1Y60A

Structure of the tetrahydromethanopterin dependent formaldehyde-activating enzyme (fae) from methylobacterium extorquens am1 with bound 5,10-methylene tetrahydromethanopterin
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
168
structure length
168
Chain Sequence
AKITKVQVGEALVGDGNEVAHIDLIIGPRGSPAETAFCNGLVNNKHGFTSLLAVIAPNLPCKPNTLMFNKVTINDARQAVQMFGPAQHGVAMAVQDAVAEGIIPADEADDLYVLVGVFIHWEAADDAKIQKYNYEATKLSIQRAVNGEPKASVVTEQRKSATHPFAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Formaldehyde-activating enzyme fae
publication title How an enzyme binds the C1-carrier tetrahydromethanopterin: Structure of the tetrahydromethanopterin dependent formaldehyde-activating enzyme (Fae) from Methylobacterium extorquens AM1
pubmed doi rcsb
source organism Methylobacterium extorquens
molecule tags Lyase
total genus 52
structure length 168
sequence length 168
chains with identical sequence B, C, D, E
ec nomenclature ec 4.2.1.147: 5,6,7,8-tetrahydromethanopterin hydro-lyase.
pdb deposition date 2004-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08714 Fae Formaldehyde-activating enzyme (Fae)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.60 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Formaldehyde-activating enzyme 1y60A00
1Y60A 1Y5YA
chains in the Genus database with same CATH superfamily
4JI2I 1IBLE 1QZRA 5EL9A 5FLXQ 4JI4I 2VQFE 4JI7I 1R6LA 1I94I 2JE6A 1NZ0A 4RPFA 2UXCE 2PNLA 3ZKDA 4GKJI 1Z0WA 4DV4I 1UDOA 2PNMA 2WW4A 4LF9E 2ZBKB 1HNZI 3P3GA 2V8PA 2NN6A 4LCHA 1PVGA 4DPXA 4YY3I 3QT5A 2Z5BB 4AIDA 1MX0A 4DV3E 2E5LE 4AM3A 4DR6I 4HYMA 1J5EI 2GQ0A 4OKGA 1Z0BA 1Z59A 4X64E 4LF8E 5JEAE 4DV2I 1Z0EA 3ZKBA 1Z0GA 4LFBI 4IFDF 5K36A 2JEAB 4B3SE 3DD6A 2V2ZA 4YHHE 1Z5AA 4I3HA 3K17A 5C0XF 2GO4A 5GMDA 4DR2E 4DR4E 4JI0E 4DPUA 1N32E 5DRQA 2C37B 4GQUA 1XXEA 4OO1F 4BA2B 2NN6D 2NPFA 1XNQI 2BA0D 1KIJA 4DV5I 4OO1A 4DUZI 1OYSA 4Z7CA 1S4EA 1IBME 3T1HE 5C0XE 2R42A 1ZM9A 2GS8A 2PO1A 1Z5CA 1UDSA 4HACB 4LF7I 1ZXNA 4JI8E 4DPYA 5K36D 3QT8A 4LPFA 2AJ4A 1FJGE 1XNRE 2UU9I 3ZZUA 5L3JA 1XMOI 3D4JA 4DV1E 4IZJA 2J65A 1VISA 4IFDB 1USVA 2X36A 2VESA 2HHHE 3P76A 2O3ZA 3M7NG 4QNJA 