1Y69K

Rrf domain i in complex with the 50s ribosomal subunit from deinococcus radiodurans
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
136
structure length
136
Chain Sequence
b'KRTKFRKQFRGRMTGDAKGGDYVAFGDYGLIAMEPAWIKSNQIEACRIVMSRHFRRGGKIYIRIFPDKPVTKKPAETRMGKGKGAVEYWVSVVKPGRVMFEVAGVTEEQAKEAFRLAGHKLPIQTKMVKREVYDEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title X-ray crystallography on ribosome recycling: mechanism of binding and action of RRF on the 50S ribosomal subunit
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
total genus 8
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2004-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00252 Ribosomal_L16 Ribosomal protein L16p/L10e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.1170.10 Alpha Beta Alpha-Beta Complex Aldehyde Oxidoreductase; domain 3 Ribosomal protein L10e/L16 1y69K01
1Q82J 1N8RJ 1VQ8H 1W2BH 1QVGH 5GAEN 5JVHJ 2OTJH 3G4SH 1S72H 1JJ2H 1YJ9H 1YIJH 5GADN 3CF5J 1YJNH 1VQ7H 1KC8J 5GAGN 1WKIA 2QA4H 2ZJQJ 2OTLH 1VQKH 4WF9J 1M1KJ 1YJWH 1KQSH 2PA2A 3G71H 3CMAH 1KD1J 3CC7H 3CCUH 1K73J 4WCEJ 1Y69K 1Q86J 4IOAJ 3CPWH 3I56H 1K8AJ 3CXCH 3CCVH 4IOCJ 1Q81J 3DLLJ 1Q7YJ 1VQNH 1VQ9H 1YI2H 5GAHN 5HL7J 4WFBJ 1VQ5H 3CC2H 1YITH 3CD6H 1QVFH 5AN9F 1K9MJ 1YHQH 2ZJPJ 1VQ6H 3CMEH 3CCQH 5DM7J 5JVGJ 3CCRH 5DM6J 5H1SO 3CCSH 3CCLH 3J7ZM 3CC4H 3CCEH 2ZJRJ 1VQOH 1VQMH 1NJIJ 4UY8M 2QEXH 4WFNJ 4WFAJ 3I55H 3CCMH 3OW2H 1VQPH 4IO9J 3G6EH 3CCJH 5MLCO 1VQLH 3PIOJ 1M90J 1VQ4H 3PIPJ 4U67J
chains in the Genus database with same CATH superfamily
1Q82J 1QAPA 1N8RJ 1YTKA 4ZOHA 5AYXA 1VQ8H 4EAFA 1W2BH 1QVGH 5GAEN 5JVHJ 2I14A 2OTJH 1YTEA 1O4UA 3AMZA 4C7YA 2DSJA 1N63B 3G4SH 1S72H 1JJ2H 1YJ9H 4KWWA 1AZYA 2QIEA 1X1OA 5GADN 4YYYA 3CF5J 1YIJH 1YJNH 3ETRC 3RPFA 2E3TA 1KC8J 5GAGN 1WKIA 2QA4H 1VQ7H 2ZJQJ 5EP8A 2OTLH 3NVWC 1VQKH 1N62B 1RM6A 2WK5A 2TPTA 4WF9J 1JROB 1M1KJ 1YJWH 1V97A 1KQSH 2PA2A 3G71H 3CMAH 1KD1J 3CC7H 3CCUH 2W3RB 1N60B 2Q5WE 2WK6A 4YEKA 1K73J 3NVYC 5EY3A 4WCEJ 1WYGA 1Y69K 3C2FA 1Q86J 3SR6C 1QPOA 3B9JC 4IOAJ 3CPWH 5HULA 1DGJA 1SB3A 1QPQA 5AYYA 1N61B 3I56H 2W54B 3C2VA 3EUB4 2WP4A 2W3SB 1K8AJ 3CXCH 3CCVH 4USAA 1JRPB 3PAJA 4US8A 2B7PA 1NVJA 3NS1C 4IOCJ 2J0FA 1Q81J 3GNNA 3DLLJ 1YTDA 1Q7YJ 4GA6A 4X46A 1VQNH 2B7NA 3WO1A 1VQ9H 1YI2H 5GAHN 5HL7J 4WFBJ 2B7QA 3AN1A 2OMDA 4LHMA 4AP8A 4XR5A 1VQ5H 3CC2H 1YITH 3NRZC 3CD6H 1QVFH 3C2RA 5AN9F 1K9MJ 1FIQC 3NVZC 3C2EA 2JBMA 3WNZA 1NVIE 1YHQH 2ZJPJ 1VQ6H 3CMEH 5AYZA 3CCQH 4EADA 5DM7J 3L4PA 3VMMA 5JVGJ 3CCRH 3L0GA 3TQVA 5DM6J 1SIJA 2I1OA 5H1SO 3CCSH 3H5QA 3CCLH 3J7ZM 3CC4H 1VLBA 3CCEH 2ZJRJ 1VQOH 3FC4A 1NJIJ 1VQMH 4UY8M 4C7ZA 4C80A 1VDVA 1FM0E 4I9AA 1ZXIB 3WO0A 3C2OA 3AM9A 1OTPA 4GA5A 2QEXH 4GA4A 3BIIE 4WFNJ 4WFAJ 1QPRA 5MPOC 3I55H 3NVVC 1FMAE 1FFUB 3CCMH 4US9A 1N5WB 1UOUA 3OW2H 4KWVA 1VQPH 4IO9J 3G6EH 3CCJH 5HUOA 1FFVB 5MLCO 1VQLH 3PIOJ 1M90J 1N5XA 1VQ4H 3PIPJ 2W55B 1QPNA 1FO4A 3FAHA 4U67J 1BRWA 5HUPA
