1Y6BA

Crystal structure of vegfr2 in complex with a 2-anilino-5-aryl-oxazole inhibitor
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
350
structure length
266
Chain Sequence
RLPYDASKWEFPRDRLKLGKPLGRGGQVIEADAFGIDKTATCRTVAVKMLKATHSEHRALMSELKILIHIGHHLNVVNLLGACTKPGGPLMVIVEFCKFGNLSTYLRSKRNEFVPYFLTLEHLICYSFQVAKGMEFLASRKCIHRDLAARNILLSEKNVVKICDFPLKWMAPETIFDRVYTIQSDVWSFGVLLWEIFSLGASPYPGVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTMLDCWHGEPSQRPTFSELVEHLGNLLQANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Vascular endothelial growth factor receptor 2
publication title Discovery and evaluation of 2-anilino-5-aryloxazoles as a novel class of VEGFR2 kinase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 92
structure length 266
sequence length 350
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2004-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1y6bA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1y6bA01
5ETIA 3SD0A 3BHUA 4HZRA 4D0XA 5BUIA 3NZ0A 2B52A 4E8AA 5IA5A 3QZFA 3O2MA 1XBBA 2HW6A 3LAUA 2LGCA 2J0MB 4ASXA 4BTFA 5E9EA 3OBJA 1RDQE 5CI6A 2PVNA 2PY3A 2YERA 2BAQA 1GJOA 3ETAA 3TUBA 1H8FA 4JBQA 2HELA 2IO6A 2ONLA 4H1JA 4NJ3A 4QTAA 1FBNA 1U54B 5CY3A 3GOKA 1PXNA 1W0XC 5AR5A 3MY5A 4LMUA 3AC5A 4EOKA 3ATSA 3FHRA 3FEGA 4HGEA 3EQDA 4I5HA 2WQEA 2ERKA 3Q53A 3E5AA 4WA9A 4RC2A 5D1JA 5FWKK 4RJ3A 4DGLC 5JGAA 5CZIA 1RW8A 3FI2A 2OICA 3JVRA 1M14A 5KBRA 4P4CA 4NM7A 4EUUA 5FTQA 2ETMA 3ERKA 1V0PA 3LXNA 3ZBXA 3QL8A 4PP7A 4YJVA 4F0GA 3EL8A 4K11A 1L8TA 2WMSA 2F57A 4RWLA 4IEBA 4BCGA 4DH3A 4RLLA 4U42A 5IUHA 3DAJA 1YWNA 4YTFA 4WG3A 4TYHB 2VN9A 1JKKA 2VNYA 3AMYA 2CGWA 2VTJA 3C50A 3IDBA 2C1AA 5CVGA 4QPSA 3CIKA 4BDBA 4JR3A 3MA3A 5F95A 4BWKA 1H00A 5CVHA 3WZJA 2REIA 3EZVA 5EW3A 3BEAA 5E7RA 3ZLXA 1YVJA 1VYWA 1OGUA 3SXRA 3E8CA 4AF3A 4BTMA 4EKKA 4L43A 4F9WA 4MXZA 5BUEA 4U79A 4CT1A 2W5HA 4HVGA 3UNJA 3SGCA 4WUNA 2R3LA 5I9WA 5EI2A 3SA0A 1ZWSA 1F5QA 3KXMA 5DHJA 3KL8A 4IB1A 4DITA 2PVLA 3EKKA 3QGYA 2CGXA 2XKFA 3DK6A 4MQ1A 4QTEA 2C3JA 3AGLA 3QAME 4IZAA 2XIRA 3KXXA 4K1BA 2WTJA 5JFVA 3FLYA 1FMKA 4RIWA 2BZKB 4FK3A 3IOPA 4GFOA 2AUHA 3NYOA 3KXHA 1WBOA 2VTIA 2W7XA 2WQOA 2X9EA 1XBCA 3SAYA 1OVEA 3R7UA 5HE0A 4ORKA 1WZYA 3VC4A 3CD8A 3WE8A 3E3BX 2C6LA 4U0IA 3TWJA 3UC4A 5HD4A 3VUHA 3QUEA 4GT3A 4YO4A 4NTSA 2R3KA 3BYMA 4PPCA 4EONA 4PPAA 1NVQA 2Z7LA 4CQEA 4IB0A 4QYHA 3FWQA 3CKXA 4YZMA 5AR3A 2XNMA 1JOWB 2VU3A 4WT6A 4EHVA 3IECA 2OXDA 1APME 2JIUA 2UZEA 3ORPA 4XYFA 4ASZA 3OY3A 3RK7A 4OR5A 4YJOA 4DEDA 4CZTA 4TYJA 5CNOA 3COHA 3PVWA 4U44A 3R8MA 2J5FA 3DBCA 3TTIA 5CT7A 4CCUA 5IDNA 4PPBA 5LMKA 3H3CA 2A1AB 4IX3A 2VTOA 3FV8A 3R8PA 3TDVA 3R2BA 5CAPA 5CU4A 3D7TA 3UOHA 4O7WA 3MN3A 4HZSA 2VTRA 4DFNA 4O2PA 4FOBA 4CSVA 4CFNA 5AV4A 4FKWA 1PF8A 2V55A 2C6OA 5L8LA 4D28A 1ZYJA 4JDHA 1PYXA 3DZQA 4FZFB 2W9ZB 4QYGA 2HZ4A 1UU3A 3T9TA 4BCKA 3U8WA 3PJCA 3GBZA 3OHTA 4XV3A 3OTUA 3GCUA 3KRLA 2PUIA 3LFBA 1Q61A 1KSWA 3JVSA 4YUQA 1E1XA 1SM2A 2NNWB 5IH4A 2R2PA 4AFJA 3AT4A 5HU9A 3A99A 4LRMA 3RZFA 2VWXA 4EEVA 2VGPA 5CU3A 1FVTA 4RPVA 3G6GA 5CZHA 2R7IA 3AD5A 2AC5A 5CEKA 5AV3A 3FZPA 3BZ3A 2BIKB 3QTQA 4FNXA 3V5QA 4MEDA 4XS2A 4ZZOA 1VYZA 3DNDA 2OKRA 4O27B 1OKZA 5L6PA 3RHKA 4F7JA 5JEBA 3PVUA 4FTUA 3KK8A 3SXSA 1YWRA 1XKKA 4D55A 1E9HA 4BF2A 4EK4A 4Z7GA 4F65A 3DBQA 4UB7A 5HD7A 4GK4A 4ZMFA 1QPEA 1OB3A 3AC1A 4LGDA 2W0JA 5KKRB 4YZCA 4O0RA 1ZOGA 3BGZA 2ITVA 3PJ8A 3UMWA 4M67A 2R3GA 5M44A 2YDIA 2ZJWA 2Y6MA 5EHYA 4IQ6A 1RJBA 5FEEA 3JR1A 3S1HA 3CBLA 5HIEA 3UQCA 4GYGA 4LRJA 3UO4A 4UMPA 3AMBA 5DEYA 5BQ0A 2CKOA 2W99B 3TL8A 2BAJA 3DY7A 3ORXA 1Y6AA 2PULA 4R3PA 1DI9A 4E5BA 5BVNA 5D12A 2ITZA 4FUYA 4TRLA 4CNHA 2R64A 2I1MA 2XEYA 3QWJA 3VRYA 4ID7A 4FOCA 3EQPA 4BDFA 3NIZA 4S32A 1JSUA 3U4UA 4AN9A 4FSTA 4EWHA 3KN5A 5GINE 4G3DA 4FYNA 2J9MA 4O96A 2X2LA 1WVYA 2IZRA 1U54A 3Q2MA 3RKBA 5LCJA 4R7BA 4CEGA 1XJDA 2XF0A 3C7QA 3LXLA 4BCHA 3A7IA 4J7BA 3VS1A 4MXXA 4UXLA 1YXSA 3RGFA 3UOLA 1PMUA 4Q9SA 2Y8OA 4RJ5A 2YZAA 3QA8A 4TY1A 4YHTA 4CMUA 4J53A 3KCFA 3M42A 3QXPA 4FV4A 4XV9A 4YTIA 2GSFA 2JBPA 3HLLA 4UMTA 2A27A 3OVVA 4XG3A 2WO6A 5FQDC 5LJJA 5GIOE 5CEMA 2QOCA 2XEZA 3E62A 4EH4A 2FSLX 3CTQA 4FMQA 4WRSA 2JKOA 5HBHA 4TYHA 4D5HA 4H3BA 4GG7A 2WTKC 4I0SA 4M66A 4S30A 4F7NA 1Y8YA 4FE2A 1KOAA 4D5KA 3NMUF 2QNJA 3QU0A 2CMWA 3PA3A 1J1CA 3TG1A 4B0GA 2ZM3A 4D4SA 3GU6A 4DEIA 3EZRA 5J79A 2YIRA 1PRYA 3DXPA 1JVPP 3D4QA 4HGTA 1JBPE 2YIWA 4YPSA 3EMGA 3FLWA 4QYEA 2JKKA 4K0YA 2BCJA 5J5SA 3NIEA 4DGOA 3R7VA 4CLIA 4Y5HA 3LFSA 3NVKI 3HUCA 5AR4A 5FRIA 3PSCA 3U55A 4FIEA 3MW1A 5HG7A 2G2HA 3S00A 3IW6A 1ZOEA 4FKIA 4F1TA 4AGWA 2R3JA 2V7OA 5HE1A 2OJFE 4DYMA 4O0WA 3THBA 4USEA 3SG9A 4HCVA 4IX5A 3G33A 4A4XA 4D2SA 3AT2A 4R78A 5AM7A 4NWMA 2X1NA 5EYMA 2DUVA 1T45A 3V01A 3G90X 5FXSA 4ZTQA 3QQUA 2R9SA 1STCE 3HX4A 3R8ZA 4JJRA 3SOCA 2YABA 5LARA 4KSQA 2JAMA 3E3PA 1CKPA 3C9WA 4H1MA 4C62A 3ZCLA 3E7VA 4BDDA 3SOAA 4AGCA 2PMIA 4FTLA 4I0RA 4AOIA 3BWJA 3DBDA 3KCKA 4N6ZA 4TNBA 4M7IA 3R8LA 3H10A 3PIXA 4NKSA 3B2WA 2FYSA 4BCPA 2X6DA 3ORMA 3PY3A 3NUNA 4ALWA 3A60A 5JK3A 3HGKA 4RQVA 5BVKA 2QKWB 4HCUA 3KN6A 5TKDA 3RMFA 1ZARA 3QTIA 5J8IA 5K0XA 2OXYA 