5JEAC 3P06A 4LF5I 5C0XB 1Z0TA 4OO1D 1H7SA 2ZITA 1ZM3A 3J81C 4LFAE 2X7IA 4HXZA 1HK7A 3LTOA 4USMA 4U3BA 4ISAA 2J7KA 2E1RA 3NZKA 4FW9A 2Z5BA 1D6TA 4DV0I 4PU9A 5IWAI 2HFSA 5BR8E 4GKKE 3V5RA 4JI5I 1H7UA 4IZJD 3F0NA 3QT6A 4JI1I 4LFCE 2VQEI 4JI6E 2IOQA 5GMEA 2GO3A 4B3TI 4FW6A 4JI3E 2JEAA 1PKPA 1HNWI 3PS3A 4DR7E 1NHJA 4MQYA 3J80C 4J3DA 3Q1QA 1Z5BA 4DXLA 2C37A 1R6MA 4ZVIA 4NBQA 4JI2E 5JEAF 2BA1D 4DR1E 4BA2A 4X66E 4DR5E 1Y60A 2C38B 3J81Q 1IBLI 3T1YI 1H74A 4NXNI 1I94E 1VI7A 2VQFI 3GCMA 1FWKA 2DEIA 1RHYA 4PRVA 2UXCI 5FWKA 1FI4A 1ZXMA 4URLA 4FWGA 4YY3E 4HACA 5DROA 3CWVA 4DR3E 3HKMA 3JAMC 1KKHA 4DR6E 2ZM6I 4LF4E 4DV3I 2E5LI 4OZEA 1J5EE 1HR0E 1E3HA 1XMQE 1DARA 3H4LA 3OTOE 1H73A 1Y5YA 4UT4A 3J80Q 1UDNA 4LCGA 4X64I 4LF8I 2JEBB 3PYGA 4IFDA 1ZM4A 1N36E 4DV6E 4FW7A 4HY1A 4B3SI 2BR2B 2HKEA 3Q6MA 4LF6E 4JYAE 1RR9A 2NN6E 4YHHI 5C0XA 5LMNI 5LL6R 1HNXE 4R1FA 4DR4I 1Y4SA 4DR2I 2V2QA 3GMEA 4JV5I 4AQYE 2O1TA 1N32I 4MYTA 5JEAB 1N34E 3H1CA 2A2CA 2PO2B 1B62A 2HFUA 4OX9I 4K0KE 1N33E 4LOMA 3PS1A 4MU1A 1IBKE 4DUZE 5K36E 2IESA 2C39B 1Y4UA 3ZZTA 3JAMQ 2Z5CB 2PO0B 1IBMI 4UTGA 4FWHA 3PYEA 4DV7E 3Q6NA 4IFDD 2IOPA 1YHCA 3B8HA 4JI8I 2HKJA 2WNRB 3L7ZB 4PRXA 4X62E 5C0XD 1XMOE 1FJGI 2UXBE 1ELOA 1XHKA 4X65E 4DV1I 4KHPE 3QT7A 1Z0VA 4QNKA 2UUBE 2Q2EB 4DU7A 2C38A 1USUA 1PIEA 2HHHI 2V2VA 2O1VA 5DNLA 3CDIA 2BM1A 1U2RA 1EA6A 4LFAI 4B3RE 2NN6C 4AIMA 4NXME 4FW5A 5EKWA 4DUYI 4B3MI 4MYUA 2UUCI 2BV3A 1NHIA 5IWAE 2UXDI 3M85D 1H72C 3GLLA 1EI1A 4JI5E 4XTJA 2IERA 3P3CA 2PNZB 2F1DA 2V34A 1P42A 4EMDA 3B82A 4N3OA 2VQEE 5LMUI 2F4VE 5K36C 1A6FA 2JEBA 2UUAI 4LFCI 1BKNA 2VF3A 3HJCA 5DRPA 1UEKA 2BR2A 3M6AA 5A2QC 3M7ND 4JI4E 4JI7E 4IZKB 2CGEA 3J7AG 5JEAA 2OI2A 2HK3A 4FWDA 4GKJE 4DV4E 4BA1B 2EFGA 4MDTA 4P52A 3T1YE 4MU0A 4DR1I 2PO2A 1HNZE 4NXNE 4X66I 1MU5A 4DR5I 4LF9I 4OO1C 2C39A 2NN6F 2BA0G 1S16A 3WU5A 3UHMA 2Z5CA 2AE8A 2PO0A 2CVEA 4DV2E 3U1KA 3WU6A 2ZM6E 4DPWA 4LFBE 4DR3I 4FW4A 2WNRA 3L7ZA 5K36F 4LF4I 1MG7A 3P3EA 1HR0I 4LCFA 1NHHA 4DPTA 1XMQI 4JG4A 5A2QQ 3OTOI 5JEAD 1OYRA 4ED4A 2WP8B 1KTVA 3WU3A 4JI0I 2XEXA 4Z7YA 1N36I 4DV6I 5LMNE 3LPSA 4LF6I 4JYAI 1XNQE 4JV5E 2Z5EA 4MU3A 1HNXI 1K47A 1RREA 4DV5E 1ZM2A 4FN5A 3ZM7A 2JE6B 