1Y6BA

Crystal structure of vegfr2 in complex with a 2-anilino-5-aryl-oxazole inhibitor
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
350
structure length
266
Chain Sequence
RLPYDASKWEFPRDRLKLGKPLGRGGQVIEADAFGIDKTATCRTVAVKMLKATHSEHRALMSELKILIHIGHHLNVVNLLGACTKPGGPLMVIVEFCKFGNLSTYLRSKRNEFVPYFLTLEHLICYSFQVAKGMEFLASRKCIHRDLAARNILLSEKNVVKICDFPLKWMAPETIFDRVYTIQSDVWSFGVLLWEIFSLGASPYPGVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTMLDCWHGEPSQRPTFSELVEHLGNLLQANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Vascular endothelial growth factor receptor 2
publication title Discovery and evaluation of 2-anilino-5-aryloxazoles as a novel class of VEGFR2 kinase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 92
structure length 266
sequence length 350
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2004-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1y6bA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1y6bA01
5DEWA 1OPJA 2VTSA 3PZHA 3VAPA 2C6DA 4XMOA 3UOLA 5BVOA 2RF9A 3GUBA 4U3ZA 4YURA 4QPAA 3PRFA 3UTOA 5FG8A 4C8BA 4AZTA 4FV7A 2CSNA 2ITOA 3PY0A 3C4XA 1JAMA 4FV0A 3WI6A 5HKMA 5L6WL 4BDKA 4DH3A 2AUHA 2WMTA 5CSVA 2J6MA 4D2VA 2X39A 5KBQA 1FVRA 4RFZA 3UC3A 3LFNA 4X3FA 2BFXA 1YOJA 5CU0A 2VD5A 2VWZA 4MEDA 4ZMEA 3FJQE 2O64A 1OB3A 5TF9A 2FSOX 3PXZA 4OT6A 1ATPE 3MDYA 4NTTA 2I0VA 4YO4A 4B99A 2VWIA 5KMMA 4LQMA 2FA2A 4BZOA 4U44A 4BTMA 3OWPA 2GSFA 4GV1A 4B0GA 4GIIA 3HV7A 3ATSA 4X3FB 3C7QA 1WVXA 2NP8A 3R63A 4TPTA 3VW8A 3PUPA 5DFPA 4MXZA 2QG7A 5J9LA 4D4VA 5CI7A 5DA3A 4ZLZA 4GK3A 5FBNC 3ZH8A 3IW4A 4G16A 1Q8TA 2ZB1A 1YWVA 2QOQA 3CIKA 3R2YA 2W06A 4JT3A 4EH6A 5DMZA 1JQHA 3R9NA 2PVMA 4O82A 3N9XA 4AW0A 2QKWB 4UV0A 3R7YA 5FUTA 4M14A 