4BKRA 4MVJI 5J23A 3H9UA 3VVBA 1B15A 4FGWA 1U4SA 2EW2A 4NNJA 3D5TA 3I9OA 4CLDA 2I3AA 4Z0TA 2QRKA 4XWYA 2PKRA 1K2WA 3OFSA 5KIAA 3KETA 3OP4A 4HFJA 4WGGA 1EEHA 1MFPA 4PG4A 1B8PA 3WJ7A 1IPEA 4FFNA 2HKIA 4YTEA 2X1HA 3WYCA 4UEJA 1WMAA 2VT3A 1FMCA 1P3DA 1IZ0A 2EERA 2XAAA 2ZCUA 1AGNA 3JQ9C 3UFXA 3PZRA 4KQXA 2QG4A 1QMGA 4GX0A 4GSLA 2Q46A 3E8XA 4XB1A 2B0JA 3PTZA 3EAGA 2HK8A 4E0BA 3KV3O 3ETGA 4Y67A 1GL3A 1B2LA 3O9ZA 3ZN2A 3E18A 3QVOA 2H9IA 4KMSA 3I9JA 2Q2QA 4K6CA 3KYCB 3AJRA 4OM8A 3PIDA 1F8GA 4ZRMA 4PN3A 3DBRB 5THKA 1ZZEA 4M86A 3U9LA 3M1LA 2RIRA 3QE3A 3H7AA 4KDFA 3JQGB 3RUCA 1X15A 3V5NA 4FCCA 3RSHA 1U3WA 2X6TA 3PK0A 4AJEA 2DPGA 5DOVA 1F12A 3DBHA 3WNQA 1NHGA 4ZICA 1NX6A 2OL4A 1GYPA 3FBTA 5JDCC 2C2YA 4J91A 3SC6A 3A06A 5C3MA 4Z9FA 1YBAA 2ZTUA 1I30A 4MP6A 4IS3A 4M1QA 3SC4A 1L7EA 1H2BA 3RI3A 4W6ZA 4XX0A 4CR7A 3NRCA 3UOGA 5DBGA 1DRWA 2PKQP 1VJ0A 5BSGA 2Q1TA 5HTOA 1U3TA 2JAHA 3BTSA 3DTYA 4WOKA 2YHUA 1O5IA 3L9WA 3GNQA 3QVSA 1KYQA 1U5AA 5H83A 5CHEA 3JQ9A 1LC0A 2PZJA 1I32A 4YB8A 3L6DA 2GF2A 3QVWA 4XGNA 2Y05A 5KNLA 2DC1A 2QZZA 3QWFA 1NR7A 4TQGA 3WS7A 2NNLD 2YUTA 5H81A 3U0BA 4GMGA 5KJCA 3FRJA 3ROKA 3GVIA 1QSGA 3P5SA 2W2KA 3BYZA 3G0OA 4R1SA 2LDXA 2Q2VA 4CMIA 3Q2KA 1LQTA 2X0JA 4Q3DA 4WLNA 4A73A 2A4KA 5CPFA 3RVDA 3QLJA 4DBZA 5FYDA 2FY8A 1T4BA 3CZMA 5ADHA 2ZQZA 3H2SA 1ZK3A 4R51A 3RUFA 3ZV6A 1IULA 4JROA 4NK4A 2VRBA 4CV1A 5JDCA 1JAYA 3PQFA 1LRKA 2HRZA 2NSDA 1GD1O 4U0KA 5U9CA 2UYYA 2DLDA 4ESOA 3NUGA 4NR0A 4QO7A 1LRLA 3V1YA 3ZV5A 2NM0A 2B5VA 3B1JA 4BO6A 4PGFA 2VRCD 3F1KA 2VYNA 4PIVA 3VPGA 3OMLA 2D2IA 4MVJG 1EUDA 3PLRA 2AQHA 3JD1A 2OXIA 5KCZA 4IDDA 4XYEA 1SNYA 2JCYA 2Y67A 4CLRB 3BHJA 4OQYA 4A26A 3ZWCA 1I10A 2AA3A 3DBHB 1TA4A 3CZRA 3ZZNA 3NEPX 1C0IA 4BMVA 3NTQA 3DBLA 2YYYA 1DC3A 4BUCA 4LISA 4GL4A 1HDCA 4PZCA 3FWZA 1PL7A 7ADHA 2I99A 4BO1A 3RUEA 1WWKA 1N9GA 4CM1A 4CUKA 1WVGA 1O95A 4D3DA 4XYBA 5B12A 9LDTA 1J0XO 1ONOA 3D0OA 4WLVA 4ZQBA 4CM5A 3I52A 3I83A 1ZVMA 3MOGA 1U2GA 2A35A 1NTOA 3KRTA 1PX0A 3ONDA 2PGJA 2HRBA 4YVFA 4IMPA 7MDHA 3K5PA 1JVBA 4BOYA 4B7XA 3U5TA 2BFAA 3C8MA 3VPFA 1H9BA 3LT2A 3QVTA 2BH9A 4XDZA 1YOVA 4F3YA 5A06A 3IMFA 4KWIA 1PR3A 4J1SA 3WX0A 2W2KB 3D3WA 3TOZA 4CMIB 3U4IA 4ZGWA 2H63A 3ZNPA 1GPJA 5A9SB 1D1SA 5JYEA 5L40A 3W4JA 4LCEA 3JCZA 1K0UA 1W8DA 4AG3A 1T2EA 4CQMA 3FCOA 4R4JA 2DVMA 1IHYA 5DCWA 1Q7GA 4M49A 3PEFA 4GKBA 1W73A 2QZ9A 5GMOA 5K9ZA 1T4DA 2YFQA 4GH5A 3G1TA 2CVZA 2E82A 4IMRA 2EKLA 3FPLA 3FPCA 1ZBQA 4XYMA 3SBOA 1K6IA 4BKPA 4B3JA 4DQVA 2B4TO 4FBGA 4RVGA 1N8KA 1P74A 3UF0A 2PD4A 4BKQA 1O8CA 3QV1A 4MDHA 4ZJUA 3A14A 3A4VA 4L8VA 2OFPA 2EP5A 1HF3A 4P4LA 5AXDA 4A2CA 2JD2A 4EEXA 4ND1A 1GUZA 4ILKA 3COSA 5JCJD 1HYEA 1QLJA 2OHXA 4P38A 1N7HA 1Q0LA 3W6ZA 3ZNQA 1OC4A 3WB9A 4BNMA 3GF4A 3R6DA 4E13A 5TT1A 2J3IA 5JMPA 4RVUA 2P5UA 5KVSA 1E1NA 4MIEA 3MJSA 1JKIA 3VOSA 3GRPA 2WYVA 2Y66A 1P1KA 5JY1A 3RC9A 2VUSA 2JD1A 3Q6IA 1U9JA 3BZUA 5BQFA 2PZLA 5C37A 2DPHA 2Y99A 4OKNA 1E3LA 4OSPA 4UVEA 3DHEA 1N9GB 3V2GA 2Q1WA 2BI8A 4OAQA 1NVMB 1XKQA 1YB5A 4KWHA 3S2GA 4EJ6A 3I9MA 1MG0A 3DR3A 5T57A 1VE9A 2XPCA 1LLUA 1VSVA 3DEYX 1QRRA 1Y7TA 2PNFA 1UH5A 2VTDA 1YH3A 4RVDA 1ISFA 3GFGA 1KBZA 1B0AA 4M55A 4PLWA 3AUUA 2GPTA 1NBOA 4L4XA 5THQA 5BR7A 4JBIA 5L9AA 4PG5A 4U8GA 4IQGA 3FF4A 4EUEA 3KO8A 4MVJH 2BHLA 2FPGA 1VJ1A 4NBUA 1JQBA 3CSDA 3EYWA 4NMHA 1LEHA 1YOVB 3LQFA 3VH4A 1XEAA 1GQ2A 4DIOA 1DOHA 1U3UA 3TSCA 2C20A 2PWZA 3D3WB 4HX5A 2PR2A 5AVOA 5A4DA 4E33A 2C54A 3PZBA 1I3NA 2UDPA 3PYLA 1BSVA 4WJZA 4CQMB 4HY3A 1O89A 2DM6A 1HL3A 3W1VA 2AQIA 4MVJM 5LC1A 4W9NC 2DUUA 3I9LA 3ZU5A 2YQ4A 5L45A 4GI2A 4FFPA 1X0XA 2I67A 3LDHA 4IXTA 5EERA 3ONFA 2DBQA 4I5EA 5FI5A 4L9RA 3H6KA 4BS9A 1HETA 5JAIA 2V6FA 2YDYA 1HKUA 4LGVA 4NU6A 4J90A 4YAJA 3S8MA 4RZHA 3HDYA 1GU7A 1M76A 1P1HA 1OOEA 3ON5A 3GRKA 3IAHA 2Q4EA 4OL9A 5BNTA 3WGIA 3GNSA 3HDQA 2WJPA 5HWSA 1V6AA 3QW2A 4OHUA 5I8WA 2W2LD 4Y98A 3G79A 2HDHA 1X14A 4JJFA 3GK3A 3KTDA 3LSYA 1CDOA 4NJOA 4Q3AA 3TNLA 3UCFA 5DCUA 3JQAD 3W8FA 3GG9A 4OOEA 3WLEA 3GG2A 3TWOA 1PZGA 3JQFC 2G1UA 3WQSB 1P1IA 1QYVA 5ENDA 3AOEC 3LU1A 4HNHA 3IUPA 1A72A 4P4GA 1T2CA 1HE2A 1JA9A 2TMGA 4JJIA 2FZWA 2HJSA 5TSDA 3KZVA 2I5PO 1U2DA 2YJZA 4PLPA 1I3KA 3PHJA 1LDEA 1C3VA 1Q7BA 4TRNA 3ZI0A 1ORRA 3DFZA 2JFHA 3EVTA 1UAYA 2GO1A 3Q9UA 4UREA 4HADA 2I9PA 4B8WA 3E03A 4ITUA 1E3JA 2EKQA 1ZUD1 4YDRA 4PCVA 3GGOA 3RD5A 4C7JA 1M75A 2WSBA 5TS3A 4EI2A 1J6UA 2EKPA 1E3EA 2NTVA 1X7DA 2O3SA 3BMCA 2JJYA 1YRLA 4BNWA 1E1KA 2Q49A 1ULUA 1GZ6A 1JWBB 1DXYA 3OETA 3I23A 3UGKA 2EGHA 3WNVA 1D7OA 2F00A 4XB2A 3I9NA 1TXGA 5ILGA 2Z95A 1WDLA 2PD6A 5COQA 1H6DA 1HYHA 3SJ7A 1ONNA 2HAEA 4DVJA 5CDSA 1R4NB 1SPXA 4UEOA 1EVIA 5EN4A 4CM9D 4R5MA 2VQ3A 3AY7A 1IOLA 3DMTC 4BNZA 3IS3A 