5GJGA 2F7EE 2HZ0A 4BIEA 2J90A 5EQPA 4IAZA 4PL4A 2GNLA 4AACA 4KIQA 4I92A 2G1TA 4BCMA 2XK9A 5BX0A 2JEDA 4CFXA 2IN6A 3HKOA 4C4HA 4EH2A 1VJYA 1LP4A 2WIPA 1R1WA 5HVJA 4FIHA 4QQCA 2OIQA 1OBDA 4O7VA 3AOXA 3MS9A 5ICPA 3I1AA 5H8EA 1V0OA 3TIZA 4GVJA 5LWMA 4QMLA 4PY1A 4IIRA 3QTWA 2CHLA 3HL7A 3HMNA 3NLBA 3VUDA 4D2RA 5AR8A 3ZFYA 3F6XA 4W4WA 5CVFA 5FP5A 2GQGA 4CFFA 4FSNA 4DFYA 4EJNA 2JDRA 3LKMA 3AC8A 3ANQA 1CDKA 4FTMA 5CF6A 5C03A 3ZBFA 3I60A 4BGQA 5K4JA 3QQLA 5TOZA 2HZIA 2UZLA 3MVMA 5B2KA 3DKGA 4JG7A 2IW9A 4FZDB 4KRCA 1M7QA 5CSVA 3DU8A 1O6LA 3MVJA 3L8XA 3ZO3A 3QTRA 1TVOA 1W83A 1BKXA 4K9YA 1SNUA 3FZRA 3KK9A 4UZDA 5BYLA 2UW9A 3FI8A 5C8KA 4A9RA 1BL6A 1P5EA 2BFXA 4GU6A 2P3GX 2YAAA 3RNYA 4JL9A 2WELA 3TV4A 3IGGA 4BVUA 4Q5EA 4UALA 3BGPA 2XZSA 3F5PA 4ZTLA 3QQKA 4HVIA 3K5VA 3QQFA 4O0XA 4CYJA 4BBEA 5F20A 3KVWA 4PRJA 3ZLWA 3NNUA 4EOMA 1UNHA 4FT5A 4KIPA 2CNVA 3QTUA 4F0FA 3BQCA 3K3JA 4YZ9A 5CNNA 4DEAA 1VR2A 5AEPA 3D15A 5AUUA 2YZLA 4FV3A 2WZJA 3EFKA 4GIHA 4F6SA 2BRBA 3OG7A 1A48A 4YLKA 5K4IA 4O0TA 4YLJA 2X39A 3TM0A 3OCBA 1W82A 2OFUA 4DLIA 5E8XA 3RWQA 2VO3A 2VX1A 3MPAA 4WNKA 1R0PA 4F9AA 3GNIB 3RVGA 4V05A 3V5TA 3F3UA 2QR7A 3WBLA 5IUGA 2WB8A 5M09A 1QL6A 4JDKA 5IEXA 4FZ6A 4BHNA 1O6YA 4FG8A 3OBGA 3R0TA 4G6NA 3RK9A 3SLSA 5CSWA 4M0YA 4WSQA 3LOKA 3SQQA 4Q9ZA 3R8UA 2C1BA 4Z7HA 4XLVA 2YWVA 2XIZA 3EN6A 3EN7A 3P1AA 4AGDA 4I4EA 3ZM4A 3AMAA 4XOYA 4YBKA 1H1PA 2OZAA 3ANRA 3G6HA 4FK6A 5FLFA 1NVSA 5C8MA 3UIXA 2GQSA 2F9GA 4IHPA 5FBOA 4M97A 5JH6A 2R0IA 3O8PA 3A61A 4CYIA 3POZA 4FGRA 3C4EA 3I79A 3NYNA 4NW5A 4QTBA 2C5XA 4CGAA 1R0EA 1NY3A 3IDPA 3NW7A 1OMWA 4D9UA 3C51A 4PTCA 5JKGA 2R3QA 3BBTB 2CNQA 2B55A 5IA0A 4ASEA 5ANDA 1F3MC 2R3RA 4LFIA 3TXOA 3ATTA 3M11A 4DT9A 3KULA 3JXWA 2JBOA 4D58A 5GHVA 3DDQA 4YNOA 3R7OA 3VNTA 3OUKA 3TNHA 4I23A 3LQ3A 4HPTE 4Q2AA 4JIAA 3UODA 4LMNA 2QOBA 5HCZA 3WZEA 4L46A 2V62A 5A4EA 4HOKA 2ETKA 2I6LA 2GTMA 2QODA 2O8YA 3E7OA 3GC8A 4JIKA 4RIYA 1JKSA 4LOOA 5CALA 5HCYA 3UJGA 1K3AA 3G0FA 4X2GA 5E92A 4BC6A 4FTJA 3CTJA 3Q9XA 3DS6A 4MXCA 5M4IA 4G5JA 3VS2A 2H34A 4EOSA 3NUAA 5A54A 4AOJA 3JY0A 5G1XA 5A14A 4V04A 4BTKA 2EB3A 4H36A 4TWOA 3BBWA 4X3FA 2PUNA 3ZHPC 4DH7A 4R6VA 2PVHA 1PMEA 4NSTA 1O9UA 5CI7A 2OXXA 3EWHA 3IW8A 3L8VA 4WOVA 5DT0A 3P7CA 4MNFA 4QMNA 5IA1A 4NM0A 4CFVA 4IZYA 3R1QA 4K6ZA 3GC9A 3EH9A 3PIZA 3U6JA 2XP2A 3HRCA 4QMMA 2V0DA 5EHLA 2B9IA 3QC9A 4MD9E 3OXIA 1PMNA 2J7TA 4JX7A 1P4OA 3AT3A 3ITZA 1KE9A 3LFAA 1MQ4A 5EDPA 5ETAA 3DKFA 4EI4A 4OT6A 4IJPA 4ACHA 4QMWA 5FEQA 2G9XA 2HW7A 4YNEA 4F70A 3BV3A 4RVLA 2YACA 4DINA 5HO7A 3BX5A 4BFMA 5EM8A 1V0BA 2BIYA 2PSQA 3BHTA 3CP9A 3CTHA 4W8DA 3P08A 3RM6A 3ZUTA 2A19B 4QMYA 2C47A 2OO8X 5CYIA 3PIYA 5HNGA 5IUIA 2IZSA 3GC7A 5JT2A 4D2TA 1HCLA 4OTGA 4EK6A 4ANQA 4IAIA 4X6QC 4BRXA 2XA4A 2ITWA 3ORZA 4NU1A 4QT1A 4ZSLA 4G31A 3HV3A 4PWNA 5HE2A 3HEGA 4U9AA 4F4PA 2BKKA 3OMVA 4YC8A 3UMXA 4AXAA 3CC6A 3Q4ZA 4Z16A 5HNIX 3N4TA 2C5OA 3MVLA 4RIWB 3BCEA 4QMVA 1U4DA 3FYKX 3VS7A 3E63A 3SW4A 4E4MA 4IADA 4L7FA 4ZY6A 3MTFA 3Q9ZA 2VGOA 3I81A 4X2JA 1Y8GA 2JKMA 3VUIA 3F5GA 4RX8A 4YGAA 1Q41A 5IISA 2J5EA 3DXQA 3HMIA 4LGGA 3I0QA 2Q0NA 3AC4A 2QHMA 1Q5KA 3C4WA 3O23A 4MXOA 4TW9A 5EOBA 1FVVA 3KXZA 5ANEA 5CXZA 3L1SA 3FSKA 2OWBA 2ZDUA 2Z7SA 2PVKA 2DYLA 3F69A 4GK3A 2VWZA 4Y73A 3UZRA 2WMBA 4JQ7A 3R9HA 3Q4UA 1RE8A 4QMZA 3QQGA 2C5NA 4KA3A 3LCKA 5IG1A 3D83A 2XB7A 1WFCA 3C0GA 2KTYA 4NH1A 5LVMA 2JLDA 1YOJA 4ZTMA 3NYXA 4LUDA 2BPMA 3IW5A 3W10A 2QQ7A 5EG3A 2VTLA 1J7LA 1SVHA 5K9IA 3QZHA 2UW7A 3FJQE 3HECA 5AA8A 2J0LA 3BEGA 4MHAA 4BDKA 4CFUA 5CX9A 2OIDA 1K9AA 4EHGA 4FEXA 3D7TB 5DE2A 5L2SA 3U4WA 3HMMA 4IMYA 4UY9A 4QP6A 1W98A 2XNBA 2ETRA 5I9UA 3NNVA 4FV9A 3QX2A 3ORNA 5TO8A 3TNWA 4D4RA 4RJ6A 5IQFA 3SKCA 2PZYA 2XYNA 4GUBA 4EYJA 2XUUA 3TZ8A 2B1PA 5DGZA 3PLSA 3UVPA 4BKJA 4FKGA 2YAKA 3OWLA 2R4BA 3K5UA 3LCTA 3AD4A 1CTPE 4Y8DA 5CF8A 3ZS5A 4O7TA 2HCKA 3DQWA 5EHOA 3FLQA 4FVRA 5B7VA 1R78A 2OBJA 5E1SA 5HG9A 3TZMA 4YC6A 1Q8WA 3CPCA 1BLXA 4FTRA 5AIRA 5ACKA 4BDEA 4EWQA 2FA2A 1TQPA 3PXQA 4JBPA 4O7SA 3EYHA 1CKIA 4NM5A 1SVGA 4FIFA 4I4FA 5IQEA 2VO7A 2XKEA 3QD2B 4MTAA 1WBWA 3PRIA 3PPZA 5TR6A 5HTCA 3ZLSA 5IMXA 2C6MA 2QO9A 4CT2A 2UW3A 4L44A 4YP8A 4ANOA 4C2VA 3V8SA 2JAVA 3WIKA 4GIIA 5DT3A 4U97A 4XP0A 2JFMA 3V5LA 2FB8A 4FKTA 3RCDA 1YXXA 5ACBC 3ACKA 4QP1A 3BHHA 3SX9A 4DBXA 4JG6A 3QHWA 4OTWA 5EDRA 5FBNC 5E4HA 4PMSA 2CCHA 3Q96A 4AAAA 2JDVA 5AIKA 5J9YA 3GCVA 3Q04A 3FKNA 3P0MA 3QTZA 2VX3A 3ENHA 4D0WA 2NPQA 3ULIA 3CE3A 4M15A 4FKOA 4M84A 4Y83A 1OM1A 2QU5A 4E26A 5I3RA 3FQHA 3Q6UA 2BALA 3U9NA 3FMKA 2QC6A 5ITAA 2OK1A 2FSMX 1REJA 1M2PA 3DBFA 3LXPA 1SNXA 4FKPA 4HGSA 2QG5A 3D7ZA 4L67A 4C8BA 5L2TA 4AZFA 1DAYA 2C68A 4GSBA 4ERKA 3F2NA 5ETFA 1U5QA 3VRZA 5HX6A 5JGDA 3RAIA 2HWOA 2UZWE 3R04A 4U40A 1OL5A 3KA0A 5AV1A 4D1XA 2A0CX 3TUDA 3QRJA 4G3GA 1AQ1A 5AR2A 2ZB1A 3PFQA 1QMZA 4FSMA 5AV2A 4F09A 4HCTA 4QPAA 3UP2A 2RSVA 3P7AA 4WUAA 2P0CA 1ZY5A 1PXJA 4S34A 4A7CA 3LFEA 4E5AX 2YLFA 3TCPA 2JITA 2I0HA 3COIA 3NCGA 4E20A 3IONA 2NRYA 4FL3A 3UO6A 4ZLYA 4WSYA 2Z60A 3QLFA 4GT4A 4Y5QA 4AWIA 3E8NA 2X7OA 4EZ3A 3LQ8A 3T3VA 5F94A 4Z3VA 4XG9A 4USDA 3ZMMA 4O82A 4IVBA 3DLSA 3I5NA 1YDTE 4BDIA 3PSDA 3C0IA 3WF6A 