5HLWA 3JY0A 4OTWA 3A60A 4PUZA 3WF7A 4YLJA 3EZRA 4FKGA 4QPMA 5KE0A 2C5VA 2CKPA 3DDPA 3JS2A 3AC4A 5AP1A 1PKGA 4L53A 3M1SA 5D7VA 5HG9A 2RFSA 3OF0A 4QP8A 2ZOQA 3FMMA 3P23A 4XLIA 4IM3A 5FEQA 4HVHA 1OKVA 3B8RA 5BVFA 4TW9A 3C0GA 5EDQA 2IVTA 3CE3A 4CTBA 2F2CB 2JIUA 3QTWA 3KU2A 2X7OA 5EKOA 2BMCA 4L8MA 1SNUA 3SRVA 3BU5A 3PA3A 4DHFA 5HBEA 4J99A 4DT8A 4BICA 2ZV8A 3KL8A 4RPVA 3HV4A 3QCXA 2W17A 2SRCA 4D1SA 4WRGA 3CTQA 4OT5A 3ZLSA 2CGUA 2PUPA 4ZEGA 1RDQE 3OCTA 3WIGA 3LMHA 4AWIA 2BVAA 2WMSA 5L2IA 3O7LD 3SRVB 4ITJA 5LMKC 3DQWA 4EK8A 3E7VA 2CNQA 2I7QA 1I44A 1URWA 5BYYA 5J87A 5L2WA 5HX8A 5M51A 3TDWA 3U8WA 3PE2A 3VQUA 3GU8A 1OPKA 3SA0A 3KRLA 3NIZA 2C1BA 3ZM9A 5HG7A 4HYSA 3FMLA 3CGOA 5AX9A 5M55A 4C36A 4NIFB 2CNVA 2YZAA 1BI8A 3GOKA 4S34A 4QQJA 2V22A 3FQSA 3H0ZA 3OXIA 1UVRA 4ONAA 5CSWA 5H9BA 4DEAA 5KHWA 3CLYA 2WMUA 2O2UA 3RBWA 1PXMA 2IZTA 3R9HA 3H9RA 3VBTA 1Y8YA 1GJOA 1GNGA 2VO7A 3JYAA 4K2RA 5CX9A 3NVMB 4KINA 4TNDA 4H1MA 4EOMA 5EI2A 1CKJA 5AV1A 4ZJJA 3JVSA 4GFOA 4PV0A 4FL3A 5AMNA 2VZ6A 1JOWB 3NUUA 4NTSA 4ALWA 4CLIA 2R5TA 3FBVA 3IS5A 4OTGA 4PDOA 3RK7A 4FF8A 1JPAA 3KRRA 2VWBA 3PRIA 3UE4A 3F3UA 4BZDA 3IGOA 4ZSAA 1YDTE 4L68A 2WTIA 4C33A 1YXVA 3ORNA 3L9NA 4XRLA 4C61A 1OPLA 3F5XA 5AUXA 5EOBA 4EONA 2F9GA 5I9YA 4O0RA 4FV6A 1O9UA 4PDSA 5IF1A 5A4LA 4JIKA 3LLAA 4NJDA 5CENA 3QTIA 3R02A 2AYPA 3HGKA 5JN2A 3BCEA 2BTSA 3F2RA 3TNQB 4R7IA 3EFWA 4TYIA 2PVNA 2RIOA 3IPHA 4BR3A 1JKTA 3QQFA 1CDKA 3RK9A 4C3RA 4MNEB 1XR1A 4YMJA 2OIQA 2BAQA 5M4IA 2Y7JA 4O86A 1PMEA 4KRDA 4AACA 3G5DA 4FKJA 3ZHPC 4F63A 4GYGA 1M7NA 3CPBA 3P79A 3Q9ZA 3V5QA 3P78A 4RG0A 2ITVA 3MJ1A 3PXFA 4EQCA 4RFMA 2NNWB 4GKIA 1QPCA 1YDSE 2GQGA 4DEDA 5AAFA 5C03A 4P5QA 5HNGA 1YXXA 2JC6A 3V51A 2EU9A 5AR8A 5J9YA 4LRMA 1S9IA 