1QV7A 4GX2A 1YB1A 1UAGA 4K28A 3WGOA 3IUSA 1DB3A 4D44A 1W6UA 2FSVA 3GLQA 5K0ZA 5KVQA 3HFSA 4XYGA 2HMWA 3OJ0A 5AXCA 2QX7A 4IIUA 3PI7A 2C2XA 4TRMA 3IKVA 1ZEJA 3A9WA 3JQFA 4XCVA 5EINA 4CPDA 1YGYA 2C5AA 5TJHA 1DC4A 4WCDA 3WGYA 2ZTMA 3OQ1A 5AXBA 3L0DA 1AHIA 1D4FA 1LUAA 3ORFA 3U4HA 2G82A 3OICA 4BNGA 1TT7A 4NU5A 2C29D 1KVRA 1PGJA 4U6QA 3WGQA 3DZIA 2OP1A 3ENNA 2CMDA 4CL3A 4MVJE 2FR0A 4XGKA 4BNNA 4YAGA 2POQX 4QFCA 4K9DA 3JSAA 3TZQA 4WECA 2EW8A 2VZ8A 5T67A 1IHXA 3CPSA 3LZ6A 1M6WA 3GGPA 4GWKA 1P31A 3UCEA 1HDRA 3ZWNA 5IZCC 1D1TA 2FMUA 4S3MA 4F6LA 4OXKA 5DT9A 3H9EO 5ENVA 2CVOA 1HWYA 3WWZA 4OGWA 4J7UA 3ITDA 3AOGA 4L76A 1H93A 2ZB8A 3GGGA 1MFZA 1LDMA 5I7FA 4N5LA 1ZK4A 2X5KO 3PHHA 2HU2A 2J3HA 2VHWA 4B8ZA 1AN9A 3AI1A 4CL8A 4FR5A 2BGKA 3ENKA 4D45A 1ZNQO 2VNAA 4PRLA 3R3SA 3BMQA 2FHSA 2VOJA 2B35A 5F3RA 2EF1A 1Z82A 4FJ2A 3FNEA 3I3OA 5L7WA 3DBVO 3VH2A 1PJ3A 5HA5A 2P68A 3DMTA 4HV4A 2DKNA 4F46A 2JCVA 1Z45A 5G0WA 4CODB 3W8EA 5F1KA 5CEFA 1ARZA 1R37A 2NVUA 3FR8A 3GVCA 4UVIA 2YQ5A 1O6ZA 4EZBA 4RVHA 5KOIA 1MC5A 3BMCB 4XA8A 1YE3A 3NKLA 4XRRA 4W4TA 2VHYA 5L7YA 3ZU2A 1XDWA 1XU7A 1YO6A 4HBGA 1OAAA 2PH3A 3GOHA 2A9FA 3WIEA 1WP4A 4RORA 3PP8A 1QLHA 2X86A 4L4RA 2HMVA 3FBGA 5HS6A 4JP3A 3BTVA 1KEUA 4FGSA 2GN4A 1YL5A 4GGOA 2GUGA 1SEPA 1XSEA 2VCYA 2VYVD 4C4OA 3CIFA 1GFSA 5A5EA 4B79A 1RPNA 5JBIA 5IZCA 3GHHA 4JQCA 4Z0PA 1LRJA 3HHPA 4BGVA 1A9ZA 1AXGA 2CSUA 4IJWA 1T1RA 5A9TA 5A3JA 2AW5A 4Z0HO 2Y68A 3FTPA 4PLZA 4CM8A 5HM8A 4P22A 4KQWA 2O7SA 2Z1MA 2BFOA 2XXBA 1QORA 3WBFA 6ADHA 2ZATA 3GZ4A 2YW9A 4A5OA 1ISIA 4X54A 2J3JA 4YEDA 4I9UA 4QEDA 2RH4A 2GERA 1NFQA 4LSWA 8LDHA 2VHXA 1FDVA 1LNQA 4CMEC 4R9SA 5DP1A 2DFVA 2WDZA 3HN7A 4ZVVA 3TFOA 2VRCA 1CYDA 3OJEA 4II3A 4J1TA 3HB4X 4K1LA 4XQCA 3BMNB 1UZLA 2CZCA 4IDAA 1QR6A 3AUSA 5AQ1A 2IXBA 3MJ4A 2ZJ0A 3ST7A 3A28A 4U7WA 1SC6A 4HNGA 1H6AA 3UCXA 1P1RA 1BXGA 1HDYA 1LLCA 3ROQA 1UXIA 4TKMA 1UZMA 5G4LA 2YFHA 4MIYA 4WLOA 4NK5A 2O3QA 4YRBA 1DEHA 3LC7O 4YJFA 1DFGA 4NBWA 4LVCA 1XQ6A 3VVCA 5C5IA 1MG5A 3BMQB 1U28A 4JGBA 4L75A 4D0SA 2HUNA 5MGBA 4R69A 3W4KA 1GV1A 4YWJA 5JYDA 1PS0A 3C7AA 4MKRA 1ZW1A 1R0LA 1RWBA 4GQAA 4W82A 5DNAA 5I7EA 5IF3A 4RF3A 3GDOA 4OSOA 1TVEA 4O6VA 5FFFA 2DQ4A 2NVUB 2DT5A 3IL2A 1PL8A 1E6UA 1R0SA 1BDBA 1P1FA 3ZWXA 3ZWYA 1WDMA 3PYMA 5DULA 5JO9A 5G0SA 5JC8A 3PQDA 4J3FA 1Q7CA 2J6IA 2IODA 3UN1A 4ND3A 1I5RA 5CDYA 4IQ0A 1SCUA 3E9MA 2ZTLA 2OBNA 3KEOA 3GDFA 2B83A 4NBTA 4QQRA 1NM5A 5GY7A 3Q1LA 5JY6A 4OO3A 1PZEA 3AI2A 4YJGA 4CMEA 4JBHA 1B8VA 3WXBA 1ZJZA 2A94A 4U5QA 1M66A 2PGLA 4I5FA 3L07A 3GUYA 1LSUA 3B1KA 1GR0A 2VWGA 1B26A 3WBBA 4EGFA 1DC6A 3SVTA 4O0LA 4R9RA 1LDGA 1WNTA 3RKRA 1C14A 5F5NA 3NJ4A 3VDRA 3RFTA 2F1KA 3GUCA 1E1LA 1VI2A 2YV1A 1B14A 4N5MA 4EUFA 1EZ4A 2VUUA 3W6UA 2C0CA 1H6BA 1I2CA 2IRWA 1Y1PA 5DBFA 1DHTA 2A92A 2GZ2A 2EGGA 2V65A 3FSRA 2DBZA 2P4QA 3VC7A 4XJSA 2H1SA 3K73O 5JCXA 1R4MA 2E4AA 4MVJF 5JAMA 3X2EA 4BNYA 2BGMA 1MV8A 1UP7A 1X13A 1DAPA 1VLLA 1M67A 5DCYA 3L77A 3PDJA 3NYWA 2AG8A 1HT0A 3TOXA 3UKOA 4BNHA 4Y6PA 5TT0A 1BXGB 1ZKMA 4IDGA 1LDBA 3UVEA 5A9RA 1PSDA 1DLJA 1WZIA 4E5YA 3AM4A 1TLTA 1PJ2A 4LCJA 4WE3A 4WEOA 4YJFB 2ZIZA 4EBFA 4WCFC 2G0TA 3R3JA 3ZU4A 5K6AC 4TRRA 2PD3A 1K6JA 1ZMOA 2AQ8A 3EZLA 1NFFA 5F21A 4D42A 3GMSA 1BMDA 4GGPA 1V3UA 4OH1A 2C5EA 5ICSA 1BW9A 4GVXA 1MXHA 4J9UE 1GDHA 3TJRA 1FF9A 4PG8A 3FD8A 1GQQA 1IE3A 1R15A 1HZZA 1VKNA 2BRUA 2ZQYA 5B4UA 1PZFA 3RWBA 3EZYA 1PGOA 1S6YA 1UUFA 4N5NA 1YB4A 1ZH8A 4EW6A 4FJ0A 1GY8A 3CMCO 2C82A 3O26A 5G4KA 1HYGA 3UICA 1BXKA 4GX1A 3MEQA 5DP2A 5EPOA 1PJLA 1E7YA 1Y5RA 3C85A 2V7PA 1E6EA 1HE3A 3ZWWA 1SOVA 2EV9A 3U3XA 2QHXA 2NTNA 1G0NA 3DO5A 2OGUA 1YXMA 4U0JA 3RBVA 2R2GA 5AYVA 2H6EA 4PVDA 3OSUA 4YYZA 4YJGB 3AI3A 1DJNA 1YL6A 1C1XA 3E9NA 2H5LA 3QQPA 2Y1FA 4WOJA 4DPKA 3S2EA 2IZ1A 1FDUA 3F4BA 1PJSA 1RJWA 2GZ3A 3C1TA 3EK2A 1FJHA 1Y9AA 5EQDA 3OBBA 1YDWA 4FFRA 4XQGA 1V9LA 2IDZA 3LC2O 3TDKA 1YWGO 1HXHA 4QECA 5CDTA 3F9IA 4RPJA 4Z9XA 3RU7A 2UV8A 4JLWA 1V8BA 4BGIA 3F4LA 3GN1A 2O2YA 3SLKA 3MWDB 3HQ4O 3VAZA 3JQ7A 3HB5X 4UEKA 4WCFA 4WLEA 5K6AA 3LT0A 4UUPA 4CR6A 1GPDG 2GZ1A 4FFOA 4JCOA 1GUFA 3O8QA 4HKTA 2EJVA 3RQSA 1P1JA 1R4MB 1K3TA 1T2AA 5T6BA 3H5AA 2CDAA 2HJRA 3JQEA 3U62A 4ZRNA 3BXXA 4IY1A 4JNKA 1LSOA 4BKOA 2W2LA 3DZFA 1QKIA 4NH4A 2ZCVA 4E12A 5B4VA 1Y8RA 1QG6A 4IS2A 1DIAA 2RH8A 3NAQA 1MUUA 4RZIA 1AHHA 1KS9A 5C7OO 1HZJA 3OECA 2PK3A 3ICCA 1T1SA 2Y0EA 1DIGA 3NT4A 2CD9A 4YBZA 3RFXA 3VH1A 4J1NA 1LA2A 3WQQA 3Q11A 4UVHA 3ANLA 5F1PA 3DZHA 3L6EA 2BMAA 2NV6A 4GAEA 5TF4A 4LMRA 4BMNA 4H7PA 1BW9B 4DRYA 3NX4A 4EJ0A 2B69A 1X7GA 1XCBA 2VWQA 1P0CA 1ENZA 5HRUA 8ADHA 4IJUA 4CM4A 1G1AA 2DBVO 4TMFA 1CERA 1Z74A 1JWAB 3TZ6A 4E6PA 1X1EA 1S7CA 2FRDA 5CEEA 4YA6A 2Y1CA 