2EUFB 4ERWA 3FMDA 1M2RA 3P23A 3I4BA 2GS7A 3EB0A 4YURA 3KMMA 4O1PA 3FPQA 2WMRA 3TV6A 4OTDA 4HPUE 4UWYA 5DBXA 1FGIA 5EFQA 4LOQA 2UVYA 2P55A 2YEXA 3COKA 4UYAA 1NVRA 3D94A 3TT0A 2OZOA 3PZEA 4KRDA 2LAVA 4GH2A 3ZSGA 4O6LA 4UMRA 3VW6A 2X6EA 3QD4A 3GU4A 3F3ZA 3DV3A 4X2NA 3VULA 1SVEA 3SC1A 4O7ZA 3F61A 3WF8A 1UNLA 5L8JA 3ORIA 3LJ2A 3NNWA 2WQBA 3FZTA 4PTGA 4IACA 2IWIA 3LFDA 5HHWA 5ANKA 1ZYSA 2YIQA 4N57A 5HZNA 4FKSA 2FSOX 3VS0A 5AADA 3JYAA 4QP3A 4TWCA 4FNZA 2VX0A 5EKOA 2PMOX 3MVHA 4W8EA 2OH0E 2WTIA 4R7HA 4C4IA 4DAWA 5H8BA 3DB6A 5BVWA 4EQUA 1ZZ2A 2BFYA 4G9CA 4YHJA 4I0TA 4RFYA 4O6EA 3V5PA 5HLWA 4FV5A 3VUMA 3NVMB 3C13A 2QVSE 5HIBA 2E9NA 1UA2A 4LOPA 2YM8A 2G2IA 4HGLA 4PTEA 3MBLA 2JC6A 4I5PA 5CAUA 2HK5A 2VUWA 3DXNA 3E88A 4FR4A 3VUKA 3W2OA 3P78A 3MPTA 3GCSA 3R9NA 4M3QA 1TQMA 5E8UA 1V1KA 3KEXA 2B7AA 3A8WA 4K77A 4LM5A 4QMOA 5EM5A 4AOTA 4CTBA 2C3KA 3S2PA 5M53A 4O7NA 4O7LA 5EQYA 3R71A 4HNFA 3GCQA 5HCXA 5J1WA 4GKHA 3OCGA 3KF4A 3PTGA 4QQJA 3IS5A 3F7ZA 4AA4A 3CXWA 4FKJA 3H0YA 3EQIA 4F1MA 1P14A 3C4CA 2EU9A 2JDOA 3LFNA 3GFWA 3H4JA 5FXRA 4YJUA 5IU2A 2B4SB 3REPA 3E92A 4OUCA 4NTTA 3LJ0A 5AP5A 2JDTA 2XS0A 2GS2A 2O3PA 3F3WA 2F2CB 2GHGA 1PKDA 3NYVA 2ITTA 3A2CA 4UEUA 1PXIA 5FDXA 5JRSA 1P2AA 2PVFA 3UIMA 2IJMA 2QO2A 3MIYA 2BZJA 5L3AA 3Q3BA 4FTTA 3EKNA 3QKLA 2C3LA 2PVJA 3LQ5A 3D14A 3ENMA 4FNWA 5L2IA 3BELA 3HMPA 5EW9A 1Q97A 2GQRA 3PDTA 4NT4A 3KRXA 4DEBA 2Y6OA 5BYZA 3FDNA 4XBRA 1OIRA 4LYNA 5A46A 1OZ1A 4GFGA 4G1WA 4YZNA 3VQHA 4R3RA 3LLTA 4I20A 5IH5A 4E1ZA 4BICA 3ZTXA 4XCUA 1RQQA 4BI1A 4X2KA 4N4SA 5H2UA 2J50A 2XBAA 2Y4IB 1XQZA 3NPCA 3QQJA 4HYIA 1ZMWA 3ZU7A 4B6LA 5KO1A 4D2VA 3O17A 3EN9A 4NEUA 3QWKA 1A06A 4FTNA 3UIBA 3ELJA 4BCQA 4P5ZA 5AP3A 4CMOA 3FE3A 3PY1A 3QF9A 3TDWA 5DH3A 4DLJA 4OTPA 4ZP5A 2J4ZA 4G9RA 4QP9A 3QTSA 2PZ5A 1OPKA 3R00A 4BCFA 2OFVA 4DFUA 3BKBA 4D4VA 5L2WA 5IEYA 3S95A 1PYEA 4MWHA 4HVSA 3W32A 3D9VA 3I6UA 3FY0A 2X7FA 1URCA 1IA8A 1GZ8A 3Q52A 4OTIA 1ZOHA 1GZNA 2OSCA 3G9NA 5GZ8A 3MESA 3GI3A 4BKYA 4C4FA 4DTKA 3PLAE 2VTTA 1KE5A 4QQTA 4GUEA 2JIVA 3O51A 3LJ1A 3AG9A 2PTKA 3KFAA 3ZXZA 4IWOA 1GNGA 2W5BA 3MH0A 4DC2A 3R7GA 4IFGA 2C5YA 3RAKA 5HOAA 4CRLA 4RJ8A 3BYUA 5JFWA 2GMXA 4RT7A 3KXGA 4FKUA 3NUUA 3C4XA 4PUZA 5I4NA 2FGIA 3UZTA 3NEWA 1E1VA 4JRNA 4O22A 2P4IA 4JAIA 3ULZA 2WPAA 5TE0A 4C33A 1Q99A 1YI6A 4RG0A 2RL5A 5AP7A 3W8QA 2P2IA 3IGOA 4NYEA 1H1SA 3HA8A 4L42A 1XH8A 4HYHA 4A9TA 4EK5A 4C4EA 5KE0A 5KUPA 2Y9QA 5IF1A 1UU8A 4AU8A 1Q3WA 2OZAB 4BI2A 2CKQA 4A4LA 1BL7A 3R7EA 1LEWA 4BYIA 2IW6A 1NXKA 3OCSA 1BX6A 1XHAA 3CY3A 4HVDA 1YWVA 2J0IA 1OPLA 3UYSA 4AE9A 4DG0E 2PE2A 3BYSA 3PJ1A 3G9LX 2VTMA 3NX8A 2HZNA 3L9NA 4CFWA 4MVFA 2RIOA 3PPJA 3K2LA 4PDYA 2X2KA 3OT8A 5JSMA 3KULB 3O0GA 3UC3A 3VHKA 4RFMA 3ZRKA 1BI8A 3FC2A 3CQWA 1NA7A 3CKWA 3UG1A 2OI4X 3QRKA 3QYZA 2YLEA 1YI4A 3I0OA 4F9YA 3PXKA 4KNBA 4EOQA 4L3LA 4QYFA 3Q5IA 2ZVAA 3F66A 4RWKA 2VTAA 2ZM1A 4UWBA 5CT0A 3VJOA 4DTAA 4RIYB 3C4ZA 3PG1A 4LV5A 4XG8A 3NW5A 2JGZA 3UTOA 4NIFB 2B9JA 4V0GA 5EDQA 3ET7A 3LVPA 3ZLYA 4BYJA 4GU9A 4X3FB 2H96A 2ZV2A 3RINA 3Q5ZA 1HCKA 5DMZA 1YI3A 1U59A 4JX3A 2HENA 1CM8A 1MRUA 4HNIA 3WE4A 4APCA 2GPHA 4MKCA 1H1RA 3ZC5A 4PMPA 4U7ZA 5I0BA 2WU6A 1KE6A 2WMTA 3LW0A 2R3IA 5CSPA 3LIJA 4WNPA 4WD5A 4QPMA 5FG8A 3KVXA 3UDBA 3D5VA 2W1CA 3PP0A 3OOGA 4XP2A 4FVPA 4MD7E 5M55A 2QLQA 4S31A 5KMJA 3EQFA 4ENXA 3LLAA 1URWA 2ITOA 2VWUA 4USFA 4M14A 3HV5A 3R1YA 1M17A 4JR7A 3DFAA 2XIYA 4XEYA 2Z7RA 3R30A 2C0OA 2X81A 4N6YA 5TT7A 3RBWA 1H01A 5DLSA 4KAOA 1LPUA 2NO3A 3V5JA 3VHEA 5KBQA 3EFLA 5HLNA 4QMSA 4C3PA 3UVRA 4C58A 3POOA 4RQKA 4PV0A 4IM2A 4E93A 4UN0C 1GOLA 2O5KA 3O7LB 3VBYA 4C3FA 3RZBA 1YOMA 4BGGA 4F63A 3QX4A 3FLSA 2PHKA 3VIDA 5LVLA 2BHEA 1PW2A 3OTVA 4FSZA 3EQHA 4YHFA 5A4QA 3GU8A 4HW7A 5BNJA 3FMJA 4R7IA 4ZTNA 4EK3A 4X21A 4A9SA 5AP2A 1OL1A 3S0OA 3FMHA 4F0IA 1UKHA 4IM3A 5IQCA 5K5NA 3WYXA 4XBUA 2CDZA 4NK9A 4DGMA 3U9CA 3FAAA 4K33A 2FVDA 3ZDIA 4L68A 4IAKA 3FLZA 5M4FA 3II5A 5CEPA 5HTBA 5H8GA 3M2WA 1H27A 2B54A 3GQIA 4RSSA 2EVAA 2QOIA 3FI4A 4L53A 4BDGA 3DQXA 4EOIA 4YTCA 3OWKA 4FA2A 1H0WA 3V8WA 5J9ZA 3R21A 4JVGA 3TNQB 4CXAA 1OI9A 2QOLA 4EQCA 4QQ5A 3FYJX 4IZ5A 3UPXA 5KHXA 3U54A 4OTFA 1QPCA 2YWPA 5HVYA 1YXVA 3DGKA 2VO0A 3DTCA 1XBAA 2UZTA 3GB2A 3CJGA 4C57A 4FTKA 4FC0A 4Q5HA 5BUJA 1OIQA 4IDTA 3UQGA 1KOBA 3ZH8A 2UW8A 4ZAUA 4GG5A 4ACDA 5CTPA 2W4JA 4BDHA 4JQEA 4OBOA 4EK8A 1REKA 1OIUA 5DEWA 2VTHA 3NNXA 3EL7A 1H08A 3NUSA 2Z7QA 3QBNA 4GS6A 5DT4A 3F5XA 4F64A 1OKVA 3RPSA 4OAVB 2FSTX 2A2AA 4NM3A 4E6AA 5I9ZA 3RI1A 4AFEA 1KUTA 2BUJA 4I24A 3ROCA 1Y6BA 4GVAA 1WVWA 3DBEA 3FI3A 2GNGA 4IH8A 5AX9A 3Q9WA 4YBJA 2H8HA 3FY2A 4M13A 2QOOA 5DOSA 1YKRA 2B0QA 4NZWB 2WD1A 2W1IA 1MRYA 1PJKA 3IG7A 3KKVA 4KD1A 5J95A 5KKRC 4CCBA 4G16A 3DOGA 4DCEA 3ODYX 4IAAA 5CU0A 3E8EA 3RTPA 4QNAA 3QZGA 3F3TA 2HOGA 3DKOA 5A9UA 2BDJA 3QXOA 2J0JA 2YCRA 4M0ZA 4AUAA 3LM5A 4KB8A 5IQGA 1MP8A 3VBWA 4EOJA 5AAGA 2WMWA 4JXFA 2WNTA 2JDSA 3FL4A 4U3ZA 3G2FA 2HY81 2H6DA 5EI8A 3RPYA 5FGKA 4N70A 5JZJA 2PL0A 3NSZA 4JG8A 3AQVA 5L6OA 3I7BA 5A6NA 3W2PA 1OL2A 3Q4CA 3T3UA 4CFMA 4X0MA 2XM9A 1MQBA 3COMA 4I6BA 2BDWA 3BLQA 4FSRA 4Y46A 4ANNA 2PMNX 4FI1A 4KABA 3H30A 5BPYA 4GW8A 4ZTSA 1YW2A 