5ACBC 5IDNA 5DR6A 3LCOA 1FVTA 1OITA 5IA3A 4Z3VA 4YJRA 3DAKA 3DXPA 1XQZA 2BALA 4I3ZA 3QQUA 2C69A 4Z9LA 2Q0NA 3R8UA 5A46A 3IW7A 3D4QA 1PF8A 5EYKA 4AE9A 5BPYA 4YPDA 3BU3A 2WQEA 4JG7A 4L42A 3NMUF 2R3HA 4WBOA 3GVUA 4ANOA 4ZTLA 3HV3A 5TR6A 3L1SA 1RQQA 1K2PA 4K0YA 2YWPA 4HVIA 1BKXA 4N0SA 4I5HA 2B52A 2HXLA 2C68A 3FZRA 3QD3A 3P7AA 2VNWA 5G6VA 2C0TA 4YP8A 1FMKA 3EN9A 3F66A 1DM2A 5IUGA 4EOJA 3ULIA 2V7OA 3KXHA 5HEZA 3UZTA 2FYSA 3CD3A 3TZ7A 1ZOHA 3DKOA 2WNTA 4HNFA 3OWKA 2PZIA 4EOIA 1ZYJA 4FSMA 1Q8WA 4DC2A 2RFEA 3MV5A 3PPKA 4FUYA 3AXWA 3HV5A 3FQEA 1PHKA 4X2GA 3UPZA 4IX4A 5CVHA 4FI1A 3RPYA 2XVDA 2VTLA 4FKIA 3ODZX 4FTOA 4D2WA 5BX0A 2JAMA 3PDTA 2V7AA 4RC2A 2UW4A 4FNYA 4X6RA 2JDVA 3MYGA 4FVQA 4CTCA 5KMKA 2WTVA 3GBZA 3DBEA 1UU3A 5L2QA 5CEQA 3SHEA 4HYUA 2HZ4A 2W9FB 4CXAA 3DK7A 1BI7A 4BIEA 4BRXA 2V5QA 3DXQA 1H1PA 4X2JA 2P55A 4FOCA 4A9SA 5AR7A 4KIKB 1MQBA 2V55A 3RPVA 4U6RA 3MVMA 4EOQA 1PJKA 3BYOA 4DN5A 3F3WA 3KB7A 1QL6A 3R1QA 4FT5A 2PE2A 2UZVA 3A7HA 4K1BA 4J71A 4ASXA 2I0EA 4FSQA 4KIPA 3BELA 1CM8A 4IX3A 3TACA 3VO3A 4BDHA 1LUFA 4JLCA 4K8AA 5ETFA 4RIXA 4BHZA 1V1KA 1KE8A 2CMWA 3PVUA 5CZHA 5HE0A 2XM9A 2P4IA 1PXJA 3EQPA 5HORA 5K5NA 4IZYA 3FI8A 2V0DA 3DQXA 5I3OA 4P90A 5IA2A 2IWIA 3TT0A 3LQ3A 1R39A 1T45A 5CS6A 1IRKA 4JR7A 3ETAA 2BUJA 2OH0E 2JITA 3H9OA 3ZDUA 2IG7A 4ACDA 1NXKA 2XIXA 4IM0A 5CASA 3AGLA 5IQDA 4KSPA 4IVAA 5T3QA 3S95A 1ZOEA 3D14A 4YTCA 3PJCA 1OIUA 4FGRA 2BRGA 3VNTA 5M44A 3ROYA 5H8GA 3UYSA 3NCGA 1VYWA 3MVJA 4RVLA 5LJJA 3NCZA 4WNMA 4DEGA 3CXWA 2QLUA 5KKRB 3NYXA 1BLXA 1KV1A 2OZAB 2AC3A 4AN2A 2E9VA 4FTJA 3UQCA 3AOXA 3QC9A 4HGTA 4AG8A 5A54A 3EQGA 4HYIA 3T9IA 5A4QA 1GIHA 4I24A 2VWXA 3W2SA 5JFWA 5J9ZA 1QCFA 4IZ7A 5JZJA 3T3UA 3VRYA 4NJ3A 1IA9A 3BKBA 2O63A 4IWOA 