3GONA 4AQYI 5ELWA 1N34I 4OX9E 3T1HI 4LF7E 1N33I 4IFDE 4K0KI 3B78A 2CZ9A 1Z0CA 2NN6B 1IBKI 4WUCA 3U1YA 2UU9E 4MU4A 1FWLA 2PNZA 1B63A 3PRYA 4FW3A 4IS9A 4KQVA 4M1KA 5DRRA 5IT9C 5DNXA 1XNRI 3M85G 4DV7I 4WUDA 4OO1E 1KVKA 2JT2A 3LNUA 3PS2A 5K36B 3PYDA 4X62I 3CDJA 4LF5E 3B4TA 4IZKA 2BM0A 4P7AA 2O1UA 1UDQA 2LJPA 2UXBI 2DEJA 3K85A 4U3DA 4X65I 4BA1A 4KHPI 2BA1G 2UUBI 5FLXC 1OJ4A 3PYFA 1WUUA 1N0UA 3J7AM 3V2UC 1E3PA 4DV0E 3K1JA 1YH8A 4WUBA 2CG9A 1Y6ZA 3ZZ0A 4DUYE 1FNMA 4B3ME 4OO1B 1FKAE 2UUCE 4B3RI 4DU8A 3WU4A 5BR8I 4GKKI 4NXMI 1N0VC 4JI1E 2UXDE 2PO1B 5IT9Q 1OYPA 3KRNA 4B3TE 1HNWE 4JI6I 4JI3I 5LMUE 2R3VA 4IFDC 4USKA 4DR7I 2UUAE 2WP8A 2A2DA 2F4VI 3HULA 4IZJB 2HK2A 2O1WA 5C0XC
chains in the Genus database with same CATH topology
1Y60A 1Y5YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y60 A;  1Y5Y A; 
#chains in the Genus database with same CATH topology
 4JI2 I;  1IBL E;  1QZR A;  5EL9 A;  5FLX Q;  4JI4 I;  2VQF E;  4JI7 I;  1R6L A;  1I94 I;  2JE6 A;  1NZ0 A;  4RPF A;  2UXC E;  2PNL A;  3ZKD A;  4GKJ I;  1Z0W A;  4DV4 I;  1UDO A;  2PNM A;  2WW4 A;  4LF9 E;  2ZBK B;  1HNZ I;  3P3G A;  2V8P A;  2NN6 A;  4LCH A;  1PVG A;  4DPX A;  4YY3 I;  3QT5 A;  2Z5B B;  4AID A;  1MX0 A;  4DV3 E;  2E5L E;  4AM3 A;  4DR6 I;  4HYM A;  1J5E I;  2GQ0 A;  4OKG A;  1Z0B A;  1Z59 A;  4X64 E;  4LF8 E;  5JEA E;  4DV2 I;  1Z0E A;  3ZKB A;  1Z0G A;  4LFB I;  4IFD F;  5K36 A;  2JEA B;  4B3S E;  3DD6 A;  2V2Z A;  4YHH E;  1Z5A A;  4I3H A;  3K17 A;  5C0X F;  2GO4 A;  5GMD A;  4DR2 E;  4DR4 E;  4JI0 E;  4DPU A;  1N32 E;  5DRQ A;  2C37 B;  4GQU A;  1XXE A;  4OO1 F;  4BA2 B;  2NN6 D;  2NPF A;  1XNQ I;  2BA0 D;  1KIJ A;  4DV5 I;  4OO1 A;  4DUZ I;  1OYS A;  4Z7C A;  1S4E A;  1IBM E;  3T1H E;  5C0X E;  2R42 A;  1ZM9 A;  2GS8 A;  2PO1 A;  1Z5C A;  1UDS A;  4HAC B;  4LF7 I;  1ZXN A;  4JI8 E;  4DPY A;  5K36 D;  3QT8 A;  4LPF A;  2AJ4 A;  1FJG E;  1XNR E;  2UU9 I;  3ZZU A;  5L3J A;  1XMO I;  3D4J A;  4DV1 E;  4IZJ A;  2J65 A;  1VIS A;  4IFD B;  1USV A;  2X36 A;  2VES A;  2HHH E;  3P76 A;  2O3Z A;  3M7N G;  4QNJ A;  5JEA C;  3P06 A;  4LF5 I;  5C0X B;  1Z0T A;  4OO1 D;  1H7S A;  2ZIT A;  1ZM3 A;  3J81 