1VZOA 4XV1A 2GHLA 4ZSAA 2XVDA 3RCJA 1WBNA 3W1FA 3C1XA 1TQIA 3IQ7A 2X9FA 3MFTA 5AM6A 3W8LA 5L2QA 4B8MA 2OF4A 1OUYA 2GNFA 2ZMDA 4YTHA 3E64A 3KRWA 1EH4A 1WBPA 3AXWA 3FHIA 4R8QA 2CN8A 2YM6A 4MF1A 5AP6A 4ZXTA 1M52A 4DN5A 2EXEA 4J8NA 4RJ4A 3HAMA 4YJQA 3VS4A 1A9UA 5LMBA 3V6SA 3KREA 3FMNA 4HYUA 5HNBA 3ROYA 1SZMA 4X3JA 4P90A 3B2TA 2ERZE 2O64A 3L8PA 3SRVA 3UE4A 2EXMA 5GJFA 4ZJVA 5IA4A 4KIKA 3R22A 2O0UA 1FINA 4DHFA 2ZV9A 4TYEA 3ZYAA 4FF8A 4PQNA 4PDSA 2IW8A 4HVHA 4DFLA 4KBCA 3HAVA 3WZUA 1IASA 1M7NA 4OTHA 4ZS0A 1G8AA 3VVHA 2CN5A 4RC4A 4U80A 3ZC6A 2IG7A 2JD5A 3RPOA 4F99A 1H07A 2J2IB 3UBDA 2GTNA 3CS9A 2HXLA 3O7LD 4L9IA 4ANSA 3GGFA 4QRCA 2QI8A 4NIFA 3OEFX 5D7AA 3QCQA 5E1EA 1YOLA 2BDFA 4EH6A 2CPKE 2AYPA 5FUTA 4DF3A 3TV7A 2PVRA 1GZOA 2IVTA 2QO7A 4MBIA 2GFSA 5CAQA 4AP7A 4BCIA 4UXQA 3UG2A 5LCKA 4I1ZA 5CSXA 2I7QA 3U51A 4PMTA 4YO6A 3RJCA 4XOZA 5E8WA 4R5YA 4MK0A 3GQLA 1FVRA 1YHVA 3MJ2A 2XNNA 1J91A 2WXVA 5D7VA 2W1DA 1DAWA 3FL5A 2UZUE 4MBJA 4ZTHA 3FKLA 1IA9A 2Z02A 3BU3A 2ITUA 3P86A 1QPDA 4IZ7A 5A4CA 1PXMA 2NRUA 3PPKA 2AC3A 2VWIA 4DE4A 3PA4A 4IC7A 3WZDA 4OT5A 5IEVA 3OW4A 3UNZA 3PA5A 5ANJA 5AAFA 2BR1A 4DGGA 1PXPA 4AE6A 2VWYA 3PXZA 5HORA 4RMZA 3M1SA 2IVVA 4WO5A 2RFDA 3O8UA 4TTHB 1U5RA 2YCFA 3BLHA 5HO8A 3I6WA 1ZZLA 3QFVA 3GFEA 3PWDA 4FVQA 4QP7A 2HYYA 5H9BA 3TKHA 4G34A 3WARA 2UVZA 2Q83A 5CEOA 2UVXA 2W1GA 4P7EA 3W18A 3OS3A 3P5KA 4I6QA 4DBNA 1Y57A 1YHWA 2YDKA 2GNIA 4MXAA 2PUPA 4U8ZA 3R2YA 3UGCA 4TYGA 4P5QA 3W2RA 5IA3A 4JBVA 2I0YA 4EZ7A 4ZEGA 5HKMA 1B39A 3OEZA 2UZBA 1I44A 4UZHA 1H1QA 4CRSA 3SDJA 4KBKA 3SV0A 2B9FA 2ZOQA 1XH5A 1Z57A 2YM4A 4FV6A 4CZUA 2WEIA 2UW0A 1Q62A 1UWJA 3QC4A 4QMXA 3K54A 4FT0A 1FMOE 3QUPA 3B8RA 5KNJA 3DNEA 4BR3A 3OCTA 3GC0A 2PK9A 4FKQA 3VS3A 4IDVA 5CF4A 1MUOA 4LL5A 5DI1A 4ENYA 4TXCA 5EYCA 3KU2A 3UP7A 4O7RA 2V7AA 3PXYA 4R5SA 3TZ7A 5AAEA 2W17A 5EM7A 4UBAA 5CAOA 2UW4A 2BVAA 5CU2A 4ZTRA 3EQRA 3HVCA 3T8OA 4BI0A 1ND4A 3CPBA 4IBMA 3ZFMA 4DG3E 5AFVA 4EL9A 4FTOA 2R5TA 3Q60A 2QG7A 5A6OA 5JMSA 4W4YA 4IB3A 4ZLOA 2XKDA 3PP1A 2X8EA 4A06A 5DR2A 3UPZA 3NRMA 4R1YA 4XG7A 5AP1A 3E8DA 2YM5A 2XJ0A 4NUSA 2RFNA 4TNDA 4EBVA 5DYJA 4LG4A 4V01A 4MH7A 2F4JA 2UUEA 3DKCA 3LXKA 5J1VA 5DR6A 3FXZA 2WMUA 4Y72A 3BHVA 4ZOGA 3HV6A 4LQMA 5E8ZA 4DTBA 5IQIA 2CLXA 3BYOA 3N9XA 3VBVA 5LVNA 4PDOA 4YJPA 4C38A 4XLIA 4A9YA 3TKUA 4E4XA 2XRUA 4LL0A 1KV2A 5JRQA 1JWHA 4FSYA 4H39A 2F7ZE 2F2UA 4FGBA 5D10A 4BWPA 4AW2A 3OZ6A 4ONAA 4GKIA 4BCNA 4FNYA 3H9RA 1ZRZA 1ZXEA 5G6VA 1Q8YA 2A4LA 4KKHA 5J87A 5AA9A 4U6RA 4YSJA 4UX9A 3EHAA 4IANA 1QCFA 3FC1X 4EUTA 4GJ3A 4AQCA 3VWAA 4J8MA 3QD0A 2XIXA 4RA5A 4W9WA 4AT3A 1PXLA 3UQFA 4JLCA 1FOTA 5E8SA 4FEUA 2E9OA 2WFYA 4OW8A 3NGAA 4P2KA 1J7IA 2PPQA 2OF2A 2W4OA 2OJGA 1P4FA 5FDPA 3CSVA 4NL0A 3F88A 4B99A 3KRJA 1XH7A 3R28A 4AGUA 2QOQA 1PXKA 2YA9A 3EYGA 3H9OA 1L3RE 4FG9A 4FKLA 4GT5A 3W2SA 4FEVA 2WOTA 2XKCA 3QCSA 2GU8A 4XG4A 5DNRA 5KX8A 3ZZEA 2W06A 5EI6A 5BVEA 3F9NA 2C69A 5CWZA 2ZV7A 4C2WA 3FZ1A 4ZZNA 1OL7A 3RPVA 3HZTA 4CV9A 4U5JA 1K2PA 3UVQA 3MV5A 3HDNA 5HIDA 5AUXA 3TEIA 3EQBA 3MDYA 2PWLA 3DB8A 3PXFA 3QA0A 4J1RA 5DFPA 3LFFA 4TL0A 4JRVA 2XNPA 5GIPE 1XH9A 2WHBA 3QRTA 4FV0A 3PVGA 5CEQA 2W5AA 4QD6A 2YIYA 4TN6A 4U45A 4X6RA 2VRXA 4A07A 1GY3A 3Q2JA 4IC8A 4YJTA 5C4KA 4O81A 1Z5MA 3MPMA 4TPTA 5DWRA 2R3FA 5ANIA 3RP9A 5K0KA 3G0EA 2BKZA 2PVYA 2R7BA 5AJQA 4D1SA 4E6CA 2E9UA 4FG7A 4GJ2A 4ANBA 1J7UA 2E9VA 2IVSA 4FICA 1F0QA 4UMQA 3L9MA 4MNEB 1J3HA 3WI6A 5DIAA 5ANGA 5AUVA 4D2PA 2E9PA 3QGWA 2XYUA 5AX3A 3HRBA 5LQFA 1JNKA 4CKRA 2ONLC 4M8TA 5CS6A 3LMGA 2EXCX 2BZIB 4OTRA 4N0SA 4ZSJA 4AA5A 4FZ7A 5KMOA 4O91A 4EH3A 4ALUA 2X2MA 2WIHA 4X7QA 4C3RA 2W4KA 1HOWA 4MYGA 1YXTA 4FTCA 4M69A 1CSNA 2UV2A 3R1SA 5HGIA 4QMPA 4XH6A 4AW0A 4RIXB 1WAKA 3FMMA 4YSMA 3CCNA 4KBAA 3W55A 1XR1A 2ITYA 3DAEA 3VJNA 5IQHA 5HTIA 2UZDA 2WMQA 3RPRA 3O50A 1JAMA 4ZSGA 5EW8A 3CQUA 4NFMA 3VS6A 5C9CA 4ANMA 4F7LA 5EKNA 3VUGA 1FGKA 3V51A 5AUTA 2W9FB 3V5WA 5I9VA 2G2FA 4UYNA 5LXMA 3OW3A 2PVMA 3D5XA 5FXQA 3U87A 2H9VA 4AN3A 3FSFA 4IVDA 5KMKA 2YDJA 4Y85A 3G51A 1PY5A 3WILA 4BWXA 2QOKA 5CXHA 4TZRA 4J97A 4ACMA 4XV2A 5T6KA 2W96B 3NWWA 4PNIA 4ZK5A 4V0GB 3ZOSA 2C5VA 2CGUA 5BVDA 2C6KA 3AGMA 2QLUA 4RZVA 4O2ZA 1OITA 4AA0A 5A4TA 1SYKA 2QURA 2B53A 5HEZA 4CD0A 3HUBA 1OKYA 3UO5A 4Z55A 2VZ6A 2Y7JA 4JDJA 3NCZA 3SW7A 5EH0A 1B38A 3R02A 5DA3A 4I5MA 4PL3A 5FEDA 3W2CA 3PXRA 1KV1A 1GAGA 4LRKA 5CENA 4HYSA 5KMNA 3R7IA 2WTKB 4E7WA 4E6DA 4FTIA 4NCTC 4CV8A 4QMQA 3RALA 2O63A 2OJIA 3TI1A 4F9CA 4NJDA 5IQDA 2HIWA 4MF0A 4ACGA 4MBLA 3R6XA 2G01A 2WTCA 2ZAZA 4PMMA 4GV1A 2J51A 3R1NA 4GCJA 5IDPA 1XWSA 3D2KA 4L8MA 1R39A 3DA6A 1WBSA 3VW8A 3KGAA 1UV5A 4G6OA 3MH1A 2BRGA 5E8YA 4IAFA 3CGOA 1Y91A 4QOXA 5I3OA 1CMKE 1OL6A 3MFSA 5LOHA 4O7YA 4M12A 3BE2A 4K2RA 4C37A 3HV4A 3KMUA 2RKUA 3O71A 2V5QA 2EWAA 1WMKA 4YJRA 2CKEA 3PJ3A 5EYKA 1CKJA 2WKMA 4AW5A 4AT4A 3LMHA 2WTDA 4E4NA 4NCTA 3H0ZA 2R3HA 2XCHA 2ACXA 4YJNA 3IW7A 3D2IA 3CY2A 5LMKC 4YPDA 3CJFA 3Q4TA 1AD5A 1ATPE 4QMUA 5E90A 1UWHA 2GNHA 2QKRA 3QRIA 5KHWA 3A8XA 2CJMA 3PZHA 3NW6A 4FT9A 3MA6A 3AD6A 2IZTA 4IX4A 3EIDA 4U3YA 3KB7A 5JQ5A 3IW4A 5HG8A 3I7CA 3QKMA 4O21A 3ZONA 4S33A 5AUWA 1J1BA 1MRVA 3ZDUA 