2WTKC 5E92A 3UBDA 5IQFA 4BY9E 2B54A 1WBVA 1XBAA 2H96A 2JKKA 4HVGA 4BDEA 4O7VA 3FSFA 2YN8A 2WTCA 4KA3A 4MBLA 5DT4A 5FDXA 3D9VA 3SAYA 4EZ7A 5M56A 3GFWA 2ERKA 5M4UA 1HCLA 4FEUA 2PZYA 5DNRA 3LJ1A 3OT8A 5AR2A 4IAFA 2BAJA 4NM3A 5CF5A 3DT1A 4XV1A 4FYOA 1DAWA 5F95A 5E90A 3TXOA 3COIA 5AV3A 2BZIB 4D4YA 3UNKA 1OMWA 2OXYA 4ZSEA 1YHSA 5FGKA 4CZUA 3PFQA 4DH8A 3MPAA 4CKIA 3ACJA 3DXNA 4GIHA 5ANEA 5CAOA 3DTWA 3QCQA 4ENXA 3PJ3A 4FTLA 3MFSA 3AGMA 4Q5HA 2BKKA 4U79A 3D2IA 3ANRA 4CT1A 1WFCA 5CTPA 2YCSA 4EI4A 3KMUA 2HK5A 2QO7A 4UZDA 4C4EA 5EYMA 1GZKA 4R1VA 5HO7A 2R64A 3VF8A 1GZ8A 4UWCA 2VTIA 2BZKB 3ALOA 4TWCA 2R3NA 4ZAUA 2NPQA 2WMVA 2IN6A 5BQ0A 4LRJA 1XH9A 3WE4A 3II5A 3PZEA 3CTHA 5TO8A 3TCPA 3AD5A 4HNIA 4L52A 2BHHA 3CCNA 3THBA 2VTMA 5CLPA 3AC1A 5AV2A 2Z7SA 4QMVA 4UALA 4M69B 5BMMA 3AC2A 3CBLA 4B8MA 1Z57A 2UZEA 3DFCB 4PL5A 4TYHA 5CVFA 3R1YA 4PPAA 2P0CA 5E8XA 4UN0C 2GS6A 3FI4A 4CYJA 4OTQA 4IANA 2YM8A 3CC6A 4BCPA 2XBJA 3NS9A 5B2LA 2XYUA 3LM0A 4QP2A 3LQ8A 5CSXA 5HIEA 3SV0A 3D0EA 4JR3A 1P4OA 4IHPA 4XNEA 4Y85A 2HCKA 1H1WA 3O8UA 3HP2A 3FZ1A 4I21A 1H25A 2W96B 2XYNA 3CS9A 4S33A 3C4EA 4IVCA 5HVJA 5J7BA 5AP0A 4KBAA 4F7SA 3K5UA 3SXFA 2QR8A 3G9LX 4RJ8A 1H1SA 2ZB0A 2BRHA 2VTAA 5CF8A 3AT4A 3FMJA 4LOQA 1UKIA 4IACA 2VGPA 4M68A 3FLZA 1QMZA 3EB0A 4V0GB 2F49A 5DT0A 2Z2WA 3IW8A 2BZHB 3NNVA 4Z7HA 1UWHA 2X4FA 4HOKA 5L6PA 2JLDA 4CQEA 3LMIA 5HG5A 4F9WA 2PTKA 3G6HA 4AAAA 5LXMA 3Q9YA 4FV1A 5IQHA 4NKSA 2J0KA 4FV9A 2CDZA 4FVRA 3OCSA 2WGJA 4UZHA 5LVNA 2XUUA 3HECA 3W10A 3LOKA 4BCOA 3RM6A 5ANDA 3TV6A 1ZY5A 1KE6A 1PRYA 3I6WA 4W4YA 3KCKA 4XHKB 4EH3A 5FLFA 3C9WA 5AUZA 4E5BA 1XKKA 3KKVA 2JGZA 3RK5A 3W33A 5JMSA 4MK0A 2X8DA 3QZIA 3EFKA 1OGUA 5CU2A 5EM6A 1AGWA 4EBWA 1REKA 5JT2A 1TVOA 4M13A 3VS2A 