2CDBA 3T7CA 1DRUA 2ZYAA 4HFMA 3KLMX 3F46A 3FTNA 3I6QA 2IZ0A 5G4KB 3WICA 2C7GA 1EVJA 4ALJA 1R16A 4R3NA 1WMBA 5JAZA 5EJ2A 1YVEI 4TROA 1W0CA 4FFMA 1ZO8A 1LLDA 1UJMA 2Y1EA 3KEQA 1XIVA 2G17A 2ZTVA 1J5PA 4Q9NA 3ADOA 1C1XB 4YPOA 3E1KA 1NAHA 4RVFA 1GZ4A 4J16A 2YDXA 1TB4A 2Q1UA 3F6YA 1NPTO 3KYDA 4CM9A 5LDGA 4QFDA 2HMTA 3MTJA 2ET6A 4E5PA 3LK7A 3CINA 5CG2A 3WGTA 1EUZA 1GQYA 3HNPA 5FWNA 3GEGA 3SLGA 4DMLA 2B36A 4ID9A 4G65A 4BQRA 2Y1GA 3FWNA 3OH8A 1PQWA 1WXDA 3QWHA 2X8LA 1NPYA 1IY8A 3TL3A 4GMFA 1XG5A 2P9CA 2O4UX 3RUIA 2Z1NA 3GN2A 3JQ7B 3MJEA 2HO5A 5BNFA 4E5NA 4WCFB 4AJ1A 3EY4A 4JX8A 1ISHA 3PHGA 1P45A 4B3IA 5FF9A 5L7TA 4AJNA 5JXWA 3NDRA 4NBVA 3DBLB 1W4ZA 3O8QB 4RO0A 4JIGA 4CM6A 5A02A 4M54A 2QYSA 3HSKA 3PIIA 1BGVA 3ZW9A 3ROPA 3QA9A 4FOSA 4EEZA 4E21A 4BNKA 5I7VA 1LDYA 2ZYDA 3D1LA 4PLGA 1CEQA 3LF1A 4NQZA 3O4RA 3KBOA 1PL6A 1ZEMA 4PLYA 4W99A 1KEPA 4BB6A 1Y8RB 1BWSA 1Y81A 2VHVA 3GR6A 1RM5A 4RLHA 3E5MA 3DDNA 1TT5A 3ETDA 1KVTA 3K96A 3TZKA 1VSUA 3BIOA 2Y1DA 4PLCA 1EK5A 3LF2A 3C1AA 4LVUA 4PG6A 4KZPA 4BIIA 4U6SA 4MJLA 3VKVA 2IYOA 4BHTA 4I1IA 5IDQA 5A3VA 4ND2A 4LSMA 4CMCA 4LW8A 2FR1A 5JW6A 4AJHA 5I9NA 1N1GA 5TRTA 3GEDA 1GZ3A 3JQDA 2UUOA 1NFRA 2CUKA 2IE0A 4ROSA 4DUPA 1EUCA 4Q3NA 4YR9A 2DFDA 3MJCA 4R41A 4YQYA 4CM4B 1I2ZA 2CNBA 2O2SA 1EVYA 5TX7A 4R1NA 4CJXA 2NLOA 4IXWA 5CDGA 2Q99A 1I24A 2WEKA 3DMYA 4BNFA 3B70A 5FEUA 2X0IA 4J1QA 1I01A 2B4QA 1ZCJA 4FB5A 1KERA 2PZMA 3F1LA 3DAPA 2NTJA 3K92A 1HLDA 2PY6A 3OHSX 4IGEA 4XIYA 2PA3A 1FDSA 4N18A 1T26A 3EHEA 4ND5A 4DYDA 5KVVA 1U7HA 2C07A 2ZKLA 3OJOA 4J9VA 3VZRA 3KYDB 4INAA 3WGHA 3ABIA 3GC6A 3JD4A 3WTCA 2HQ1A 5HBRA 5A5FA 1SAYA 1Q0HA 3V8BA 4CMHA 2E6UX 2NU8A 3K31A 4CMJA 1C0PA 1R0KA 1LDNA 2AQKA 5U1PA 4BO9A 4D0RA 4CMAA 1DFIA 3RC2A 4CM3A 4PZEA 5CEJA 2QYTA 2QRLA 1E92A 3QSGA 3ZU3A 4CLEA 5KWEA 3LLSA 1CJCA 3G17A 3JD3A 2J5KA 5G0VA 4L4SA 4BL5A 2VWHA 5KKCA 4D41A 4WEQA 4DL9A 4MINA 4NBRA 3ANNA 4O63O 2EXXA 3DTTA 3I4CA 3AU9A 4FIZA 4G81A 2BFPA 1H94A 1GEGA 1CIVA 3BHMA 1R12A 3R1IA 4NG5A 2P5YA 1XGKA 1A27A 4GKVA 3RJ5A 4J43A 1YQXA 4WNCA 2HCTA 3Q0EA 1TT5B 3ZNOA 4DPLA 1NAIA 4BO7A 2DU8A 1ZJYA 3P2OA 1VM6A 1RM3A 1F0YA 3MJTA 4IZHA 4FFLA 4XQ9A 5IN4A 3T4EA 3BAZA 1YJ8A 3VPHA 4DLLA 5L51A 3ASUA 1C0KA 1YQGA 3IP3A 4KTVE 1BRMA 2J3KA 4MVJP 1I0ZA 3B6ZA 6LDHA 2O50A 4D3FA 2GYYA 4WUVA 5IXSA 5DDIP 2YY7A 4RLSA 3GVPA 4BNLA 1X1TA 3H5RA 1H9AA 3ZHZA 3RC1A 3HFGA 2Y0DA 3ULKA 5TNXA 5EIOA 3GH3A 1CQJA 3U4CA 4Z6KA 3CE6A 1L7DA 3AM5A 1MB4A 1DO8A 2JFGA 4TSKA 3TN7A 4PLTA 5F1OA 4XD2A 3TQHA 5AXAA 3WIDA 4ALMA 4R01A 1BVUA 1HSOA 1A71A 1LBEA 3QWBA 1MA0A 1VL8A 2IEBA 5CDUA 5JPIA 2PKQO 3KSZO 2J5QA 3DAFA 3DB2A 5JAQA 1ADBA 3WLFA 4K26A 2I66A 3T4XA 1B3RA 5JLAA 4BO2A 3G49A 3VTZA 3LT1A 3QVXA 4XYLA 3AWDA 4FW8A 4B4UA 3OJFA 4NFHA 2GSDA 1UDAA 2QRJA 3GAFA 4GWGA 3VDQA 1BG6A 1VL6A 4KUHA 1CF2O 4IDFA 4H3VA 3RUHA 3ZWPA 1GAEO 4PLVA 1R66A 2SCUA 3S2IA 4I9NA 3PHIA 3WOHA 3WGGA 2OBYA 1P9LA 2WD8A 3DWFA 4I5DA 3BMOA 2B5WA 1YKFA 1E7SA 2CVQA 2EEZA 3QP9A 3FI9A 1KVUA 4L74A 4W7IA 3HJAA 3F5SA 1TEHA 1KC3A 4IINA 1LSJA 2P91A 3VPSA 1EK6A 4QO8A 1NQAO 3KUXA 1NQ5A 1VC2A 4BO3A 4TVOA 3DOJA 4NIMA 4YAKA 1EDZA 3OF2A 4XKJA 1F17A 4FQ8A 2WMDA 1ZFNA 4A7PA 4D3SA 4CMBA 2JHGA 3ZWAA 2HK7A 2W8ZA 4RPLA 5IDYA 1CRWG 4Q39A 1E3WA 1YQDA 3M1AA 3S2FA 2Y93A 3WTBA 1AXEA 3KVOA 3K30A 3RC7A 4ALIA 5L4SA 2X4GA 1H0KA 3GQVA 1HRDA 2NVBA 1LSSA 1GEEA 1KY5A 1PGNA 4J7XA 4GSKA 3PGJA 5BSFA 5GZ6A 2ZB7A 1ID1A 1E3SA 3AM3A 3N7UA 3TRIA 3HN2A 2Q50A 5TC4A 3H9GA 3ZHXA 1ADGA 1NXQA 3D3EA 1Y9EA 5JMWA 3GT0A 4DXHA 2PFGA 2X9GA 5DF1A 3DHYA 4BGEA 1UDCA 1EE2A 1H5QA 4H16A 1KVSA 4ZQFA 2D1YA 1LX6A 1HE4A 5LDHA 4QSMA 1KEVA 4EDFA 4RPGA 2V6MA 1UXJA 3GPIA 3F47A 3TF5A 1KOLA 2O7QA 1PGQA 1SZJG 3CMMA 4BV9A 3GVHA 5A1TA 2ZJ1A 4RQUA 3ITKA 1DC5A 3INGA 4YT2A 1OFGA 1ZSYA 3M2TA 2BGLA 3R0IA 2FN7A 4KP7A 1YL7A 2B4RO 3AUTA 4TRJA 5T5QA 1WLYA 1B16A 4IDBA 5DBIA 5L4NA 2O3TA 3SJUA 1RM4A 2GR9A 1OZAA 3H8VA 4M87A 3FNFA 4XDYA 2VHZA 1XHLA 2Y1OA 3DOCA 2EWMA 3WYEA 3LVFO 5JC1A 4ZHSA 3INRA 4NPCA 1ISJA 4OIMA 4IBOA 4BNIA 2VNSA 1ADFA 1ADCA 1PZHA 5MDHA 4Y8VA 3RBZA 3ZCXA 4E3ZA 3OIGA 2JHFA 2G76A 3DZJA 3GHYA 1Q0QA 1IUKA 4XIJA 1WPQA 5DZSA 1PTJA 4UVDA 3BMOB 5BNIA 3LLVA 2C59A 1A4UA 4E31A 4YT5A 1GYRA 2AHRA 3PXXA 1PU2A 3PFWO 5B4TA 1OI7A 3BHIA 3WMXA 3GY0A 4A10A 4DIFA 1HEUA 3K8ZA 2WWRA 3PPIA 3P19A 3WR5A 3EW7A 4FOOA 3B20A 4ZD6A 3ZWOA 3NT2A 2Q45A 4E2YA 1NYTA 1ZK1A 4GBJA 3PDUA 3CH6A 4JBGA 4AVYA 3H9JA 3K6JA 1WW8A 2FSSA 4HFRA 3WFJA 5I9LA 2BF7A 3M6IA 3ZHBA 2NU6A 3ASVA 2CFCA 1I36A 4H15A 1E3WB 2UVDA 2QQ5A 1EQUA 1KETA 3KLPX 3G3EA 1ZK2A 4IJVA 5DOZA 4B4OA 3VPXA 4BO0A 3CUKA 4PZDA 3D4NA 2O3JA 1UP6A 2PH5A 1O94A 3D7LA 2AMFA 4AJPA 1IB6A 3VZQA 5G0UA 3AY3A 2RHCA 5TIIA 