2CKPA 2QR8A 2YITA 3OWPA 3OXZA 3OXTA 5B0XA 2QONA 1ERKA 2R3OA 4WNMA 1PMVA 4BKZA 2DS1A 4CQGA 3ZSIA 3DK3A 2BHHA 3V6RA 4RX5A 2X8IA 3DTWA 2VTSA 5JN2A 4G3EA 2OLCA 3P9JA 2X4ZA 4C0TA 4E73A 4KSPA 4O86A 2QCSA 4YR8A 3MJ1A 4C02A 5B2MA 5CQWA 2CSNA 2W1HA 1IEPA 4FSQA 4WBOA 5M56A 2WQMA 3ZO2A 3GXLA 3WIGA 4I6HA 1Q8ZA 4J52A 3ZO4A 4AS0A 3H9FA 3WZKA 4U81A 4MQ2A 3WOWA 3U6IA 2I40A 2YISA 4EOOA 5HX8A 5EQEA 4W9XA 1BMKA 3QLGA 2VV9A 4PDPA 4XP3A 3OF0A 5DVRA 3FQSA 4D1ZA 1IR3A 4ZY4A 1SMHA 3PYYA 3ID6C 4XMOA 4FIGA 4DEHA 3MH3A 4U41A 4BL1A 4RJ7A 1OUKA 1Q8UA 2B9HA 4TKSA 1G3NA 1Q4LA 4FIIA 4GYIA 4I3ZA 2GNJA 1DS5A 4RC3A 2QD9A 2C6DA 1H25A 3NUPA 3N4VA 2WOUA 5F9EA 3ZEPA 3UNKA 3VF9A 4PF4A 4OAUC 4BBFA 4XRLA 1NW1A 2XIKA 5H3QA 2YHVA 4DH5A 3BHYA 3ORKA 1FPUA 3HNGA 3EFJA 4AT5A 3ZM9A 4FV7A 1KWPA 2JFLA 2Y0AA 4MNEA 4XX9A 4PNKA 1IG1A 4W4XA 5KZIA 4EH8A 2VWWA 1WBVA 3F7WA 3TUCA 3DT1A 4EZ5A 1UU7A 3BV2A 4O0UA 4BZNA 1YDSE 2C3IB 2UZOA 5CASA 1OBGA 2RF9A 3BPRA 5L6WL 3CR0A 5M06A 2ZMCA 3BLRA 4FYOA 4IJ9A 3UOJA 3MB7A 3GENA 3QQHA 4UMUA 3UIUA 4RZWA 4OTQA 4XG2A 4MAOA 4TWNA 5C4LA 3LZBA 1BI7A 3PE1A 3RM7A 4JOAA 4EC8A 3TN8A 2ZB0A 1Q3DA 3D5UA 5A4LA 4RIXA 4QMTA 4WIHA 3MGYA 1UVRA 1XH4A 2DQ7X 3EQCA 4IXPA 5DN3A 3TKIA 4EORA 5HBJA 3SRVB 4FKVA 4QTDA 3ZEWA 4BGHA 4KIKB 5JFXA 1G5SA 5E8VA 2QHNA 3FQEA 4GL9A 5F4NA 5FTOA 4YZBA 1UNGA 4QNYA 3LFCA 2C6TA 1AGWA 4F9BA 4EH5A 2X7GA 3SG8A 3DCVA 1YRPA 3IO7A 5IQBA 2QU6A 2WGJA 4G2FA 4OBPA 4FEWA 2OU7A 2YCSA 4G3CA 4YJSA 1LEZA 2PZPA 3MI9A 4G6LA 5J7HA 4DH1A 1H24A 4EYMA 3BU5A 3V3VA 1JQHA 3LCDA 5I9YA 3A62A 3BE9A 3F82A 3MIAA 4O0YA 1W84A 2C30A 4RA4A 5J9LA 3F2RA 1O6KA 2BRHA 3CEKA 3LCSA 4FV2A 4BDAA 2G15A 1UKIA 4IWDA 3MWUA 4IM0A 5FM3A 2PE0A 4FUXA 2UW5A 2XJ1A 3P79A 3DLZA 3G5DA 4OLIA 4RGJA 3ZXTA 2EB2A 5T68A 2YIXA 4A9UA 4EOPA 5I9XA 3PUPA 4BDJA 3KMWA 3R63A 3FPMA 4L3PA 3A4OX 5IKWA 4AZWA 4AN2A 1WBTA 3BI6A 4LUEA 4CLJA 2O65A 4WRGA 2IVUA 2UW6A 3D0EA 5BYYA 4L6QA 3I5ZA 1I09A 2CNUA 4ACCA 4ITIA 3VN9A 3R8VA 3GU5A 4FT7A 3W33A 3DJ6A 3RHXA 3ODZX 5CSHA 3UZPA 2OGVA 2VWBA 4D2WA 2BTSA 2ZV8A 4ZIMA 4CZYB 4CG9A 5FD2A 4R77A 2XRWA 3BYVA 4IVAA 4ZMEA 3NUXA 4IWPA 3Q6WA 4LV8A 3DAKA 1JLUE 4MX9A 4PX6A 3C5UA 4FIJA 3NS9A 5FP6A 3RAWA 2IPXA 4II5A 2XH5A 4O38A 5GZ9A 3OROA 4XRJA 3ZSHA 4K18A 3FZSA 3QD3A 4L52A 3MFUA 4BCOA 3QYWA 5GJDA 3DPKA 3FUPA 4ITHA 5M57A 3DFCB 4J95A 3CLYA 2FUMA 2XBJA 3ZZWA 1ZYDA 4I22A 3CQEA 4JQ8A 3QHRA 4EBWA 1VEBA 4CKJA 1DI8A 1XO2B 2YM3A 4ZJJA 1Z9XA 3RNIA 2Q0BA 4FODA 5BMMA 4JNWA 3ZRLA 2J6MA 4BDCA 4CVAA 1JPAA 3A7GA 1W7HA 1WCCA 3A7JA 4QTCA 5E8TA 1BYGA 4WBBB 5EM6A 2RFEA 3LPBA 5I5ZA 5CQUA 5K5XA 5BMSA 2R3NA 5FM2A 2QOFA 3DZOA 5HE3A 4MWIA 2RFSA 4LGHA 2BZHB 3OWJA 3F5UA 4QP2A 3FBVA 5HO6A 2Y4IC 1YDRE 4I41A 4C36A 4RWIA 2XNOA 3PJ2A 3QTXA 5HQ0A 4JAJA 2UZNA 2BMCA 2YJSA 3LMIA 4BZDA 4FKRA 3CGFA 2BAKA 4KWPA 4B4LA 1G8SA 3RAHA 5C26A 2Y4PA 1UU9A 3TJCA 3O8TA 3GCPA 3KC3A 3NR9A 4IVCA 5D41A 4MXYA 4D4YA 4EHEA 5JQ8A 4BN1A 3TTJA 3L9LA 4IWQA 5HLPA 1LUFA 4FL2A 2RG6A 2ZYBA 4XUFA 4BTJA 5CU6A 1OPJA 3QUDA 3HV7A 3ALNA 4RVTA 2BROA 4H58A 2OH4A 2XK3A 2O2UA 2VTNA 3OT3A 4O1OA 5AP4A 4ZJIA 3VQUA 3TIYA 4C35A 5HESA 4Y95A 4F6WA 1H1WA 4DFZE 3DK7A 2GCDA 4X2FA 5IH6A 4IE9A 4MCVA 1OIYA 3S3IA 3U6HA 2CLQA 2XK7A 2ZM4A 2VWVA 2ITNA 3S4QA 2WAJA 4RX7A 4E6QA 3HYHA 4B8LA 5C1QB 2XNGA 4YU2A 4JI9A 3VO3A 4UWCA 3VBXA 4I6FA 5IA2A 1KE8A 4NW6A 1GIHA 1Q8TA 1S9IA 2HAKA 2WTVA 4FL1A 3BGQA 4OGRA 5F1ZA 3FXXA 2R0UA 4C4GA 4ZLZA 2I0EA 2BRMA 4B9DA 1U46A 3TNPC 4CMTA 1ZLTA 3GEQA 4XG6A 5LMAA 4J96A 3SHEA 4ZY5A 4G3FA 4GMYA 5HVKA 5E91A 1T46A 1GIJA 4JBOA 5M08A 5CANA 2PYWA 3NAYA 2FH9A 4JT3A 3IKAA 2PU8A 3VUTA 2J0KA 4AZSA 2CGVA 4E3CA 4KKEA 4E5WA 1YXUA 3L8SA 3C0HA 3L9PA 4QP8A 4RIOA 5HI2A 2JKQA 3O96A 2NP8A 4BBMA 2PZIA 3BIZA 2BRNA 5HBEA 5HICA 3PE2A 4C59A 2OW3A 5D9HA 3AC3A 3CD3A 5M4CA 4H05A 4PP9A 3QRUA 2XK6A 5AMNA 1IAJA 3MY1A 3ZO1A 4FT3A 4DEEA 2RGPA 5LVOA 3D5WA 2W1EA 4M68A 5CEIA 3BRBA 3UYTA 3WYYA 3ZFXA 2RG5A 4BB4A 4DCAA 4XHKB 4KINA 2XCKA 3ZUUA 4BHZA 1X8BA 1TKIA 4FTQA 3W2QA 3B8QA 4UV0A 1PXOA 4FV8A 5DPVA 4TT7A 1BUHA 5ETCA 2W1ZA 1ZYCA 2VTQA 3VBQA 5GZAA 4C34A 5IMEA 3QKKA 4XJ0A 4ZSEA 4ASDA 4DG2E 1H26A 1JKLA 4DEGA 1H28A 2ITQA 2X0GA 4ANLA 3QZIA 4AZVA 4J99A 4DFBA 1OKWA 4BIDA 3VS5A 3DJ7A 2W1FA 4KKGA 3R83A 4FSUA 3NUYA 2WEVA 4X3FC 5K3YA 5KMLA 4M69B 4RFZA 3EQGA 4EH7A 2UZVA 4WHZA 3IPHA 1ZMUA 3SXFA 4I5CA 2DWBA 3HP5A 4L7SA 3PRFA 5CF5A 4YMJA 1ZYLA 3FLNC 5J7BA 3F3VA 4ALVA 3OD6X 1YQJA 2V22A 4OBQA 3MYGA 5DRBA 4IAYA 4BCJA 2E2BA 2YJRA 3R9DA 4XNEA 1IRKA 4ITJA 1B6CB 2XK8A 4O83A 5BVOA 3HDMA 4A4OA 2YN8A 4LI5A 1DM2A 3EFWA 4GFMA 2C0IA 3BQRA 4AG8A 4ZS4A 3HA6A 4O0VA 3P7BA 4IB5A 3EN5A 3EJ1A 4RWJA 3RWPA 2PE1A 3KRRA 2WMXA 4D9TA 2C4GA 5M51A 2Z8CA 4CKIA 1PHKA 3MFRA 2KULA 3MB6A 4K8AA 5KCVA 2OIBA 4FZAB 2C0TA 3OC1A 3UOKA 3A7FA 3TZ9A 2XMYA 3IK3A 5KMIA 5JZNA 3MH2A 2VAGA 4H3PA 4RLKA 3N4UA 2C6IA 4F08A 3NAXA 3KF7A 3GVUA 4KUJA 4PL5A 3ZUVA 3A4PA 1YHSA 2HY0A 3JUHA 4FBXA 3KY2A 4WNOA 3W16A 3MY0A 5EK7A 5AV0A 5A3XA 3R73A 4G17A 4TYIA 1W8CA 1Q24A 3BWFA 1GIIA 4FTAA 4EQMA 5IQAA 5M07A 3ACJA 4F1OA 4B7TA 4S2ZA 2HXQA 4NFNA 4FEQA 3OY1A 1XH6A 2SRCA 5GNKA 3OP5A 3WF9A 4I94A 3OOMA 2GS6A 4Z9LA 3TJDA 4WKQA 4BZOA 4YLLA 