C;  4LFA E;  2X7I A;  4HXZ A;  1HK7 A;  3LTO A;  4USM A;  4U3B A;  4ISA A;  2J7K A;  2E1R A;  3NZK A;  4FW9 A;  2Z5B A;  1D6T A;  4DV0 I;  4PU9 A;  5IWA I;  2HFS A;  5BR8 E;  4GKK E;  3V5R A;  4JI5 I;  1H7U A;  4IZJ D;  3F0N A;  3QT6 A;  4JI1 I;  4LFC E;  2VQE I;  4JI6 E;  2IOQ A;  5GME A;  2GO3 A;  4B3T I;  4FW6 A;  4JI3 E;  2JEA A;  1PKP A;  1HNW I;  3PS3 A;  4DR7 E;  1NHJ A;  4MQY A;  3J80 C;  4J3D A;  3Q1Q A;  1Z5B A;  4DXL A;  2C37 A;  1R6M A;  4ZVI A;  4NBQ A;  4JI2 E;  5JEA F;  2BA1 D;  4DR1 E;  4BA2 A;  4X66 E;  4DR5 E;  1Y60 A;  2C38 B;  3J81 Q;  1IBL I;  3T1Y I;  1H74 A;  4NXN I;  1I94 E;  1VI7 A;  2VQF I;  3GCM A;  1FWK A;  2DEI A;  1RHY A;  4PRV A;  2UXC I;  5FWK A;  1FI4 A;  1ZXM A;  4URL A;  4FWG A;  4YY3 E;  4HAC A;  5DRO A;  3CWV A;  4DR3 E;  3HKM A;  3JAM C;  1KKH A;  4DR6 E;  2ZM6 I;  4LF4 E;  4DV3 I;  2E5L I;  4OZE A;  1J5E E;  1HR0 E;  1E3H A;  1XMQ E;  1DAR A;  3H4L A;  3OTO E;  1H73 A;  1Y5Y A;  4UT4 A;  3J80 Q;  1UDN A;  4LCG A;  4X64 I;  4LF8 I;  2JEB B;  3PYG A;  4IFD A;  1ZM4 A;  1N36 E;  4DV6 E;  4FW7 A;  4HY1 A;  4B3S I;  2BR2 B;  2HKE A;  3Q6M A;  4LF6 E;  4JYA E;  1RR9 A;  2NN6 E;  4YHH I;  5C0X A;  5LMN I;  5LL6 R;  1HNX E;  4R1F A;  4DR4 I;  1Y4S A;  4DR2 I;  2V2Q A;  3GME A;  4JV5 I;  4AQY E;  2O1T A;  1N32 I;  4MYT A;  5JEA B;  1N34 E;  3H1C A;  2A2C A;  2PO2 B;  1B62 A;  2HFU A;  4OX9 I;  4K0K E;  1N33 E;  4LOM A;  3PS1 A;  4MU1 A;  1IBK E;  4DUZ E;  5K36 E;  2IES A;  2C39 B;  1Y4U A;  3ZZT A;  3JAM Q;  2Z5C B;  2PO0 B;  1IBM I;  4UTG A;  4FWH A;  3PYE A;  4DV7 E;  3Q6N A;  4IFD D;  2IOP A;  1YHC A;  3B8H A;  4JI8 I;  2HKJ A;  2WNR B;  3L7Z B;  4PRX A;  4X62 E;  5C0X D;  1XMO E;  1FJG I;  2UXB E;  1ELO A;  1XHK A;  4X65 E;  4DV1 I;  4KHP E;  3QT7 A;  1Z0V A;  4QNK A;  2UUB E;  2Q2E B;  4DU7 A;  2C38 A;  1USU A;  1PIE A;  2HHH I;  2V2V A;  2O1V A;  5DNL A;  3CDI A;  2BM1 A;  1U2R A;  1EA6 A;  4LFA I;  4B3R E;  2NN6 C;  4AIM A;  4NXM E;  4FW5 A;  5EKW A;  4DUY I;  4B3M I;  4MYU A;  2UUC I;  2BV3 A;  1NHI A;  5IWA E;  2UXD I;  3M85 D;  1H72 C;  3GLL A;  1EI1 A;  4JI5 E;  4XTJ A;  2IER A;  3P3C A;  2PNZ B;  2F1D A;  2V34 