2J0IA 4CT2A 4G3EA 5C26A 3OFMA 3B2TA 3TN8A 5DN3A 3MBLA 4RC3A 3VF9A 4D9TA 4DF3A 3IOKA 4JIAA 5E1EA 2PMNX 4L7SA 3QUPA 1FBNA 4MD8E 3NW5A 2UZBA 3CJGA 4RWIA 3PIXA 1KWPA 5DBXA 4CRLA 4IAIA 4LV8A 4XS2A 3VS5A 4DCAA 2B9JA 1J3HA 4G9RA 3GI3A 1OZ1A 3DK3A 4DTKA 4O7NA 3QTUA 2GNJA 2UVXA 2QOLA 3QZGA 2RGPA 2WMRA 4IVBA 5IH4A 4I6HA 3OEZA 1P2AA 2W5HA 4AN3A 3ZOSA 4FTAA 4KKEA 1TQPA 4KKGA 4X3FC 1YI3A 2YCQA 2ITZA 3C0IA 3W2CA 4EHZA 1NVSA 2ZAZA 1PMVA 1F3MC 3FSKA 5KZIA 4R78A 3Q5IA 2G01A 3UJGA 3G51A 4BCNA 5EDPA 5M09A 3F3TA 1JVPP 3NUXA 1JSTA 3W8QA 4DLJA 4Y8DA 3MH1A 4JNWA 3MIYA 4FZ6A 4BCHA 4DFYA 4F1MA 3ZFMA 1H27A 4ENYA 1Q3WA 2JFLA 3FMEA 2QOKA 3FLYA 3OY3A 3PP1A 4BI2A 2Y6OA 3KQ7A 3KULA 5CEMA 3UVQA 3ZYAA 4QP9A 2CCIA 4C3PA 3CP9A 4BDIA 3VHEA 2PZ5A 1OIQA 3BE9A 3TZ9A 4E7WA 3V5PA 1MUOA 4AGCA 4F9AA 4CSVA 2E9UA 5EDRA 5A6NA 4APPA 1R3CA 3EN6A 4DGMA 4GW8A 3CJFA 3VS6A 4DGOA 3O96A 1H00A 2PVKA 2BRBA 3CKWA 4V05A 4F1OA 2PVLA 3NUSA 3R8MA 1GZNA 5D41A 1YXSA 4D58A 1AQ1A 4EJ7A 5M08A 1JBPE 3LQ5A 4KIOA 2XIYA 3IG7A 3QALE 4H58A 4FIFA 4YNEA 3R8PA 3R9DA 4PDYA 5AP7A 3WILA 1PY5A 3DBCA 3W18A 3UQFA 4LFIA 2QHNA 3RPSA 2OJFE 3EN4A 4I4FA 3BYMA 4C3FA 1Y91A 5DEYA 3L9PA 5KBRA 1W83A 1M7QA 3EKKA 4ZY4A 4QMNA 4RZWA 4E5WA 3EMGA 2C3LA 4XG4A 1H1QA 4MXOA 3JUHA 5AUYA 3DY7A 2XJ1A 4FIGA 2FSLX 2ESMA 4PTCA 3IOPA 5EW8A 3TV4A 3UIBA 3BE2A 4TWNA 3QCSA 4RJ3A 5F9EA 5DI1A 5F20A 4L3LA 3RGFA 3Q53A 4AT4A 5BVNA 3BHHA 2J2IB 4JDIA 4JRVA 1YRPA 2BTRA 2QKRA 4U9AA 3R9RA 3OW3A 4IB0A 1YW2A 2R3QA 3QRUA 5FQDC 5ITAA 5GZAA 4ZTRA 4GJ3A 3NAXA 4TT7A 4BDAA 2E9OA 4Q2AA 4B7TA 3WZJA 3ZLWA 3UOJA 4WA9A 1M17A 1R78A 2F57A 4I23A 4F1TA 3GEQA 3PIZA 4TL0A 4QMUA 2BFYA 3OD6X 2RSVA 4QYFA 1W7HA 2OJIA 3Q9XA 4CKJA 2W4JA 4YHJA 2BR1A 4O7ZA 4CFWA 2H8HA 4I94A 5AA8A 