3KXNA 4O84A 3HMOA 4QP4A 4QO9A 5CAVA 4YZDA 2PUUA 3FMEA 5EOLA 5AUYA 2OG8A 3QCYA 2GDOA 5C27A 4IFCA 4RVKA 1ZAOA 1OECA 3DJ5A 4IW0A 4O0SA 4U43A 1M2QA 2WQNA 4KIOA 4AW1A 1H4LA 3HRFA 2ESMA 3GOPA 3RK5A 2P33A 4AZEA 5DRDA 2VTPA 5JFSA 5IZFA 4J98A 5AR7A 5C8NA 3JPVA 3A7HA 3PVBA 4GEOA 3Q9YA 1JSTA 2PZRA 4YC3A 5LVPA 3PWYA 2W05A 3VBTA 4L00A 3SVVA 4EHZA 3FMLA 4C7TA 1ZY4A 3R7YA 4BIBA 4TWPA 1ZMVA 4ARKA 3BU6A 3C5IA 2XK4A 3G15A 2FO0A 3PG3A 4AZTA 4J71A 4AX8A 5B2LA 4RVMA 2VNWA 5DR9A 5EYDA 4EJ7A 3V8TA 3V04A 3FXWA 1S9JA 2R3MA 2XM8A 3LM0A 5TF9A 5AUZA 4C4JA 4F7SA 4L3JA 4I93A 5J5TA 5FTGA 3R9OA 3KQ7A 4BY9E 3FKOA 3QALE 2OJ9A 2ITPA 1GZKA 3ORTA 4IX6A 2I0VA 2WTWA 4RBLA 2ZDTA 4R3CA 4G5PA 3TNIA 3T9IA 4KS8A 5BVFA 4NKAA 5HG5A 2GHMA 3VAPA 2Z2WA 5LWNA 3F2AA 3JY9A 1NT2A 2ITXA 5T3QA 4HJOA 2PMLX 4RRVA 4FX3A 4C61A 3TACA 4WG5A 4KS7A 4ZZMA 3ALOA 4FSWA 2VO6A 2JIIA 3ZRMA 4CTCA 3LHJA 3K3IA 3Q32A 4L45A 4DFXE 4EH9A 3EN4A 3LCOA 4CG8A 3PSBA 2X8DA 4GRBA 1LR4A 4I21A 3WF5A 3R01A 1R3CA 3R9RA 3QCXA 3IDCA 4H3QA 3WF7A 2BILB 2WMVA 3DDPA 2R3PA 3OFMA 5L8KA 2XJ2A 3LE6A 3NDMA 1WVXA 4QYYA 2P2HA 3FZOA 5L4QA 5AP0A 3PY0A 3E87A 4GK2A 4DH8A 1IAHA 4EOLA 2YFXA 2QOHA 1QPJA 5DG5A 3LFQA 5CLPA 5M4UA 1JKTA 2F49A 4DT8A 2GFCA 3GU7A 3IOKA 2WMAA 2HWPA 2OJJA 3GUBA 5KMMA 1H0VA 4MD8E 4DA5A 3ORLA 5JGBA 2YCQA 4RX9A 1FQ1B 2YM7A 3E93A 4FV1A 5D11A 3MTLA 1KE7A 2VD5A 5ANOA 5HU3A 3HP2A 4EC9A 3C4FA 2CCIA 3OUNB 4DGNA 5C01A 2C6EA 2XNEA 3JS2A 2F7XE 3GP0A 2BTRA 3MSSA 4WG4A 3VF8A 2WU7A 2X4FA 3P4KA 3N51A 4R1VA 4APPA 4E4LA 5IPJA 4EKLA 4L01A 3EOCA 3GT8A 1PKGA 5KZ0A 1JSVA 3AC2A 5AWMA 4W4VA 4JS8A 4JDIA 2IZUA 4F6UA
chains in the Genus database with same CATH superfamily
5ETIA 3SD0A 3BHUA 4HZRA 4D0XA 5BUIA 3NZ0A 2B52A 4E8AA 5IA5A 3QZFA 3O2MA 1XBBA 2HW6A 3LAUA 2LGCA 2J0MB 4ASXA 4BTFA 3W0NA 5E9EA 3OBJA 3UDZA 1RDQE 5CI6A 2PVNA 2PY3A 2YERA 2BAQA 1GJOA 3ETAA 3TUBA 1H8FA 4JBQA 2HELA 2IO6A 2ONLA 4H1JA 4NJ3A 4QTAA 1FBNA 1U54B 5CY3A 3GOKA 1PXNA 1W0XC 5AR5A 3MY5A 4LMUA 3AC5A 4EOKA 3ATSA 3FHRA 3FEGA 4HGEA 3EQDA 4I5HA 2WQEA 4MUQA 2ERKA 3Q53A 3E5AA 4WA9A 4RC2A 5D1JA 5FWKK 1W2CA 4RJ3A 4DGLC 5JGAA 5CZIA 1RW8A 3FI2A 2OICA 3JVRA 1M14A 5KBRA 4P4CA 4NM7A 4EUUA 5FTQA 2ETMA 3ERKA 1V0PA 3LXNA 3ZBXA 3QL8A 4PP7A 4YJVA 4F0GA 3EL8A 4K11A 1L8TA 3UDTA 2WMSA 2F57A 4RWLA 4IEBA 4BCGA 4DH3A 4RLLA 4U42A 5IUHA 3DAJA 1YWNA 4YTFA 4WG3A 4TYHB 2VN9A 1JKKA 2VNYA 3AMYA 2CGWA 2VTJA 3C50A 3IDBA 2C1AA 5CVGA 4QPSA 3CIKA 4BDBA 4JR3A 3MA3A 5F95A 4BWKA 1H00A 5CVHA 3WZJA 2REIA 3EZVA 5EW3A 3BEAA 5E7RA 4DHJA 3ZLXA 1YVJA 1VYWA 1OGUA 3SXRA 3E8CA 4DHIB 4AF3A 4BTMA 4EKKA 4L43A 4F9WA 4MXZA 5BUEA 4U79A 4CT1A 2W5HA 4HVGA 3UNJA 3SGCA 4WUNA 2R3LA 5I9WA 5EI2A 3SA0A 1ZWSA 1F5QA 3KXMA 5DHJA 3KL8A 4IB1A 4DITA 2PVLA 3EKKA 3QGYA 2CGXA 2XKFA 3DK6A 4MQ1A 4QTEA 2C3JA 3AGLA 3QAME 4IZAA 2XIRA 3KXXA 4K1BA 2WTJA 5JFVA 3FLYA 1FMKA 4RIWA 2BZKB 4FK3A 4QDEA 3IOPA 4GFOA 2AUHA 3NYOA 3KXHA 1WBOA 2VTIA 2W7XA 2WQOA 2X9EA 1XBCA 3SAYA 1OVEA 3R7UA 5HE0A 4ORKA 1WZYA 3VC4A 3CD8A 3WE8A 3E3BX 2C6LA 3BLAA 4U0IA 3TWJA 3UC4A 4LV7A 5HD4A 3VUHA 3QUEA 4GT3A 4YO4A 4NTSA 2R3KA 3BYMA 4PPCA 4EONA 4PPAA 1NVQA 2IF8A 2Z7LA 4CQEA 4IB0A 4QYHA 3FWQA 3CKXA 4YZMA 5AR3A 2XNMA 1JOWB 2VU3A 4WT6A 4EHVA 3IECA 2OXDA 1APME 2JIUA 2UZEA 3ORPA 4XYFA 4ASZA 3OY3A 3RK7A 4OR5A 4YJOA 4DEDA 4CZTA 4TYJA 5CNOA 3COHA 3PVWA 4U44A 3R8MA 2J5FA 3DBCA 3TTIA 5CT7A 4CCUA 5IDNA 2IEWA 4PPBA 5LMKA 3H3CA 2A1AB 4IX3A 2VTOA 3FV8A 3R8PA 3TDVA 3R2BA 5CAPA 5CU4A 3D7TA 3UOHA 4O7WA 3MN3A 4HZSA 2VTRA 4DFNA 4O2PA 4FOBA 4CSVA 4CFNA 5AV4A 4FKWA 1PF8A 2V55A 2C6OA 5L8LA 4D28A 1ZYJA 4JDHA 1PYXA 3DZQA 4FZFB 2W9ZB 4QYGA 2HZ4A 1UU3A 3T9TA 4BCKA 3U8WA 3PJCA 3GBZA 3OHTA 4XV3A 3OTUA 3GCUA 3KRLA 2PUIA 3LFBA 1Q61A 1KSWA 3JVSA 4YUQA 1E1XA 1SM2A 2NNWB 5IH4A 2R2PA 4AFJA 3AT4A 5HU9A 3A99A 4LRMA 3RZFA 2VWXA 4EEVA 2VGPA 5CU3A 1FVTA 4RPVA 3G6GA 5CZHA 2R7IA 3AD5A 2AC5A 4O4BB 5CEKA 5AV3A 3FZPA 3BZ3A 2BIKB 3QTQA 4FNXA 3V5QA 4MEDA 4XS2A 4ZZOA 1VYZA 3DNDA 2OKRA 4O27B 1OKZA 5L6PA 3RHKA 4F7JA 5JEBA 3PVUA 4FTUA 3KK8A 3SXSA 1YWRA 1XKKA 4D55A 1E9HA 4BF2A 4EK4A 4Z7GA 4F65A 3DBQA 4UB7A 5HD7A 2X0PA 4GK4A 4ZMFA 1QPEA 1OB3A 3AC1A 4LGDA 2W0JA 5KKRB 4YZCA 4O0RA 1ZOGA 3BGZA 2ITVA 3PJ8A 3UMWA 4M67A 2R3GA 5M44A 2YDIA 2ZJWA 2Y6MA 5EHYA 4IQ6A 1RJBA 5FEEA 3JR1A 3S1HA 3CBLA 5HIEA 3UQCA 4GYGA 4LRJA 3UO4A 4UMPA 3AMBA 5DEYA 5BQ0A 2CKOA 2W99B 3TL8A 2BAJA 3DY7A 3ORXA 1Y6AA 2PULA 4R3PA 1DI9A 4E5BA 5BVNA 5D12A 2ITZA 4FUYA 4TRLA 4CNHA 2R64A 2I1MA 2XEYA 3QWJA 3VRYA 4ID7A 4FOCA 3EQPA 4BDFA 3NIZA 4S32A 1JSUA 3U4UA 4AN9A 4FSTA 4EWHA 3KN5A 5GINE 4G3DA 4FYNA 2J9MA 4O96A 2X2LA 1WVYA 2IZRA 1U54A 3Q2MA 3RKBA 5LCJA 4R7BA 4CEGA 1XJDA 2XF0A 3C7QA 3LXLA 4BCHA 3A7IA 4J7BA 3VS1A 4MXXA 4UXLA 1YXSA 3RGFA 3UOLA 1PMUA 4Q9SA 2Y8OA 4RJ5A 2YZAA 3QA8A 4TY1A 4YHTA 4CMUA 4J53A 3KCFA 3M42A 3QXPA 4FV4A 4XV9A 4YTIA 2GSFA 2JBPA 3HLLA 4UMTA 2A27A 3OVVA 4XG3A 2WO6A 5FQDC 5LJJA 5GIOE 5CEMA 2QOCA 2XEZA 3E62A 4EH4A 2FSLX 3CTQA 4FMQA 4WRSA 2JKOA 5HBHA 4TYHA 4D5HA 4H3BA 4GG7A 2WTKC 4I0SA 4M66A 4S30A 4F7NA 1Y8YA 4FE2A 1KOAA 4D5KA 3NMUF 2QNJA 3QU0A 2CMWA 3PA3A 1J1CA 3TG1A 4B0GA 2ZM3A 4D4SA 3GU6A 4DEIA 3EZRA 5J79A 2XARA 