2PTGA 1ENYA 2NWQA 4N7RA 4Z3DA 4CV3A 2E37A 3KYBA 1GCUA 4KUGA 4UAGA 2D3TA 1E7WA 5L3ZA 5H82A 3GVXA 3TPCA 2IEDA 1VL0A 3UXYA 1XA0A 1XQ1A 1VRWA 5COBA 1F06A 2X22A 3IP1A 4Y6SA 4EYEA 4RF4A 3RROA 5IN5A 1MLDA 4BNTA 3QWAA 1D8AA 1U8XX 3WJAA 4OQZA 4R5HA 5I9MA 2I76A 1QYWA 3DZBA 2AEMA 3RAJA 2ZK7A 5CPBA 2B37A 5C7IO 5A05A 1R6DA 5CP8A 1RYDA 3NTRA 1Q1NA 2NQ8A 2RCYA 3K2BA 4CM8B 3DFUA 3UHAA 4FC7A 1XR3A 4YT8A 2GD1O 1SB8A 4GPD1 4RDHA 4YXFA 2NVWA 3ADPA 3H9QA 4W7HA 3WWYA 3PVZA 4B4VA 5B1YA 3IJRA 4B7CA 1E0DA 1HLPA 1NVTA 5JFOA 2TMDA 4I08A 4OXNA 5BSHA 4EUHA 4QT0A 1DIBA 4RPHA 1E77A 1PJQA 5IZ4A 3O38A 4UULA 4JK3A 2D5AA 4MIOA 3IJPA 4ZQGA 5JCJA 3FNHA 1Z75A 2OO5A 1XLTA 4TZTA 1DJQA 1D3AA 3KB6A 3DC2A 4CLRA 3JQBC 4OXYA 5LCXA 4MP8A 3ZW8A 4D43A 1UP4A 2X5OA 2NUAA 2OZPA 3H5NA 4HXYA 1HDXA 1A4IA 2YV3A 3DAGA 1ENPA 4WASA 1T25A 1EFKA 5AOVA 3RUDA 1U1IA 2GN8A 1UDBA 2D4AA 2D8AA 1FK8A 2P4HX 1PQPA 3ETEA 4R16A 3NGLA 4ALLA 4HWKA 1ONPA 4LRTB 4ZN6A 1BDMA 1KEWA 2PV7A 3JD2A 3M2PA 4DBVO 4TWRA 4II2A 4D7AA 1DHRA 4HUJA 3INTA 2X0RA 2ZB4A 4DTIA 2D0IA 4BV8A 3NJ8A 1Q2XA 1SBYA 3RU9A 1JDJA 3BTUA 4DWVA 4R1TA 4DC1A 3RCBA 3DHNA 1RM0A 2FPPA 3W8DA 1QP8A 3RUAA 3F3SA 1WZEA 1JW9B 4BNJA 4YRAA 1DBVO 2RAFA 4J7CA 4EITA 2P9EA 4AFNA 2NU9A 5KTKA 1UXKA 4CLOA 3PWZA 4O5OA 1KC1A 4J2HA 2IZZA 4KDEA 4KTTE 1Y6JA 3D5QA 1V0JA 4IDEA 1PS8A 1DIRA 4WKGA 4ND4A 1NQTA 2YZ7A 1NR1A 1QYCA 3C7CB 4D79A 5JDIC 4WK6A 3E48A 2J8ZA 4Y6RA 3UUWA 3CKYA 3N74A 3AK4A 4D46A 3JQBA 5I8ZA 1FDWA 3LC1O 4M8SA 3EGOA 4AJ2A 4DREA 2FOIA 3CXRA 3GFBA 3V1UA 1FDTA 3L9XA 3RBXA 1EBFA 1N2SA 2HLPA 3UH1A 1CQIA 1P77A 2WM3A 1GADO 1NHWA 1XU9A 2P2SA 4XQEA 1O0SA 3TL2A 4BNUA 1ISGA 1LC3A 4P8RA 2EG9A 4R68A 1GTMA 1UXGA 1M6HA 3UAGA 4FSHA 1MX3A 1G0OA 4AJ4A 2VOEA 4BNVA 2I65A 3MCVA 4JXKA 2NQTA 4YT4A 3D64A 3JQAA 4E5MA 2X23A 2D5CA 1AE1A 4A0SA 3JQ8A 1I3LA 3UW3A 4RDIA 3QIVA 4BQPA 3KM0A 3CEAA 3D4OA 2DAPA 4MVJD 4F6CA 1T2DA 1UXHA 1KVQA 1E5QA 1K6XA 1XELA 5A03A 1OC2A 3NTOA 3ZDFA 3JQCA 2GN9A 1NVGA 4YJHA 1PJ4A 5KKAA 1DPGA 1UR5A 1GUYA 1NASA 2X58A 4XEHA 5I7SA 5ICMA 3PGXA 2PZKA 3S1LA 4Z9YA 4J0FA 5IJZA 3U09A 4XJTA 1A9YA 4TKLA 2BFMA 4B4WA 1NPDA 3IKTA 3I6IA 2OOSA 3OIFA 3MOIA 4DA9A 5TQVA 2Z5LA 1F14A 4BVAA 3K9QO 1HDOA 3AU8A 2ZYGA 1X7HA 3GDGA 3OEWA 1DDOA 5JDIA 4XGIA 3SX2A 4N54A 4OOFA 1ZK0A 4F45A 4Z3KA 5JE8A 2HSDA 3HZZA 3I5MA 5JSFA 4IM7A 4J49A 4RVSA 4TZKA 4RF5A 3ONEA 2XXJA 4CUZA 2V6BA 3I4FA 5JO0A 5IG2A 2BI7A 2FP4A 3KHUA 4AJIA 2JFFA 3WSWA 2Q2WA 2AG5A 2HMSA 3JYOA 3STHA 3WSVA 1ZXBA 4CLOB 2WE7A 1E6WA 2VZ0A 5GZ1A 3RKUA 3Q9NA 4UUNA 1ZSNA 5CG1A 2OORA 3E5RA 2GCGA 5TGDA 3JD0A 1ZIDA 2JCXA 5IAAA 3DXFA 4ZU3A 3MTGA 3L6OO 4I9HA 4E5KA 5T8KC 3T7EA 1YS4A 5A04A 1V35A 2PGDA 1F8FA 4MP3A 3S55A 3ZGYA 2GASA 4CV0A 3TFQA 2FWMX 3E6AA 3OQ6A 1VJTA 2O23A 2NU7A 4AJLA 1WDKA 4Q3CA 3QY9A 4MKZA 4DQUA 1PGPA 4E2ZA 1E3IA 3EUWA 3HADA 3EMKA 1LU9A 1U7TA 4RL6A 4EJMA 3P7MA 1JU9A 3AFNA 2Q1SA 1NQOA 1RYEA 4MO2A 2AE1A 1IYZA 2IXAA 2OMEA 4OKIA 4HP8A 3ZWVA 4BNXA 2GN6A 3EC7A 3WG9A 4DYVA 2VWPA 1EBUA 4BMSA 1E5LA 4OYRA 5U4QA 4JJGA 4FC6A 1CWUA 4YRDA 1ZMTA 3OQBA 4RF2A 4DPMA 1ZXLA 5A9SA 5L4LA 5GZ3A 3ZV3A 3JQAB 3RFVA 1N92A 1YBMA 4J0EA 1N5DA 4CQLA 3ZWMA 3GA0A 3I1JA 3JQ8B 2GNAA 4IIVA 5BT9A 3AFMA 3C7DB 3HE3A 1SOWA 1ML3A 3ZH2A 1C0LA 3PYXA 4YJHB 4KUEA 1LXCA 3PFFA 5EMHA 1GYQA 4LRSB 1XYGA 1VKOA 1DIHA 2UUPA 4IQ8A 3ZWBA 4E4YA 1RKXA 4YAEA 2V6GA 4RJTA 4XZ3A 2VZ9A 3JYQA 1Z7BA 3OIDA 2QW8A 2X0NA 2WTBA 1OBFO 3DZKA 3QWIA 4O1MA 5T8KA 4C7KA 1QXSA 2EIHA 4R3WA 5L95A 1O9BA 3I9KA 2I3GA 3C1OA 4BKUA 2GRAA 1LQUA 3OA0A 2NACA 4LK3A 5EL0A 2RHRA 2O4CA 1GV0A 3O03A 4G2NA 3RASA 3FHLA 1BHSA 1N1EA 1E7QA 5ER6A 1I33A 2XOXA 3KXDA 3WQRA 4FS3A 3OM9A 1R4NA 5KJ1A 4LMPA 1DSSG 2DTDA 1SB9A 2YV2A 3VKUA 4CV2A 1EE9A 5EQFA 3GEMA 1YDEA 1Y5MA 1NWCA 1JLLA 2VYVA 1UZNA 4AJOA 3KSDO 1NP3A 2VYND 3F5QA 3IQDB 4NJMA 4I5GA 3GZNA 1BVRA 4QX6A 3W4IA 1A7KA 3RIHA 4HFNA 3ZHYA 4S1VA 4UUMA 5FI3A 1ENOA 1E7MA 1J49A 2Y0CA 3HWRA 5CFZA 3BTOA 1SO8A 4CUJA 5IDXA 3PLNA 4GX5A 5ITVA 1KIFA 2EHDA 2X5JO 4DIBA 4J6FA 1FXSA 2DTXA 5C7LO 1PR9A 1HTBA 4NFSA 4NFYA 5KJFA 2AEFA 2NADA 5G0TA 1PQUA 5T64A 4DC0A 3B1FA 4R54A 1HSZA 5TJ9A 1BTOA 1CETA
chains in the Genus database with same CATH superfamily