chains in the Genus database with same CATH topology
1Q82J 1N8RJ 1VQ8H 1W2BH 1QVGH 5GAEN 5JVHJ 2OTJH 3G4SH 1S72H 1JJ2H 1YJ9H 1YIJH 5GADN 3CF5J 1YJNH 1VQ7H 1KC8J 5GAGN 1WKIA 2QA4H 2ZJQJ 2OTLH 1VQKH 4WF9J 1M1KJ 1YJWH 1KQSH 2PA2A 3G71H 3CMAH 1KD1J 3CC7H 3CCUH 1K73J 4WCEJ 1Y69K 1Q86J 4IOAJ 3CPWH 3I56H 1K8AJ 3CXCH 3CCVH 4IOCJ 1Q81J 3DLLJ 1Q7YJ 1VQNH 1VQ9H 1YI2H 5GAHN 5HL7J 4WFBJ 1VQ5H 3CC2H 1YITH 3CD6H 1QVFH 5AN9F 1K9MJ 1YHQH 2ZJPJ 1VQ6H 3CMEH 3CCQH 5DM7J 5JVGJ 3CCRH 5DM6J 5H1SO 3CCSH 3CCLH 3J7ZM 3CC4H 3CCEH 2ZJRJ 1VQOH 1VQMH 1NJIJ 4UY8M 2QEXH 4WFNJ 4WFAJ 3I55H 3CCMH 3OW2H 1VQPH 4IO9J 3G6EH 3CCJH 5MLCO 1VQLH 3PIOJ 1M90J 1VQ4H 3PIPJ 4U67J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q82 J;  1N8R J;  1VQ8 H;  1W2B H;  1QVG H;  5GAE N;  5JVH J;  2OTJ H;  3G4S H;  1S72 H;  1JJ2 H;  1YJ9 H;  1YIJ H;  5GAD N;  3CF5 J;  1YJN H;  1VQ7 H;  1KC8 J;  5GAG N;  1WKI A;  2QA4 H;  2ZJQ J;  2OTL H;  1VQK H;  4WF9 J;  1M1K J;  1YJW H;  1KQS H;  2PA2 A;  3G71 H;  3CMA H;  1KD1 J;  3CC7 H;  3CCU H;  1K73 J;  4WCE J;  1Y69 K;  1Q86 J;  4IOA J;  3CPW H;  3I56 H;  1K8A J;  3CXC H;  3CCV H;  4IOC J;  1Q81 J;  3DLL J;  1Q7Y J;  1VQN H;  1VQ9 H;  1YI2 H;  5GAH N;  5HL7 J;  4WFB J;  1VQ5 H;  3CC2 H;  1YIT H;  3CD6 H;  1QVF H;  5AN9 F;  1K9M J;  1YHQ H;  2ZJP J;  1VQ6 H;  3CME H;  3CCQ H;  5DM7 J;  5JVG J;  3CCR H;  5DM6 J;  5H1S O;  3CCS H;  3CCL H;  3J7Z M;  3CC4 H;  3CCE H;  2ZJR J;  1VQO H;  1VQM H;  1NJI J;  4UY8 M;  2QEX H;  4WFN J;  4WFA J;  3I55 H;  3CCM H;  3OW2 H;  1VQP H;  4IO9 J;  3G6E H;  3CCJ H;  5MLC O;  1VQL H;  3PIO J;  1M90 J;  1VQ4 H;  3PIP J;  4U67 J; 
#chains in the Genus database with same CATH topology
 1Q82 J;  1QAP A;  1N8R J;  1YTK A;  4ZOH A;  5AYX A;  1VQ8 H;  4EAF A;  1W2B H;  1QVG H;  5GAE N;  5JVH J;  2I14 A;  2OTJ H;  1YTE A;  1O4U A;  3AMZ A;  4C7Y A;  2DSJ A;  1N63 B;  3G4S H;  1S72 H;  1JJ2 H;  1YJ9 H;  4KWW A;  1AZY A;  2QIE A;  1X1O A;  5GAD N;  4YYY A;  3CF5 J;  1YIJ H;  1YJN H;  3ETR C;  3RPF A;  2E3T A;  1KC8 J;  5GAG N;  1WKI A;  2QA4 H;  1VQ7 H;  2ZJQ J;  5EP8 A;  2OTL H;  3NVW C;  1VQK H;  1N62 B;  1RM6 A;  2WK5 A;  2TPT A;  4WF9 J;  1JRO B;  1M1K J;  1YJW