2YIRA 1PRYA 3DXPA 1JVPP 3D4QA 4HGTA 1JBPE 2YIWA 4YPSA 3EMGA 3FLWA 4QYEA 2JKKA 4K0YA 2BCJA 5J5SA 3NIEA 4DGOA 3R7VA 4CLIA 4Y5HA 3LFSA 3NVKI 3HUCA 5AR4A 5FRIA 3PSCA 3U55A 4FIEA 3MW1A 5HG7A 2G2HA 3S00A 3IW6A 1ZOEA 4FKIA 4F1TA 4AGWA 2R3JA 2V7OA 5HE1A 2OJFE 4DYMA 4O0WA 3THBA 4USEA 3SG9A 4HCVA 4IX5A 3G33A 4A4XA 4D2SA 3AT2A 4R78A 5AM7A 4NWMA 2X1NA 5EYMA 2DUVA 1T45A 3V01A 3G90X 5FXSA 4ZTQA 3QQUA 2R9SA 1STCE 3HX4A 3R8ZA 4JJRA 3SOCA 2YABA 5LARA 4KSQA 2JAMA 3E3PA 1CKPA 3C9WA 4H1MA 4C62A 3ZCLA 3E7VA 4BDDA 3SOAA 4AGCA 2PMIA 4FTLA 4I0RA 4AOIA 3BWJA 3DBDA 3KCKA 4N6ZA 4TNBA 4M7IA 3R8LA 3H10A 3PIXA 4NKSA 3B2WA 2FYSA 4BCPA 2X6DA 3ORMA 3PY3A 3NUNA 4ALWA 3A60A 5JK3A 3HGKA 4RQVA 5BVKA 2QKWB 4HCUA 3KN6A 5TKDA 3RMFA 1ZARA 3QTIA 5J8IA 5K0XA 2OXYA 5GJGA 2F7EE 2HZ0A 4BIEA 2J90A 5EQPA 4IAZA 4PL4A 2GNLA 4AACA 4DDGA 4KIQA 4I92A 2G1TA 4BCMA 2XK9A 5BX0A 2JEDA 4CFXA 2IN6A 3HKOA 4C4HA 4EH2A 1VJYA 1LP4A 2WIPA 1R1WA 5HVJA 4FIHA 4QQCA 2OIQA 1OBDA 4O7VA 3AOXA 3MS9A 5ICPA 3I1AA 5H8EA 1V0OA 3TIZA 4GVJA 5LWMA 4QMLA 3UDSA 4PY1A 4IIRA 3QTWA 2CHLA 3HL7A 3HMNA 3NLBA 3VUDA 4D2RA 5AR8A 3P5JC 3ZFYA 3F6XA 4W4WA 5CVFA 5FP5A 2GQGA 4CFFA 4FSNA 4DFYA 4EJNA 2JDRA 3LKMA 3AC8A 3ANQA 1CDKA 4FTMA 5CF6A 5C03A 3ZBFA 3I60A 4BGQA 5K4JA 3QQLA 5TOZA 2HZIA 2UZLA 3MVMA 5B2KA 3DKGA 4JG7A 2IW9A 4FZDB 4KRCA 1M7QA 5CSVA 3DU8A 1O6LA 3MVJA 3L8XA 3ZO3A 3QTRA 1TVOA 1W83A 1BKXA 2A98A 4K9YA 1SNUA 3FZRA 3KK9A 4UZDA 5BYLA 2UW9A 3AKKA 5C8KA 3FI8A 4A9RA 1BL6A 1P5EA 2BFXA 4GU6A 2P3GX 2YAAA 3RNYA 4JL9A 2WELA 3TV4A 3IGGA 4BVUA 4Q5EA 4UALA 3BGPA 2XZSA 3F5PA 4ZTLA 3QQKA 4HVIA 3K5VA 3QQFA 4O0XA 4CYJA 4BBEA 5F20A 3KVWA 4PRJA 3ZLWA 3NNUA 4EOMA 1UNHA 4FT5A 4KIPA 2CNVA 3QTUA 4F0FA 3BQCA 3K3JA 4YZ9A 5CNNA 4DEAA 1VR2A 5AEPA 3D15A 5AUUA 2YZLA 3W0SA 4FV3A 2WZJA 3EFKA 4GIHA 4F6SA 2BRBA 3OG7A 1A48A 4YLKA 5K4IA 4O0TA 4YLJA 2X39A 3TM0A 3OCBA 1W82A 2OFUA 4DLIA 5E8XA 3RWQA 2VO3A 2VX1A 3MPAA 4WNKA 1R0PA 4F9AA 3GNIB 4AAYA 3RVGA 4V05A 3V5TA 3F3UA 2QR7A 3WBLA 5IUGA 2WB8A 5M09A 1QL6A 4JDKA 5IEXA 4FZ6A 4BHNA 1O6YA 4FG8A 3OBGA 3R0TA 4G6NA 3RK9A 3SLSA 5CSWA 4M0YA 4WSQA 3LOKA 3SQQA 4Q9ZA 3R8UA 2C1BA 4Z7HA 4XLVA 2YWVA 2XIZA 3EN6A 3EN7A 3P1AA 4AGDA 4I4EA 3ZM4A 3AMAA 4XOYA 4YBKA 1H1PA 2OZAA 3ANRA 3G6HA 4FK6A 5FLFA 1NVSA 5C8MA 3UIXA 2GQSA 2F9GA 4IHPA 5FBOA 4M97A 5JH6A 2R0IA 3O8PA 3A61A 4CYIA 3POZA 4FGRA 3C4EA 3I79A 3NYNA 4NW5A 4QTBA 2C5XA 4CGAA 1R0EA 1NY3A 3IDPA 1ST4A 3NW7A 1OMWA 4D9UA 3C51A 4PTCA 5JKGA 2R3QA 3BBTB 2CNQA 2B55A 5IA0A 4ASEA 5ANDA 1F3MC 2R3RA 4LFIA 3TXOA 3ATTA 3M11A 4DT9A 3KULA 3JXWA 2JBOA 4D58A 5GHVA 3DDQA 4YNOA 3R7OA 3VNTA 3OUKA 3TNHA 4I23A 3LQ3A 4HPTE 4Q2AA 4JIAA 3UODA 4LMNA 2QOBA 5HCZA 3WZEA 4L46A 2V62A 5A4EA 4HOKA 3PUFC 2ETKA 2I6LA 2GTMA 2QODA 2O8YA 3E7OA 3GC8A 4JIKA 4RIYA 1JKSA 4LOOA 5CALA 5HCYA 3UJGA 1K3AA 3G0FA 4X2GA 5E92A 4BC6A 4FTJA 3CTJA 3Q9XA 3DS6A 4MXCA 5M4IA 4G5JA 3VS2A 2H34A 4EOSA 3NUAA 5A54A 4AOJA 3JY0A 5G1XA 5A14A 4V04A 4BTKA 2EB3A 4H36A 4TWOA 3BBWA 4X3FA 2PUNA 3ZHPC 4DH7A 4R6VA 2PVHA 1PMEA 4NSTA 1O9UA 5CI7A 2OXXA 3EWHA 3IW8A 3L8VA 4WOVA 5DT0A 3P7CA 4MNFA 4QMNA 5IA1A 4NM0A 4CFVA 4IZYA 3R1QA 4K6ZA 3GC9A 3EH9A 3PIZA 3U6JA 2XP2A 3HRCA 4QMMA 2V0DA 5EHLA 2B9IA 3QC9A 4MD9E 3OXIA 1PMNA 2J7TA 4JX7A 1P4OA 3AT3A 3ITZA 1KE9A 3LFAA 1MQ4A 5EDPA 5ETAA 3DKFA 4EI4A 4OT6A 4IJPA 4ACHA 4QMWA 5FEQA 2G9XA 2HW7A 4YNEA 4F70A 3BV3A 4RVLA 4FRFA 2YACA 4DINA 5HO7A 3BX5A 4BFMA 5EM8A 1V0BA 2BIYA 2PSQA 3BHTA 3CP9A 3CTHA 4W8DA 3P08A 3RM6A 3ZUTA 2A19B 4QMYA 2C47A 2OO8X 5CYIA 3PIYA 5HNGA 5IUIA 2IZSA 3GC7A 5JT2A 4BJJA 4D2TA 1HCLA 4OTGA 4EK6A 4ANQA 4IAIA 4X6QC 4BRXA 2XA4A 2ITWA 3ORZA 4NU1A 4QT1A 4ZSLA 4G31A 3HV3A 4PWNA 5HE2A 3HEGA 4U9AA 4F4PA 2BKKA 3OMVA 4YC8A 3UMXA 4AXAA 3CC6A 3Q4ZA 4Z16A 5HNIX 3N4TA 2C5OA 3MVLA 4RIWB 3BCEA 4QMVA 1U4DA 3FYKX 3VS7A 3E63A 3SW4A 4E4MA 4IADA 4L7FA 4ZY6A 3MTFA 3Q9ZA 2VGOA 3I81A 4X2JA 1Y8GA 2JKMA 3VUIA 3F5GA 4RX8A 4YGAA 1Q41A 5IISA 2J5EA 3DXQA 3HMIA 4LGGA 3I0QA 2Q0NA 3AC4A 2QHMA 1Q5KA 3C4WA 3O23A 4MXOA 4TW9A 5EOBA 1FVVA 3KXZA 5ANEA 5CXZA 3L1SA 3FSKA 2OWBA 2ZDUA 2Z7SA 2PVKA 2DYLA 3F69A 4GK3A 2VWZA 4Y73A 3UZRA 2WMBA 4JQ7A 3R9HA 3Q4UA 1RE8A 4QMZA 3QQGA 2C5NA 4KA3A 4DDIA 3LCKA 5IG1A 3D83A 2XB7A 1WFCA 3C0GA 2KTYA 4NH1A 5LVMA 2JLDA 1YOJA 4ZTMA 3NYXA 1XMMA 4LUDA 2BPMA 3IW5A 3W10A 2QQ7A 5EG3A 2VTLA 1J7LA 1SVHA 5K9IA 3QZHA 2UW7A 3FJQE 3HECA 5AA8A 2J0LA 3BEGA 4MHAA 4BDKA 4CFUA 5CX9A 2OIDA 1K9AA 4EHGA 4FEXA 3D7TB 5DE2A 5L2SA 4JMQA 3U4WA 3HMMA 4IMYA 4UY9A 4QP6A 1W98A 2XNBA 2ETRA 5I9UA 3NNVA 4FV9A 3QX2A 3ORNA 5TO8A 3TNWA 4D4RA 4RJ6A 5IQFA 3SKCA 2PZYA 2XYNA 4GUBA 4EYJA 2XUUA 3TZ8A 2B1PA 5DGZA 3PLSA 3UVPA 4BKJA 4FKGA 2YAKA 3OWLA 2R4BA 3K5UA 3LCTA 3AD4A 1CTPE 4Y8DA 5CF8A 3ZS5A 4O7TA 2HCKA 3DQWA 5EHOA 3FLQA 4FVRA 5B7VA 1R78A 2OBJA 5E1SA 5HG9A 3TZMA 4YC6A 1Q8WA 3CPCA 1BLXA 4FTRA 5AIRA 5ACKA 4BDEA 4EWQA 2FA2A 1TQPA 3PXQA 4JBPA 4O7SA 3EYHA 1CKIA 4NM5A 1SVGA 4FIFA 4I4FA 5IQEA 2VO7A 2XKEA 3QD2B 4MTAA 1WBWA 3PRIA 3PPZA 5TR6A 5HTCA 3ZLSA 5IMXA 2C6MA 2QO9A 4CT2A 2UW3A 4L44A 4YP8A 4ANOA 4C2VA 3V8SA 2JAVA 3WIKA 4GIIA 5DT3A 4U97A 4XP0A 2JFMA 3V5LA 2FB8A 4FKTA 3RCDA 1YXXA 5ACBC 3ACKA 4QP1A 3BHHA 3SX9A 