2NO7A 4XR4A 2FYTA 3L84A 3HJNA 3MA0A 5KJ6A 2HA2A 2NXJA 4QUHA 4DCPA 3JALA 4EKIA 1P44A 2QZSA 5F4BA 2A9KA 4RKYA 2QLLA 4MWZA 3UQZA 3OCYA 3REQB 2H59A 5KYYB 1MXFA 3MYRA 3ZCQA 1NWHA 1WQ1R 2CMHA 1SUEA 2OGTA 4ENUA 3QRWA 1JTVA 4YXWA 3HCAA 4YP0A 2VN8A 2ATCA 2OR3A 3KE9A 3OIUA 1U7ZA 3G7SA 1FB5A 4LQDA 3VRHA 3T5GA 4XVUA 4KVAA 5CYGA 2XVXA 1D2MA 4BLWA 1BS9A 3RGGA 2Y1XA 4M7RA 3ZCTA 4UCQA 3TZBA 5AJZA 1JQDA 3FPHA 2BLLA 2VJCA 4AMZA 5I9SA 4ER7A 2XRZA 1C1DA 1QHIA 2HH9A 5ALHA 1K27A 1UBSB 1MAUA 3DOHA 3DNMA 4G5RA 1JJFA 3VZPA 4AL4A 1F38A 1X77A 5TDHA 3V3KA 1N6IA 3G0HA 1PEDA 2R1UA 2X8JB 2KYRA 4MYUA 2WJJA 4Z7NB 3QOYA 1N1DA 3OQJA 2C8JA 3OJXA 2DY1A 2Z2JA 1U5CA 1SG9A 5JHHB 4CR8A 2LW7A 1N7GA 1LF0A 4MKIA 4YWHA 4AWAA 1K8QA 3WFZA 4CIYA 3CVYA 1LLQA 2IS2A 4P35A 3VO2A 3C3WA 3ONNA 4UDOA 4QU8A 1DBPA 4I4NA 4URZR 4GM1A 2XNCA 4PLFA 3UMGA 4FN4A 4CDMA 4G0PA 3VUFA 3I4LA 4WK2B 4BO4A 4YV2A 3FFBA 4IIDA 3KKPA 1JN0A 1HDZA 5AKKA 3PNVA 3TCXB 2LUOA 1PJBA 2H06A 5AKGA 2IUYA 3FDXA 1JBQA 4MLDA 4IDOA 1JBKA 1U3VA 4I3GA 3HCNA 5EKDA 1L4UA 1KFKB 4DGSA 2FZGA 1JLLB 1J4AA 2O8EA 2O1SA 2ZRFA 3L7DA 1XJWA 4QYXA 1TCBA 2LTAA 2ANBA 5FUXA 4L73A 4JBNA 2O48X 4NJMB 5BV0A 2AZXA 1B76A 1P9WA 4LAFA 4Q47A 1X0VA 1P0FA 4OHWA 2CF5A 1JFRA 1VFPA 5EMNA 3COVA 2QLJA 4JUCA 4BQIA 5A5GA 5FL7A 3JYHA 3Q12A 5DW0A 2AHOA 3P9CA 4WBNB 4IXNA 4C03A 3DVSX 3DTVD 3QHAA 4TMWA 1RAAA 2PEZA 4DNFA 3V4SA 1QNFA 2DMRA 3TR5A 3ZHCA 1TC1A 4ZTUB 4KQFA 4J4BA 3UK2A 1SXPA 2ES4A 4C0JA 1EGHA 4M36A 5I4BA 1J1ZA 1Z0SA 2PO5A 4RPKA 1FUKA 3TNDA 1G6KA 4BB5A 4F1WA 1ICIA 2F62A 1M2EA 3B3GA 2BI4A 1VCHA 2OC9A 1B6TA 2Y1WA 2Z5GA 2XDQA 3HACA 2R6ZA 4CWAA 1U0BB 1J2TA 4TGLA 2R1TA 2YMMA 3ZQKA 3P9SA 3FNBA 1MO4A 3AR2A 1XD9A 3EXG1 3BULA 3ND6A 3EVGA 2K2WA 3BA1A 3MT8A 1IEVA 1VHWA 4MIKA 4E5SA 4L5YA 1W6RA 3RVOA 4UUOA 3CCBA 3KZCA 1UIRA 3VR2A 2R00A 3JYLA 3ZGLA 1IU9A 1NMXA 1OROA 1VRCA 4YJDA 3ICPA 4YPVA 1TCCA 1BRTA 1QOQB 2E4WA 1R9GA 1Z7GA 2CMFA 1QZZA 2AF3C 1SOAA 2CY0A 1EFHA 2HA7A 2RSLA 3B1WA 3IHTA 1G6Q1 3KX2A 4HHEA 3UA3A 1E1MA 4ZEVA 1TCAA 3GRAA 3LPLA 5FPHA 3RDPA 5JS6A 4F60A 4L72A 5DE3A 2CK3D 3U49A 1NYRA 1DUIA 5JJBA 1WETA 2PDAA 4D9IA 5AUPB 2J5RA 5E4TA 4ND7A 3O3MB 3WJ2A 1MW9X 1Z7EA 3DLAA 3FFAA 1EJBA 2X0FA 3VHQA 4JWKA 4MKXA 2G4LA 1HM5A 3GMDA 3V8MA 4JJ7A 3ZDEA 3AR6A 1VPDA 1KE2A 5LD2C 2LCIA 4RHEA 2C4NA 4OX9B 5KWIA 1PVOA 5IEBA 1F5SA 4GLOA 3IEVA 3RIYA 3KJQA 4JR2A 5HOEA 3ZE2B 4KK3A 1NLMA 1TKAA 4FDAA 4QUEA 4PRKA 2FUG1 3GEIA 2G5CA 3HU3A 3ROZA 3W5DA 4MAMA 4AICA 5BUQA 1PIWA 4NVRA 4BPRA 4I1UA 5JD5A 1P7PA 1Y3IA 3SF0A 3E9QA 2WUDA 2QN8A 3N58A 5CT8A 4YJ3A 3G1UA 5IFLA 3ROFA 2FZEA 721PA 1GTG1 3FY4A 2B0CA 1X1DA 4AS1A 1DWPA 3L1UA 3NIDB 1XMVA 2CW5A 1B8UA 3AW9A 3K35A 2BEWA 2EHJA 3C70A 2ZXEA 1ISMA 2OCGA 2GPAA 2JIQA 3LQKA 3QJ5A 2FCRA 1E64A 4MPJA 4V0ME 4B6RA 4PYIA 3KWFA 2G1KA 1LTHR 1JKFA 3CYFA 1NJGA 1LB1B 2BTQB 3EEIA 3EJ6A 3ER6A 3JRWA 4N5HX 4RXTA 3JS5A 3X2FA 4YRNA 3EPJA 3L4BA 2E49A 3HUDA 2X9NA 4MOWA 2XD9A 4GPZA 4IDHA 4HXFB 2DETA 3JV7A 3MZ0A 5CAEA 2EFHB 2YRXA 4HMQA 5DYTA 4WESB 1BMFD 2PZFA 4RCVA 4YRPA 1MENA 2A58A 2D3WA 3FDZA 2HN9A 2WD7B 1IZ9A 2KPOA 3G0IA 1DAGA 4UBMA 2B4KA 4DYHA 5IKXA 4GUAA 1GNVA 5DU2A 3QKIA 4KR7A 3GNTA 4NI5A 5F78A 5CT6A 3C3MA 4WN3A 3IVCA 1B23P 4R8VA 5AUQA 4CDRA 2OV6A 4FHDA 3JWGA 4KN5A 1ZJ6A 1VL5A 1MAWA 2O3RA 2ZQ5A 1ESMA 1CKEA 3DLTA 5BSEA 4HDRA 5IULC 2HGSA 5BN4B 4QE3A 3KZOA 2O6LA 5LLDA 4OQLA 3NH9A 3GP8A 4E30A 1CVIA 5E6SB 3X1KA 1U4NA 1Z28A 4PHFA 1T1IA 5DCLA 1O08A 1WD7A 5GZ1A 1K7XB 3I6YA 3NETA 4F1JA 1DELA 1Y89A 3TG2A 1CY0A 1BFDA 1E1RA 1MC4A 1TYEB 4JC0A 3F71A 2ODBA 4AN1A 3U6BA 4MW7A 2QTFA 3UV7A 1CUUA 1FFWA 2PVCA 1DKMA 2Q0SA 1QGED 2AX3A 3PJGA 1FLAA 1N75A 2NP6A 2EP7A 1EAMA 2HTEA 3UWPA 1QYDA 1Z26A 1GWNA 5LB2A 2W90A 5KZMB 1PR4A 3E35A 4IGFA 4CLXA 1ECBA 4RQBA 4WA8A 4M0MA 2OP0A 2OBFA 1NMSA 2AF4C 3CCCA 2DBRA 4TTTS 3I04A 1YJAA 3NGXA 1QWSA 1M3SA 3P9XA 4TUYA 4JENA 4URFA 1OMOA 3ZPXA 2NPOA 3QBEA 1YJQA 3QXSA 1H1DA 4PFJA 4HWOA 3VO9A 4B48A 4CMGA 3OE4A 5DNCA 1KO4A 4EZIA 2QQFA 4JEHA 4UM7A 5JJ5A 1KU6A 4FFWA 4L28A 1M2FA 4CQJA 1U4SA 1VPLA 2EW2A 4KMRA 3IOCA 4ZHQA 6ABPA 1TUGA 3QELB 4KNVA 4NYMR 3EXEB 4Z0TA 1C9NA 2QRKA 4D0NA 5K05A 3N3AC 3G2PA 2G6TA 1RWWA 1Z17A 2VNHA 3DVQX 2JIDA 3D6UA 2WAOA 2VJMB 3IGFA 1NXOA 1X3SA 2BBSA 3H2YA 4OXXA 4PE5B 4WGGA 5DNDA 1NJFA 4PG4A 3VV3A 4DHEA 1X80B 3QBVA 2GZAA 2X1HA 4LWPA 4LJ7A 4C29A 3D2CA 5EHNA 2IUUA 3A2LA 1KJZA 1QG0A 1FMCA 2B5OA 2EERA 2GUWA 1Y1SA 4I50F 2XT0A 3TIIA 2ZUVA 4DUGD 5K09A 3TXXA 4QBFA 3GJQA 1S0UA 3B48A 1OIVA 3M6UA 4GX0A 3D8NA 4JU8A 1V2HE 4GSLA 2Z6UA 4WY5A 4XB1A 3W5JA 4Y9RA 4F91B 2QG9A 3NHSA 1NMEA 2VFAA 2VPYA 1DOAA 1ZD2P 3DWEX 5ALFA 1BQEA 2WIAA 3NUQA 5ERYA 4E0BA 3VJRA 4CYMA 1P4AA 3DOFA 4LDAA 2ZI4A 1CY1A 3FBWA 1GL3A 1B2LA 1Q1QA 3BORA 3O9ZA 2QD3A 3QE2A 4F2HA 3K70C 1F60A 3QVOA 4XXHA 2Q2QA 1L4MA 4MGIR 2P8SA 1E6KA 2ZIGA 1RAHA 4PYQA 4OM8A 5HUHA 3QKRA 3CX3A 2QBYA 2C4TA 2GCNA 3EIWA 4Z53A 1IHPA 2V0NA 3DBRB 1XD2A 4FN5A 4KX5A 2VP3A 3ESCA 5DM2A 1ZZEA 5THKA 2J3MA 3BFVA 3T5DA 5LOVB 1INLA 4E14A 2OKGA 4IDQA 5F2OA 3TTTA 3QE3A 2CEKA 3S0JA 4KDFA 1DVRA 4ZV7A 2PT9A 1K3UB 1YT5A 2VLBA 3V5NA 1XCGB 3DCYA 4YGYA 3QUAA 2W00A 1SH7A 2J5BA 3PK0A 3T7IA 1RYNA 3E2MA 3N8IA 5BV7A 1P0IA 4PU0A 1GYPA 5JDCC 3L4KA 