A;  1P42 A;  4EMD A;  3B82 A;  4N3O A;  2VQE E;  5LMU I;  2F4V E;  5K36 C;  1A6F A;  2JEB A;  2UUA I;  4LFC I;  1BKN A;  2VF3 A;  3HJC A;  5DRP A;  1UEK A;  2BR2 A;  3M6A A;  5A2Q C;  3M7N D;  4JI4 E;  4JI7 E;  4IZK B;  2CGE A;  3J7A G;  5JEA A;  2OI2 A;  2HK3 A;  4FWD A;  4GKJ E;  4DV4 E;  4BA1 B;  2EFG A;  4MDT A;  4P52 A;  3T1Y E;  4MU0 A;  4DR1 I;  2PO2 A;  1HNZ E;  4NXN E;  4X66 I;  1MU5 A;  4DR5 I;  4LF9 I;  4OO1 C;  2C39 A;  2NN6 F;  2BA0 G;  1S16 A;  3WU5 A;  3UHM A;  2Z5C A;  2AE8 A;  2PO0 A;  2CVE A;  4DV2 E;  3U1K A;  3WU6 A;  2ZM6 E;  4DPW A;  4LFB E;  4DR3 I;  4FW4 A;  2WNR A;  3L7Z A;  5K36 F;  4LF4 I;  1MG7 A;  3P3E A;  1HR0 I;  4LCF A;  1NHH A;  4DPT A;  1XMQ I;  4JG4 A;  5A2Q Q;  3OTO I;  5JEA D;  1OYR A;  4ED4 A;  2WP8 B;  1KTV A;  3WU3 A;  4JI0 I;  2XEX A;  4Z7Y A;  1N36 I;  4DV6 I;  5LMN E;  3LPS A;  4LF6 I;  4JYA I;  1XNQ E;  4JV5 E;  2Z5E A;  4MU3 A;  1HNX I;  1K47 A;  1RRE A;  4DV5 E;  1ZM2 A;  4FN5 A;  3ZM7 A;  2JE6 B;  3GON A;  4AQY I;  5ELW A;  1N34 I;  4OX9 E;  3T1H I;  4LF7 E;  1N33 I;  4IFD E;  4K0K I;  3B78 A;  2CZ9 A;  1Z0C A;  2NN6 B;  1IBK I;  4WUC A;  3U1Y A;  2UU9 E;  4MU4 A;  1FWL A;  2PNZ A;  1B63 A;  3PRY A;  4FW3 A;  4IS9 A;  4KQV A;  4M1K A;  5DRR A;  5IT9 C;  5DNX A;  1XNR I;  3M85 G;  4DV7 I;  4WUD A;  4OO1 E;  1KVK A;  2JT2 A;  3LNU A;  3PS2 A;  5K36 B;  3PYD A;  4X62 I;  3CDJ A;  4LF5 E;  3B4T A;  4IZK A;  2BM0 A;  4P7A A;  2O1U A;  1UDQ A;  2LJP A;  2UXB I;  2DEJ A;  3K85 A;  4U3D A;  4X65 I;  4BA1 A;  4KHP I;  2BA1 G;  2UUB I;  5FLX C;  1OJ4 A;  3PYF A;  1WUU A;  1N0U A;  3J7A M;  3V2U C;  1E3P A;  4DV0 E;  3K1J A;  1YH8 A;  4WUB A;  2CG9 A;  1Y6Z A;  3ZZ0 A;  4DUY E;  1FNM A;  4B3M E;  4OO1 B;  1FKA E;  2UUC E;  4B3R I;  4DU8 A;  3WU4 A;  5BR8 I;  4GKK I;  4NXM I;  1N0V C;  4JI1 E;  2UXD E;  2PO1 B;  5IT9 Q;  1OYP A;  3KRN A;  4B3T E;  1HNW E;  4JI6 I;  4JI3 I;  5LMU E;  2R3V A;  4IFD C;  4USK A;  4DR7 I;  2UUA E;  2WP8 A;  2A2D A;  2F4V I;  3HUL A;  4IZJ B;  2HK2 A;  2O1W A;  5C0X C; 
#chains in the Genus database with same CATH homology
 1Y60 A;  1Y5Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...