4DBXA 4JG6A 3QHWA 4OTWA 5EDRA 5FBNC 5E4HA 4PMSA 2CCHA 3Q96A 4AAAA 2JDVA 5AIKA 5J9YA 3GCVA 3Q04A 3FKNA 3P0MA 3QTZA 2VX3A 3ENHA 4D0WA 2NPQA 3ULIA 3CE3A 4M15A 4FKOA 4M84A 4Y83A 1OM1A 2QU5A 4E26A 5I3RA 3FQHA 3Q6UA 2BALA 3U9NA 3FMKA 2QC6A 5ITAA 2OK1A 2FSMX 1REJA 1M2PA 3DBFA 3LXPA 1SNXA 4FKPA 4HGSA 2QG5A 3D7ZA 4L67A 4C8BA 5L2TA 4AZFA 1DAYA 2C68A 4GSBA 4ERKA 1XMLA 3F2NA 5ETFA 1U5QA 3VRZA 5HX6A 5JGDA 3RAIA 2HWOA 2UZWE 3R04A 4U40A 1OL5A 3KA0A 5AV1A 4D1XA 2A0CX 3TUDA 3QRJA 4G3GA 1AQ1A 5AR2A 4AQKA 2ZB1A 3PFQA 1QMZA 4FSMA 5AV2A 4F09A 4HCTA 4QPAA 3UP2A 2AEGA 2RSVA 3P7AA 4WUAA 2P0CA 1ZY5A 1PXJA 4S34A 4A7CA 3LFEA 4E5AX 2YLFA 3TCPA 2JITA 2I0HA 3COIA 3NCGA 4E20A 3IONA 2NRYA 4FL3A 3UO6A 4ZLYA 4WSYA 2Z60A 3QLFA 4GT4A 4Y5QA 4AWIA 3E8NA 2X7OA 4EZ3A 3LQ8A 3T3VA 5F94A 4Z3VA 4XG9A 4USDA 3ZMMA 4O82A 4IVBA 3DLSA 3I5NA 1YDTE 4BDIA 3PSDA 3C0IA 3WF6A 2EUFB 4ERWA 3FMDA 1M2RA 3P23A 3I4BA 2GS7A 3EB0A 4YURA 3KMMA 4O1PA 3FPQA 2WMRA 3TV6A 4OTDA 4HPUE 4UWYA 5DBXA 1FGIA 5EFQA 2ZFYA 4LOQA 2UVYA 2P55A 2YEXA 3COKA 4UYAA 1NVRA 3D94A 3TT0A 2OZOA 3PZEA 4KRDA 2LAVA 4GH2A 3ZSGA 4O6LA 4UMRA 3VW6A 2X6EA 3QD4A 3GU4A 3F3ZA 3DV3A 4X2NA 3VULA 1SVEA 3SC1A 4O7ZA 3F61A 3WF8A 1UNLA 5L8JA 3ORIA 3LJ2A 3NNWA 4AXCA 2WQBA 3FZTA 4PTGA 4IACA 2IWIA 3LFDA 5HHWA 3BL9A 5ANKA 1ZYSA 2YIQA 4N57A 5HZNA 4FKSA 2FSOX 3VS0A 5AADA 3JYAA 4QP3A 4TWCA 4FNZA 2VX0A 5EKOA 2PMOX 3MVHA 4W8EA 2OH0E 2WTIA 4R7HA 4C4IA 4DAWA 5H8BA 3DB6A 5BVWA 4EQUA 1ZZ2A 2BFYA 4G9CA 4YHJA 4I0TA 4RFYA 4O6EA 3V5PA 5HLWA 4FV5A 3VUMA 3NVMB 3C13A 2QVSE 5HIBA 2E9NA 1UA2A 4LOPA 2YM8A 2G2IA 4HGLA 4PTEA 3MBLA 2JC6A 4I5PA 5CAUA 2HK5A 2VUWA 3DXNA 3E88A 4FR4A 3VUKA 3W2OA 3P78A 3MPTA 3GCSA 3R9NA 4M3QA 1TQMA 5E8UA 1V1KA 3W0MA 3KEXA 2B7AA 3A8WA 4K77A 4LM5A 4QMOA 5EM5A 4AOTA 4CTBA 2C3KA 3S2PA 5M53A 4O7NA 4O7LA 5EQYA 3R71A 4HNFA 3GCQA 5HCXA 5J1WA 4GKHA 3OCGA 3KF4A 3PTGA 4QQJA 3IS5A 3F7ZA 4AA4A 3CXWA 4FKJA 3H0YA 3EQIA 4F1MA 1P14A 3C4CA 2EU9A 2JDOA 3LFNA 3GFWA 3H4JA 5FXRA 4YJUA 5IU2A 2B4SB 3REPA 3E92A 4OUCA 4NTTA 3LJ0A 5AP5A 2JDTA 2XS0A 2GS2A 2O3PA 3F3WA 2F2CB 2GHGA 1PKDA 3NYVA 2ITTA 3A2CA 4UEUA 1PXIA 5FDXA 5JRSA 1P2AA 2PVFA 3UIMA 2IJMA 2QO2A 3MIYA 2BZJA 5L3AA 3Q3BA 4FTTA 3EKNA 3QKLA 2C3LA 2PVJA 3LQ5A 3D14A 3ENMA 4FNWA 5L2IA 3BELA 3HMPA 5EW9A 1Q97A 2GQRA 3PDTA 4NT4A 3KRXA 4DEBA 2Y6OA 5BYZA 3FDNA 4XBRA 1OIRA 4LYNA 5A46A 1OZ1A 4GFGA 4G1WA 4YZNA 3VQHA 4R3RA 3LLTA 4I20A 5IH5A 4E1ZA 4BICA 3ZTXA 4XCUA 1RQQA 4BI1A 4X2KA 4N4SA 5H2UA 2J50A 2XBAA 2Y4IB 1XQZA 3NPCA 3QQJA 4HYIA 1ZMWA 3ZU7A 4B6LA 5KO1A 4D2VA 3O17A 3EN9A 4NEUA 3QWKA 1A06A 4FTNA 3UIBA 3ELJA 4BCQA 4P5ZA 5AP3A 4CMOA 3FE3A 3PY1A 3QF9A 3TDWA 5DH3A 4DLJA 4OTPA 4ZP5A 2J4ZA 4G9RA 4QP9A 3QTSA 2PZ5A 1OPKA 3R00A 4BCFA 2OFVA 1TFFA 4DFUA 3BKBA 4D4VA 5L2WA 5IEYA 3S95A 1PYEA 4MWHA 4HVSA 3W32A 3D9VA 3I6UA 3FY0A 2X7FA 1URCA 1IA8A 1GZ8A 3Q52A 4OTIA 1ZOHA 1GZNA 2OSCA 3G9NA 5GZ8A 3MESA 4O4CA 3GI3A 4BKYA 4C4FA 4DTKA 3PLAE 2VTTA 1KE5A 4QQTA 4GUEA 2JIVA 3O51A 3LJ1A 3AG9A 2PTKA 3KFAA 3ZXZA 4IWOA 1GNGA 2W5BA 3MH0A 4DC2A 3R7GA 4IFGA 2C5YA 3RAKA 5HOAA 4CRLA 4RJ8A 3BYUA 5JFWA 2GMXA 4RT7A 3KXGA 4FKUA 3NUUA 3C4XA 4PUZA 5I4NA 2FGIA 3UZTA 3NEWA 1E1VA 4JRNA 4O22A 2P4IA 4JAIA 3ULZA 2WPAA 5TE0A 4C33A 1Q99A 1YI6A 4RG0A 2RL5A 5AP7A 3W8QA 2P2IA 3IGOA 4NYEA 1H1SA 3HA8A 4L42A 1XH8A 4HYHA 4A9TA 4EK5A 4O4EA 4C4EA 5KE0A 5KUPA 2Y9QA 5IF1A 1UU8A 4AU8A 1Q3WA 2OZAB 4BI2A 2CKQA 4A4LA 1BL7A 3R7EA 1LEWA 4BYIA 3BL7A 2IW6A 1NXKA 3OCSA 1BX6A 1XHAA 3CY3A 4HVDA 1YWVA 2J0IA 1OPLA 3UYSA 4AE9A 4DG0E 2PE2A 3BYSA 3PJ1A 3G9LX 2VTMA 3NX8A 2HZNA 3L9NA 4CFWA 4MVFA 2RIOA 3PPJA 3K2LA 4PDYA 2X2KA 3OT8A 5JSMA 3KULB 3O0GA 3UC3A 3VHKA 4RFMA 3ZRKA 1BI8A 3FC2A 3CQWA 1NA7A 3CKWA 3UG1A 2OI4X 3QRKA 3QYZA 2YLEA 1YI4A 3I0OA 4F9YA 3PXKA 4KNBA 4EOQA 4L3LA 4QYFA 3Q5IA 2ZVAA 3F66A 4RWKA 2VTAA 2ZM1A 4UWBA 5CT0A 3VJOA 4DTAA 4RIYB 3C4ZA 3PG1A 4LV5A 4XG8A 3NW5A 2JGZA 3UTOA 4NIFB 2B9JA 4V0GA 5EDQA 3ET7A 3LVPA 3ZLYA 4BYJA 4GU9A 4X3FB 2H96A 2ZV2A 3RINA 3Q5ZA 1HCKA 5DMZA 1YI3A 1U59A 4JX3A 2HENA 1CM8A 1MRUA 4HNIA 3WE4A 4APCA 2GPHA 4MKCA 1H1RA 3ZC5A 4PMPA 4U7ZA 5I0BA 2WU6A 1KE6A 2WMTA 3LW0A 2R3IA 5CSPA 3LIJA 4WNPA 4WD5A 4QPMA 5FG8A 3KVXA 3UDBA 3D5VA 4AXEA 2W1CA 3PP0A 3OOGA 4XP2A 4FVPA 4MD7E 5M55A 2QLQA 4S31A 5KMJA 3EQFA 4ENXA 3LLAA 1URWA 2ITOA 2VWUA 4USFA 4M14A 3HV5A 3R1YA 1M17A 4JR7A 3DFAA 2XIYA 4XEYA 2Z7RA 3R30A 2C0OA 2X81A 4N6YA 5TT7A 3RBWA 1H01A 5DLSA 4KAOA 1LPUA 2NO3A 3V5JA 3VHEA 5KBQA 3EFLA 5HLNA 4QMSA 4C3PA 3UVRA 4C58A 3POOA 4RQKA 4PV0A 3NFGB 4IM2A 4E93A 4UN0C 1GOLA 2O5KA 3O7LB 3VBYA 4C3FA 3TMOA 4BJJB 3RZBA 1YOMA 4BGGA 4F63A 3QX4A 3FLSA 2PHKA 3VIDA 5LVLA 2BHEA 1PW2A 3OTVA 4FSZA 3EQHA 4YHFA 5A4QA 3GU8A 4HW7A 5BNJA 3FMJA 4R7IA 4ZTNA 4EK3A 4X21A 4A9SA 5AP2A 1OL1A 3S0OA 3FMHA 4F0IA 1UKHA 4IM3A 5IQCA 5K5NA 3WYXA 3AKLA 4XBUA 2CDZA 4NK9A 4DGMA 3U9CA 3FAAA 4K33A 2FVDA 3ZDIA 4L68A 4IAKA 3FLZA 5M4FA 3II5A 5CEPA 5HTBA 5H8GA 3M2WA 1H27A 2B54A 3GQIA 4RSSA 2EVAA 2QOIA 3FI4A 4L53A 4BDGA 3DQXA 4EOIA 4YTCA 3OWKA 4FA2A 1H0WA 3V8WA 5J9ZA 3R21A 4JVGA 3TNQB 4CXAA 1OI9A 2QOLA 4EQCA 4QQ5A 3FYJX 4IZ5A 3UPXA 5KHXA 3U54A 4OTFA 1QPCA 2YWPA 5HVYA 1YXVA 3DGKA 2VO0A