1AT1A 4E1BA 4D4LA 5K8UA 2QROA 3RS8A 3ZEIA 1WPXA 3PT5A 1OH7A 4Z9FA 4XUGB 5C18A 1YBAA 3FE2A 4G8BA 5DWVA 4EHFA 3AHCA 4NWIA 1EFCA 5DBOA 2VK1A 4IS3A 1GXSA 1XE3A 4OHPA 5IJ9A 3GOQA 3RI3A 4GFDA 1AUVA 4KXYA 4EZEA 3CVOA 2HX1A 5FOSA 1QK3A 5JVDF 3NRCA 3PE4A 4DZRA 1AX9A 2HEIA 1NNEA 4LFBB 4GD3Q 2Q9UA 1FVOA 5M29A 1RWVA 4G1CA 1N3LA 4UAVA 1KWKA 3TSWA 2PKQP 1W75A 1X1SA 4N39A 1DWOA 1R10A 4GQIA 4IFBA 1CY8A 1OY1A 2FGJA 2QQ0A 4A1OA 3STYA 4YMIA 4Q1BA 3L9WA 4HGOA 4LRYA 1KYQA 3VOTA 5EIEA 5LQDA 2QM0A 1X94A 3ZH9B 4CU5A 1LC0A 2C9OA 1BA2A 3T9BA 5HK8A 1HDEA 4Q3LA 3G2KA 1I1OA 3QVWA 1MH1A 4FVTA 4XGNA 3PC6A 2FVYA 3PA6A 4TQGA 4PHCA 3NWEA 4KFUA 3DF7A 1UPTA 3QLEA 5P21A 2NNLD 4M53A 3GCDA 1C80A 4W8OA 1ECLA 1CPYA 2QTCA 3U0BA 2GTIA 1DG1G 5KTOA 4HVLA 1G42A 1VMIA 3TINA 1IM5A 1HNWB 1QSGA 1EVLA 4KQ9A 3M6LA 1N2CB 2LDXA 4CMIA 5B57C 4OLAA 3KLBA 4QVKA 1X9IA 5DO9A 2G04A 1KL7A 3DA8A 4X64B 1RU3A 4TTSA 1NIJA 1NVAA 3P0RA 4WX2B 1OFVA 4UHFA 1GT6A 3QLJA 4KIUA 5KOHA 2IWHA 1SXIA 5D87A 3SZGA 3AEKA 2ZSJA 3HJRA 2NP7A 4PBSA 2BZ1A 2F1RA 3UFXB 3RUFA 5SV2A 4JEIA 1QP0A 1JHAA 2RE8A 3NHYA 4NK4A 1D6NA 4CV1A 4ITRC 1YZTA 2C8KA 2QYHA 3D5EA 3LQRA 1BFKA 4HRVA 4PGMA 3EGDA 4QPPA 1ITZA 1I1NA 1KHHA 2DLDA 1NN1A 4ESOA 3B6IA 1CFZA 2CBGA 3NUGA 3KAJA 1KTVA 3OKPA 1EK1A 1XEFA 2SICE 2EFJA 2MOKA 4QO7A 4RSRA 3K5HA 3OU7A 3TX6A 3ZV5A 2NM0A 3PPVA 1NUHA 2VDRB 4KXNA 4PS1A 4EMUA 5CBPB 3R0ZA 4B31A 1ORVA 4TTQA 3UC5A 3VPGA 2QZJA 4QFMA 1YRAA 2DHDA 1Y3BE 4X20A 4A0RA 4RJLA 4B4KA 3LRXA 4QOGA 5GVSA 4DQDA 1E3MA 3JD1A 3SS8A 1QPBA 6GPBA 1H4VB 4G0YA 2Y67A 3L7MA 4CLRB 4OQYA 3ZWCA 1YK0A 5F4ZA 3DBHB 4DJFC 4UM8B 4AS2A 3QITA 4MS1B 2W93A 2Q3JA 2HBZA 2AJBA 4D4KA 3DBLA 3HWWA 1GGKA 3MCAA 4IAOA 1T5IA 1T9CA 1Q6YA 3G5AA 4L02A 3WLIA 2JHPA 4EATA 2G25A 2IEAA 2YYYA 4IH4A 3R75A 1L7XA 4OGKA 2JANA 4PZCA 3FWZA 3MAGA 4LJ6A 3B2EA 4IOLA 4F0JA 7ADHA 4OBXA 4Z4FA 3RUEA 3VA7A 1SWWA 1VG0B 3PUYA 4MH0R 4MV1A 3B8HA 4CHGA 1ZQ9A 3IMKA 4E5DA 2WQ6A 5ICFA 9LDTA 4GPEA 4C5BA 1J0XO 3RRFA 1YNSA 4UM9D 1ONOA 1V5WA 5TQ2A 1YZYA 3QNMA 3SM3A 3I52A 4CM5A 5KHLB 2CT8A 3UT0A 2OLKA 3E4CA 2DCUA 5CW2A 4DDMA 4G0XA 1U2GA 5D00A 2XMZA 1US8A 1M9NA 1UFKA 4YVFA 2WWFA 1TCUA 1GRCA 3IVAA 4IMPA 2VP4A 2WU1A 3IDQA 2ECPA 3K5PA 2ID9A 4W5RA 1C8BA 3UIEA 3BQNB 2BFAA 3FVTA 2PYZA 3C8MA 3BVPA 3EZNA 3QVUA 4MWOA 2QN6A 1OTHA 2ZJOA 2BJWA 2VO1A 3EBPA 4P33A 1VMAA 1XDDA 4P08A 4F3YA 3IMFA 1NXVA 4DQLA 4FW9A 2JAWA 5G40A 2H9YA 1WM1A 4P3KA 1E8DA 5JFGA 3ZDAA 2WFLB 3COWA 2QUKA 1H2WA 5C46F 1FX1A 2R2AA 4KXWA 4DLWA 4I19A 3QLVC 1EFRD 3NIBA 4LCEA 3JCZA 4KCGA 1HTTA 4O4LA 4P4SB 3QLUC 1IWBB 1A5TA 4MQBA 4UXHA 4XGRA 1JRLA 2DVMA 3EVCA 4RIIA 1QRTA 3VX4A 2QX8A 4M49A 2F3QA 5C53B 2QZ9A 3HBFA 4MUEA 1KDPA 2GJSA 3T3EA 4B0OA 4AYTA 4P0TA 4M1MA 2YFQA 3O8NA 4GH5A 3AZQA 4IMRA 4JSYA 3SD7A 2R84A 4RK1A 1BA3A 3CONA 2GZRA 4JFAA 4N82A 1V95A 3FPCA 4UM5A 4XYMA 4CG0A 4B3JA 4DQVA 4G89A 3FUWA 2B4TO 4MI6A 3V48A 3JZIA 2AUMA 2BFDA 4K1XA 4L50A 4K9RA 3NOVA 4BKQA 3QV1A 1Q22A 2REQB 2Q6TA 2ZSIA 4ZJUA 3A05A 3JVVA 5LYYA 1PNVA 3LZDA 4C7VA 2KHZA 2R8BA 3A4VA 1UF9A 1DGQA 3A1WA 3NHZA 2EP5A 3GLGA 4EEXA 2QRMA 2JD2A 5IU6A 2AVDA 2YC4C 2V7TA 4ILKA 1Q91A 1ST3A 1EUDB 4LVOA 5CVJA 5JCJD 1J33A 3EVEA 5FBKA 3KT8A 3OLVA 3WB2A 1TF5A 1Y3FE 1ZIPA 2Q21A 4N9WA 3EBOA 2ZETA 1R6AA 3E8SA 3DTVA 3CX4A 1NONA 3GFOA 1UMBB 3L6CA 3NANA 4ZEXA 2P5UA 5JMPA 5J4LA 2Q4DA 1JTFA 1RXIA 2YJ6A 2Y92A 3HJGA 4GC9A 3VOSA 5FORA 4PQRA 3BXEA 1CULC 2HSEA 3L0OA 1OJLA 5JY1A 4OHBA 1SU8A 4JSRA 4KQ2A 1VJCA 3BZUA 1BDJA 1A2BA 2O8NA 2PZLA 2W11A 3JAKB 1UKAA 4FIDA 4LYDA 4HX2A 1JZQA 1KZ6A 2CUTA 2P67A 4HOYA 3K5WA 5CNKA 3GEBA 4QDJA 3TZLA 4M60A 2RONA 4Z4HA 1E3LA 1JHUA 2DPXA 2XBMA 2JI4A 3LW7A 2PSEA 1E2BA 3RJZA 4UVEA 1N9GB 1J9GA 4AB1A 1L7OA 3RYCA 1XTUA 1XN1A 5IKMA 5A4FS 3S2GA 4M1WA 2P3SA 3N05A 2O8VA 5L4SA 3I9MA 1MG0A 3DR3A 4KQHA 1VE9A 4OGGA 5DKFA 1MT3A 4DR3B 2EL7A 5ILQA 2I54A 1UH5A 5AW2A 1YH3A 4DMFA 2E2WA 2H4WA 4FM9A 1Z3CA 2RGNC 3BXFA 1NBOA 4L4XA 5EJ9A 4JBIA 1L3BA 4G56A 3FF4A 3AO0B 3KO8A 2DRIA 1ZN9A 2FPGA 621PA 4Z2AA 3DPIA 1JQBA 2ZREA 1KY2A 1PEYA 1K9SA 3TQSA 1RKQA 2CZQA 3Q8KA 1U0HC 2F9FA 5L3RA 3QXJA 3ZOKA 4B6PA 1QIHA 3PX3A 1YOVB 1YC2A 2YRFA 4PCLA 3DLPX 1ZD1A 1D07A 5C80A 4NKRA 3TSCA 4X00A 4BNDB 2B92A 2PWZA 2QDXA 1J8FA 3D3WB 4G67A 5DFAA 4HX5A 2KWIA 1J25A 4F3RA 3TMAA 5C5DA 2QD1A 3PZBA 1OXXK 2H8GA 3H6GA 2RB4A 3KU4A 1COZA 3L5KA 4C78A 5FV4A 1BSVA 2O8FA 3UV6A 3E9ZA 4G1UC 2HADA 4HY3A 2ZFUA 1WY7A 4JLNA 3ZUPA 2CJWA 1EGAA 1GZ5A 2P3LA 2PPVA 3FFXA 3L6UA 3N2IA 4MVJM 5LC1A 2HSJA 3W1VA 5IK2D 3F9CA 2FMXA 3I9LA 2YQ4A 2PL1A 3W04A 3ACBA 4GI2A 4FFPA 3YASA 1SU6A 1JI0A 2L82A 1DJPA 4IXTA 4Z2YA 1WUIS 1RQXA 3RU3A 1AO3A 2Z8ZA 2DBQA 4I5EA 5FI5A 4DEVA 2V6FA 2R65A 2YDYA 5FPQA 2CXUA 3HJBA 