H;  1V97 A;  1KQS H;  2PA2 A;  3G71 H;  3CMA H;  1KD1 J;  3CC7 H;  3CCU H;  2W3R B;  1N60 B;  2Q5W E;  2WK6 A;  4YEK A;  1K73 J;  3NVY C;  5EY3 A;  4WCE J;  1WYG A;  1Y69 K;  3C2F A;  1Q86 J;  3SR6 C;  1QPO A;  3B9J C;  4IOA J;  3CPW H;  5HUL A;  1DGJ A;  1SB3 A;  1QPQ A;  5AYY A;  1N61 B;  3I56 H;  2W54 B;  3C2V A;  3EUB 4;  2WP4 A;  2W3S B;  1K8A J;  3CXC H;  3CCV H;  4USA A;  1JRP B;  3PAJ A;  4US8 A;  2B7P A;  1NVJ A;  3NS1 C;  4IOC J;  2J0F A;  1Q81 J;  3GNN A;  3DLL J;  1YTD A;  1Q7Y J;  4GA6 A;  4X46 A;  1VQN H;  2B7N A;  3WO1 A;  1VQ9 H;  1YI2 H;  5GAH N;  5HL7 J;  4WFB J;  2B7Q A;  3AN1 A;  2OMD A;  4LHM A;  4AP8 A;  4XR5 A;  1VQ5 H;  3CC2 H;  1YIT H;  3NRZ C;  3CD6 H;  1QVF H;  3C2R A;  5AN9 F;  1K9M J;  1FIQ C;  3NVZ C;  3C2E A;  2JBM A;  3WNZ A;  1NVI E;  1YHQ H;  2ZJP J;  1VQ6 H;  3CME H;  5AYZ A;  3CCQ H;  4EAD A;  5DM7 J;  3L4P A;  3VMM A;  5JVG J;  3CCR H;  3L0G A;  3TQV A;  5DM6 J;  1SIJ A;  2I1O A;  5H1S O;  3CCS H;  3H5Q A;  3CCL H;  3J7Z M;  3CC4 H;  1VLB A;  3CCE H;  2ZJR J;  1VQO H;  3FC4 A;  1NJI J;  1VQM H;  4UY8 M;  4C7Z A;  4C80 A;  1VDV A;  1FM0 E;  4I9A A;  1ZXI B;  3WO0 A;  3C2O A;  3AM9 A;  1OTP A;  4GA5 A;  2QEX H;  4GA4 A;  3BII E;  4WFN J;  4WFA J;  1QPR A;  5MPO C;  3I55 H;  3NVV C;  1FMA E;  1FFU B;  3CCM H;  4US9 A;  1N5W B;  1UOU A;  3OW2 H;  4KWV A;  1VQP H;  4IO9 J;  3G6E H;  3CCJ H;  5HUO A;  1FFV B;  5MLC O;  1VQL H;  3PIO J;  1M90 J;  1N5X A;  1VQ4 H;  3PIP J;  2W55 B;  1QPN A;  1FO4 A;  3FAH A;  4U67 J;  1BRW A;  5HUP A; 
#chains in the Genus database with same CATH homology
 1Q82 J;  1N8R J;  1VQ8 H;  1W2B H;  1QVG H;  5GAE N;  5JVH J;  2OTJ H;  3G4S H;  1S72 H;  1JJ2 H;  1YJ9 H;  1YIJ H;  5GAD N;  3CF5 J;  1YJN H;  1VQ7 H;  1KC8 J;  5GAG N;  1WKI A;  2QA4 H;  2ZJQ J;  2OTL H;  1VQK H;  4WF9 J;  1M1K J;  1YJW H;  1KQS H;  2PA2 A;  3G71 H;  3CMA H;  1KD1 J;  3CC7 H;  3CCU H;  1K73 J;  4WCE J;  1Y69 K;  1Q86 J;  4IOA J;  3CPW H;  3I56 H;  1K8A J;  3CXC H;  3CCV H;  4IOC J;  1Q81 J;  3DLL J;  1Q7Y J;  1VQN H;  1VQ9 H;  1YI2 H;  5GAH N;  5HL7 J;  4WFB J;  1VQ5 H;  3CC2 H;  1YIT H;  3CD6 H;  1QVF H;  5AN9 F;  1K9M J;  1YHQ H;  2ZJP J;  1VQ6 H;  3CME H;  3CCQ H;  5DM7 J;  5JVG J;  3CCR H;  5DM6 J;  5H1S O;  3CCS H;  3CCL H;  3J7Z M;  3CC4 H;  3CCE H;  2ZJR J;  1VQO H;  1VQM H;  1NJI J;  4UY8 M;  2QEX H;  4WFN J;  4WFA J;  3I55 H;  3CCM H;  3OW2 H;  1VQP H;  4IO9 J;  3G6E H;  3CCJ H;  5MLC O;  1VQL H;  3PIO J;  1M90 J;  1VQ4 H;  3PIP J;  4U67 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...