4LGVA 4J90A 4MICA 4YAJA 5IM4F 3HXKA 1R9MA 3AVPA 5AJYA 3WHPA 1SUSA 1OOEA 1RTTA 4H7DA 4KPFC 2B1IA 1LKZA 4ZVRA 1L8AA 4GLFA 5BNTA 1WSBA 3NYQA 5JATA 2WOJA 1RD4A 1YGPA 2BEUA 1P2TA 3NRJA 3KD2A 1ZCFA 3W2TA 5ITZB 4M37A 2W2LD 5KQPA 3NNSA 5K3EA 4F93B 1FYEA 5WRFA 1BMFA 3HNRA 3PXUA 3KTDA 3U3RA 4NJOA 3UCFA 2O8CA 4ZAXA 3JQAD 4OOEA 4R3UC 2G80A 4BN5A 1XMQB 3TWOA 1JFTA 2XODA 1PT6A 1PZGA 2PU5A 4ZMRA 1UBOS 3WQSB 3LU1A 4HNHA 1JG2A 1VJGA 3RVNA 3MMNA 4P4GA 1Y4UA 5A3QA 4PYLA 2ZRCA 4JJIA 1GUBA 4LK2A 3FPGA 3U48A 3DV0A 3EB9A 2I5PO 3IELA 2YJZA 2F1JA 3FLMA 3GLIE 1I3KA 2B8JA 3GCGA 1QG2A 1Q7BA 2QT1A 3R20A 4TRNA 3ZI0A 5LVAA 3RC8A 2JFHA 3KFXA 3DW1X 3EVTA 1BCSB 2WAAA 5J40A 5EZYA 1Z0AA 1XOIA 3Q9UA 4MUHA 1E5DA 1GGVA 4UREA 1RWOA 2QAIA 3GJ5A 4B8WA 2GKSA 4QUBA 1EHIA 2BMWA 3TNJA 1N2BA 1L4FA 4HAUA 2H48A 1NF8A 1T6ZA 4WKPA 5H5JA 3RD5A 1M75A 1L5MA 3TRHA 4A0QA 4RTOA 4OCZA 4QXRA 3CR3C 4X1KA 5L3ZA 1GGEA 3M6MD 5AKJA 2JJYA 3V8RA 2B30A 4EFDA 5AKEA 1O8BA 3OETA 2HGZA 1D5WA 3UGKA 2BKXA 3UW1A 3WNVA 4B3XA 3QVGA 4BQOA 5T7BA 3CZ9A 3A4MA 3BQ9A 3X1ZA 2AOVA 2YWGA 1SKQA 2Z95A 2PD6A 3OTHA 5E6RB 2OCIA 4MMYB 3H84A 3JQRA 5F98A 1QX3A 2HAEA 4KGVA 2W5UA 3OD1A 4DVJA 4DV2B 4B3SB 4CG1A 5LZ2A 3AF1A 4WBNF 5IVKA 1Q6ZA 1ODCA 3V46A 2O54A 4BMCA 1ODSA 4ZZ3A 2WIGA 4H7HA 5I7AA 2VQ3A 1J1UA 3E8MA 2R44A 1IOLA 3DMTC 4H0FA 1GNTA 3WKEA 1TJPB 5HF8A 1IDOA 3RTAA 5KC9A 4K28A 4H1HA 5KOJB 1J39A 1DB3A 1SD1A 3PGLA 2VDLB 3EVDA 2C1ZA 5L3VA 2GTPA 4XPZA 2R7AA 1FRNA 4UD2A 1O77A 5CYFA 5KVQA 1RJGA 3WZMA 4LY6A 1UBGA 3OJ0A 5ALDA 3C6YA 2C0QA 2O52A 1ZEJA 1FPQA 1J0DA 1G64A 3AHFA 3JQFA 1O4WA 1YGYA 5TJHA 2X4DA 4PF1A 4WY8A 3QVVA 2XVAA 3GO4A 4FBMA 1GU0A 4WCDA 4BN4A 2ZTMA 4DUGA 2ZYTX 3G6WA 3K0SA 1QPZA 3PXCX 1LUAA 5AO9A 3ORFA 1UK7A 3R6LA 5H0IA 3TEFA 4BNGA 1FQWA 4ML3A 1G7CA 1ZIYA 2OHHA 1TD9A 3WGQA 4YUXA 3WQBA 3DZIA 4B35A 5BN3B 3ENNA 1I4DD 1M2VA 3C39A 3ND7A 3Q3HA 4BNNA 2FQXA 4RMNA 4E22A 3CCFA 2C9CA 3QVKA 3GU3A 2VAXA 4NE7A 2FXVA 4ZANA 3PG5A 2HIHA 1QU2A 3BILA 2VZ8A 5ALXA 2NYRA 3N9IA 4KEAA 3UBMA 5HKKD 1AKQA 2J1LA 2WA2A 1HDRA 2PSFA 1ZRSA 4OHMA 2UZ3A 1NJ6A 3M3HA 3TDMA 2P2CA 2K7ZA 4L76A 2O8BA 1H93A 3GGGA 1N2CE 2O2EA 3G8BA 2GT1A 2H16A 3UWKA 2QP3A 3BSYA 3PHHA 1JDVA 4DBLE 3QH4A 4B8ZA 2QBYB 4WKOA 1MW8X 1M2JA 4MZXA 1LPNA 3AI1A 3KR1A 4CL8A 5B58C 2Y6UA 4FR5A 3GFRA 3WIUA 3ENKA 5DM70 1ZNQO 2P2YA 3F6RA 1B4DA 1NXSA 1YAJA 2VOJA 4KGXA 3HCCA 2EF1A 2HWXA 3BD6A 4LDRA 3FNEA 2LBPA 1OPXA 3I3OA 2ERXA 2I7VA 3C8UA 1PJ3A 1V47A 2ONCA 2Z4TA 4HV4A 2DKNA 3NZEA 4KBYA 1OYWA 1Z45A 4HWPA 3FGOA 2WVHA 1VE5A 3PNMA 1KSHA 2A5DA 1R37A 4U02A 4ZV9A 3T9DA 3GROA 4EZBA 1FCJA 1H42A 3V1KA 1GFWA 1ODLA 4XA8A 3HBMA 1MA3A 2GB4A 3ANXA 2Z3WA 2EG5A 2VHYA 4FDVA 4TWAA 4B3RB 4INZA 1WZNA 2C1EA 1YO6A 2W2MA 2FZCA 3WV5A 2ACWA 1HORA 4HQRA 1M73E 4N0QA 2XTZA 1YKSA 4CEHA 3BRWD 4RORA 5EXEA 3PP8A 2WJ3A 4RY2A 5C1DA 1U28C 3THYB 1QRAA 1B8NA 5HS6A 1LPMA 2RFLA 3QENA 4C4PA 2E4YA 4QWWA 4RIGA 3WRVA 2PSHA 1YL5A 3O74A 1FS6A 2GUGA 4GRAA 1SEPA 3T06B 4LPSA 1H2ZA 1W9MA 3O1HB 2WFZA 4Y2SA 1C30B 2VYVD 3K1JA 1HPLA 4OUKX 4BAUA 1CUGA 3CIFA 5L3SA 1BE1A 1YB6A 5E4FA 4DOMA 4P7JA 1SXGA 4PN7A 5JBIA 1G60A 3N2EA 1LRJA 1Z39A 4BGVA 5I5EA 3L7IA 3KCNA 2VHQA 5A9TA 1KZ1A 1SUFA 1PQ4A 5HPYB 2J67A 1OI2A 2IHVA 4PLZA 3ZD6A 2DERA 5HM8A 2AZDA 1E2LA 4JAVC 1X8JA 5BVHA 1U90A 3EXIA 4GOJA 2O7SA 2Z1MA 3PKJA 4P22A 5EXDA 2VJAA 2WB4A 1QORA 2YHSA 2HA5A 4QDKA 1E1CB 3ORRA 4EELA 1ISIA 4BWFB 1TM3E 4J3JA 1N5LA 2WWHA 3L0YA 4JI3B 2J3JA 2PZGA 4Z7OB 1R64A 4KIJA 2ZG6A 2BJVA 3QF4B 1LNQA 4Y7CA 4Q05A 4CMEC 4R9SA 2CCGA 4YRQA 2QT9A 5DP1A 3RANA 1UZAA 3VNQA 3D3NA 1YUMA 4ZVVA 3TFOA 5AW8A 3LZCA 4J1TA 5C8XA 3MTAA 1EM6A 1LFAA 1QZUA 1YVDA 1IK6A 4IDAA 2GA8A 3K71B 3AUSA 4B4DA 2IXBA 4LXQA 1Q17A 5M3BA 2QW0X 3ST7A 5FR1A 3ER9A 5EQJB 5JTTA 1SBCA 1Z9BA 2APJA 4LZZA 5AJVB 2DZDA 4C1NA 3ROQA 1UXIA 4LOAA 5HKOA 1EWRA 2VP6A 2X6QA 4WLOA 5JCZA 3CGGA 3MILA 1ES9A 4YJFA 3ZK9A 1AZLA 3WLTA 2BFBA 3M4ZA 5DYYA 2P75A 3V7WA 5C5IA 4KITB 1YBHA 4L75A 3CISA 1Y80A 3TE7A 2BHRA 1UBEA 4HD8A 2VA9A 4R69A 2IY9A 3W4KA 4R7GA 4DR6B 4MPTA 3AKEA 1JR6A 5A3SA 4DMKA 1Z2OX 4JZKA 1FP4B 3SY8A 3TLCA 1REQA 3MLEA 4W82A 2PCLA 4B2LA 5JS8A 4RF3A 4QXQA 4OSOA 2GPSA 3N0WA 4ARZB 1ZDMA 3PC8A 4G3XA 4O6VA 5FFFA 1NF3A 3RB8A 4DDKA 2RBKA 1I14A 4OFZA 4YV1A 2ZRLA 4UEWA 1R0SA 4HUQB 1LWOA 4EW3A 1BDBA 1JU4A 4Z3OA 3R8FA 4UJ5A 3QUCA 1THZA 2N75A 3IJEB 1IY0A 5DULA 5JR3A 2FEPA 3JVIA 4DIEA 5JC8A 2NUBA 2QDKA 2J6IA 3UN1A 5BN5B 4B75A 3EWSA 3LIIA 4G5GA 2G7MC 3RRYA 3FVWA 5CDYA 4IQ0A 5JVDA 2EKZA 1J99A 3M83A 5DXAA 3T1OA 1V8FA 2UYOA 4NBTA 1NDQA 4N8SA 2XT6A 3BWYA 4UU0A 5LOVF 3GXBA 3SWWA 2Z9BA 5E7IA 5FT9A 3TOCA 3ZVNA 3R9XA 4YN3A 3QTLA 1B8VA 2ZTSA 3B3FA 3ZZUA 4DIUA 1H3NA 1W93A 4JEUA 1BXRA 1LPSA 3CVJA 2A94A 2O1WA 1VG9B 2R7NA 3OFND 3NASA 1H8HD 3I58A 1H66A 4QYIB 4BLVA 2C2GA 5CD1A 4MCAA 1OGIA 1IBLB 3AXTA 1DEKA 2FFAA 4ABTA 4R9RA 3RKRA 5F5NA 2WM8A 1YVUA 2YHAA 1FMFA 1T6YA 1ODFA 4CT5A 3L0BA 1OLSB 4TLAA 2IV2X 4YLYA 3PNBA 5TPWA 3CBGA 3IEPA 2NT4A 4ZT5A 1QO9A 3BH0A 2FB9A 3MWDA 2X3UA 4U2CA 4WBXC 4LTDA 5CXXA 1N8TA 1OZHA 2ABWA 5FFNA 5EIXA 3MPUA 1H6BA 1QGUA 2IRWA 4C87A 1ZMRA 4B3TB 1Y1PA 2QXUA 1Y9ZA 2WTAA 3RABA 2EGGA 4A0HA 1A7JA 4ZFNA 2IDKA 4MRAA 4YBRA 1ZZGA 2LWIA 4N1AA 3VC7A 2VTBA 1RQNA 3AYZB 1IQPA 4RABA 3T9CA 4QHTA 1GVNB 3QYPA 3G9QA 1KMCA 3KKOA 2QN3A 2JEOA 5K0SA 2MSLA 3EPRA 4MKHA 5JAMA 3V34A 4PXAA 3W7AA 4BNYA 2XITA 1C9JA 1H5NA 3L77A 3I34X 3A11A 4DIDA 5HDBB 2R8RA 2RGCA 2PWYA 1FNSA 2XI4A 4YRMA 2B99A 4WN9B 3H1EA 4YUYA 4AIRA 1VJRA 3FA2A 2FDXA 3B7GA 4E5YA 1TLTA 5BWNA 2WIDA 3TI7A 2ZIZA 1YS7A 1Q0UA 3AFHA 3O0TA 3I45A 1HRKA 4NCXA 3UAWA 5JSUA 4TRRA 4NOLA 2I4NA 5F21A 3UFBA 5B55A 2YCLA 3FYUA 1NSFA 2IEYA 3GMSA 3SJAA 5B2EA 4HAIA 4JGGA 4EKGA 4GYWA 5KSPA 3EDRA 4MYSA 3TMYA 1FFBA 1V3UA 3PE6A 1BW9A 4WXEA 5JXJA 4Q12A 3PX7A 2W7TA 2WZCA 3IUYA 3WYAA 4KQMA 1EFDN 2GILA 2H2DA 1FNNA 5EJAA 1JLHA 4ZT6A 5EJEA 4MW4A 4MLPA 2UZ1B 2MYTA 3ZTYA 1JHQA 1TPYA 2ZQYA 2J3LA 3NNDA 3AF3A 1YJ5A 2KM1A 2DKOA 1Y4SA 1S6YA 1EUYA 5TQJA 1MEEA 4WOPA 3GUZA 4A8JA 1WY5A 3L43A 2G9UA 1I4LD 1NN5A 2C82A 1M6VA 4JA2A 1ZMXA 3HL0A 4ICIA 3UICA 4IQ4A 1Y5RA 5H59A 3C3PA 1IN7A 1ADJA 5IC5A 1U2GC 3RNOA 4KXVA 3U3XA 1AK2A 1G0NA 3PDHA 3VDNB 2OGUA 3JVUA 2V7UA 2YINC 5K4AA 5H8WA 1IATA 5F76A 3CH4B 5ALIA 5AYVA 4YYZA 4BMXA 5IYZB 1IWOA 1XVIA 4Y3UA 3ZXYA 2FPWA 2WWWA 3QEJA 5CFRA 5CH8A 4IUDS 3QQPA 3F90A 5HOQA 1W4LA 1QVVA 1XCJA 5HQTA 4ACBA 1FDUA 3F4BA 4MHTA 3EK2A 3CEMA 1EK2A 1UPBA 2FRDC 5EQDA 1YRHA 3VGJA 5K3FB 4ZZ1A 4PC3A 2TRSB 2IELA 2IDZA 2IE8A 2JJ2D 3GLKA 4XQGA 1HXHA 4QECA 5IK2A 5ES4B 2JLBA 4Z9XA 3TW8A 4BGIA 1XV5A 5M7EA 4DV5B 4Z4EA 3GN1A 1EHYA 2O2YA 3R2JA 3CLUC 2B1QA 4ARAA 2J9FA 2E3JA 2Q5FA 3S2ZA 5LZ4A 4ISCA 1ZAKA 2QWXA 1L1RA 1TYDE 4Z9AA 3VAZA 4G41A 1CQPA 3C3DA 4WCFA 2J45A 4CTJA 3H3XA 4UUPA 4WNYA 4LHVA 2FFRA 4JCOA 3GJYA 2OILA 1DDIA 1TO6A 2R11A 4MUIA 1TU4A 4NMLA 5B2FA 3QVJA 4NU8X 3TRJA 5BN1A 4G9BA 1P1JA 5T6BA 3VU9B 3PNOA 3MB5A 2PMFA 1SKUA 2C2HA 3I9FA 3WDMA 5AVVA 4O1IA 3ZQJA 3BXXA 4IY1A 3OZCA 1FSZA 1K5DA 4AKTA 2W0SA 1J1IA 2W2LA 1XFDA 5AJHA 4NH4A 5LP6B 1E5TA 5B4VA 3ANYB 3A3NA 4IS2A 3EDQA 3OQHA 4QUAA 3SYLA 1AHHA 3ZCPA 1V96A 3KSRA 2RJ3A 2ZYUX 4JV5B 4DMRA 3Q5DA 4Y1EA 4R9UC 2DX7A 5EPUA 2ZZKA 3NT4A 3THXB 2FCAA 2FMFA 1KAGA 2H1LA 3KQVA 4AZVA 1J8YF 4BVJA 2BZGA 1LA2A 4J1NA 4DAEA 2JCGA 4UHHA 1UKCA 1OYYA 2NG1A 3G82C 4UVHA 5F9HA 3K6SA 1IVSA 4JKYA 2J9XB 3L6EA 4Y0AA 3P9KA 4ZALA 5TF4A 2XWSA 4ZVUA 2PKWA 3DE2X 1W44A 2C9ZA 3NX4A 4W7SA 3QVLA 4MI3A 1Y1RA 1X7GA 2OV4A 3LUAA 1RJEA 3Q5EA 4RMIA 4Q9HA 1TIKA 2NV2B 1OFUA 2PFSA 3VDMA 1IZ7A 1ENZA 1X87A 3WWPA 2XWPA 4TMFA 3C7KA 4BBZA 1ZIOA 1PT8A 4LJKA 5CEEA 1RADA 3CS3A 4K8RB 3U6KA 4HFMA 1UOPA 2YUIA 1AZSC 3KLMX 3F46A 4HDSA 4EF6A 4EEKA 4JP1A 1GTSA 2PG3A 3G89A 2ORWA 5G4KB 2ZWOA 2C7GA 5IW8A 1L0BA 1NN3A 2IP1A 4ALJA 4F2DA 5KTNA 3OZEA 3RBAA 1KMNA 4FFMA 4P93A 1G66A 2C97A 1XCLA 1YV9A 4WBSA 3SHOA 4BE9A 2R1VB 3SU8A 2Y1EA 3UG7A 1C7IA 2XCSB 4G8JA 2ZTVA 4KXFB 5TPZD 1KZ9A 3F7MA 7REQA 4RWZA 4UUBA 5GONB 5KU7A 1SRRA 2FFJA 5JSZA 3LDGA 1Q0ZA 2Z8YA 2YDXA 2R6CA 5LDGA 4FLEA 2DPMA 2AW3A 1M1YB 2ET6A 4S2EA 5JS7A 3KUUA 1Y1LA 5FWNA 3SLGA 3BOSA 5ALWA 2B36A 5LKAA 1PUJA 4G65A 3I2GA 3HB1A 1RABA 1RHJA 2I6GA 4BQRA 1CRLA 1HI9A 2PXXA 6CHYA 1VCOA 4RTKA 4QASA 4WXPA 3PDWA 5CLLA 3TL3A 1ZOOA 1XG5A 1CNFA 3IESA 3D02A 3GAAA 2O4UX 1IM8A 3GN2A 2PUDA 3ICOA 3U7FB 2JBAA 4E5NA 2IX9A 3TE6A 1RLIA 2O2XA 2C0PA 3HM9A 3NONA 4B3IA 5L7TA 1PF7E 1AQJA 3HO1A 1NW9B 1D2EA 3STWA 3HBAA 3H75A 5A02A 4JIGA 4XLLA 4XUDA 4CM6A 4DCTA 1TO1E 4PC7A 3JPYA 4GKKB 3F6BX 3WWDA 3WRXA 3RVSA 5UKDA 4FOSA 4EGAA 4JELA 3VSEA 2FKAA 1XZGA 1QJ4A 1M0SA 2NO6A 2QUHA 4JC8A 3W6PA 2JLUA 3LF1A 2GF0A 4NQZA 3O4RA 1TK9A 5HKKA 2ZULA 2OCDA 1HMYA 1JIQA 5HKLA 5U4XA 4OI1A 3JRNA 4X3PA 1Y8RB 2CXTA 3IO5A 1NY6A 2VBIA 4FLFA 4IRMA 2CXPA 4RH0A 1K5GA 4GMHA 3K96A 3KKKA 5LZ5A 2C98A 4PTYA 5B3KA 1KJJA 2EFDB 2YWBA 5D51S 3HPQA 2Q4TA 4LVUA 4Q7QA 2GOYA 4PG6A 4CG2A 4CG3A 1ESZA 3A9CA 4KZPA 4MJLA 3UJPA 4KQ6A 1AM4D 4G0NA 2CFIA 4MRPA 4ND2A 4MHOA 3IODA 5KYWB 2DWUA 2NSLA 3L7NA 3QPUA 4IFTA 3X1XA 3PIRA 4FKMA 4CCAA 5KTPA 3HYNA 1PX2A 4JI5B 1XP8A 1N1GA 4XCQA 5LYJA 4C01A 1NV9A 3KUKA 5DHSA 1AZWA 2IE0A 4EQZA 1EUCA 1Q5PA 2AVNA 2WUEA 3DDHA 4Y2JA 5AKYA 5JTUA 4CM4B 5GGYA 3G2NA 4HZUB 1L7QA 3EWAA 1MH9A 1L4LA 3FJ1A 4WZBA 1XUOA 1EVYA 4UHDA 5EWLA 4BQFA 1MT0A 3AHEA 2WMYA 2CXHA 4IXWA 2XYHA 4ODIA 2QLTA 3B8EA 4MB2A 4RPCA 4EA6A 1I24A 3A3OA 1FDIA 2OZLB 4Q4JB 2KW5A