3E64A 1U4DA 3HMOA 4Q9SA 4FKTA 4IBMA 1PXNA 2WU6A 3R8ZA 4L3JA 4YJUA 3IK3A 1ZY4A 3IDPA 5GINE 3F2NA 3OWJA 1XH5A 3RAHA 3WF9A 5C8NA 2O3PA 3TG1A 2HIWA 3BYSA 2HY81 3REPA 3PJ1A 4E4NA 1XH6A 2IZRA 1KV2A 3D5WA 1ZMUA 2ITXA 4R5SA 2C6KA 4WD5A 3EYGA 4XG9A 2LAVA 3MVHA 1J7UA 5LARA 4FKVA 3KVXA 3RZBA 2QD9A 4DFXE 4X2NA 4EZ5A 5IA4A 2J4ZA 3CTJA 2YJRA 2X2LA 3G0FA 1SVGA 3UO6A 4UEUA 2X7FA 3SC1A 5IA1A 4YPSA 5GZ9A 3NAYA 3OUKA 4UXQA 5KMNA 4G1WA 4LM5A 4RLKA 4F09A 3OCBA 4BDBA 1DAYA 3U4WA 3U87A 4WRSA 3A99A 2JEDA 3QYWA 5IEXA 4LRKA 4QTDA 2W7XA 1FMOE 2CPKE 3ZFXA 2ITUA 4MD7E 4LMNA 2BIKB 5E8SA 4X2FA 1XHAA 5AIKA 3BU6A 3GB2A 5FM2A 1MRYA 4IAYA 3VUHA 3ALNA 5FRIA 4OTDA 1WBWA 3LFAA 4D28A 3FUPA 3MH3A 2ITNA 5DR2A 5BYZA 5EHYA 4U97A 4AA0A 3HA6A 3TNWA 5HU3A 5ANJA 5FWKK 5AP2A 3NDMA 2YM3A 3FZSA 4OTHA 5IUIA 2IO6A 2PYWA 3RWQA 1LEZA 2HW6A 4U81A 1YHWA 3VJOA 5JFSA 4K77A 2XEZA 2P2HA 3DFAA 4PRJA 4XEYA 4BWXA 4ZLOA 4PF4A 5CEPA 5IUHA 3QGYA 1XWSA 3T8OA 3AMAA 4XLVA 4E6CA 4RGJA 4X6QC 2ZM3A 4YJVA 3BWJA 4B4LA 5JQ8A 2G15A 4I93A 2GNLA 3OWLA 4KS7A 4ZJIA 2R3JA 3SW7A 3JY9A 4JBOA 4NM0A 3OOMA 4N6YA 3VS4A 4EKLA 3PSCA 5C27A 4DG0E 1YI6A 3EFLA 3IO7A 5HVYA 3U51A 3GNIB 2XMYA 3GCSA 4LGGA 2OJJA 4O6EA 5T6KA 3FKOA 5EFQA 5HOAA 3HDNA 5AV4A 1VR2A 3DS6A 3KA0A 4U3YA 4QTBA 3EN7A 4D2PA 4IFCA 2PMLX 5CQUA 5HGIA 4BL1A 4FKSA 2JKOA 4RA5A 3OCGA 4IAZA 5JGAA 3FYJX 4NYEA 4BI0A 4QP1A 5EG3A 2H9VA 1ZWSA 3SQQA 2I0YA 2WMWA 3R7EA 3SKCA 1U54A 5L8KA 4BDDA 2BKZA 2OFVA 2UV2A 1FINA 3O51A 3NR9A 4EK5A 5A4TA 3HRFA 3VUMA 3F9NA 1J1BA 3V8WA 3CQWA 2XK9A 4M84A 4HYHA 5HESA 3QWJA 5LOHA 3ENHA 1URCA 2E9NA 4EJNA 4BDGA 4XP0A 3ORIA 1I09A 3DAEA 5L2SA 4I0SA 3U54A 1YVJA 4DYMA 4M3QA 4UYAA 4BIDA 4PL4A 3S3IA 4OBQA 4FKQA 4U45A 3QL8A 3VUKA 3U9CA 4MXCA 2C5XA 2P33A 2QOHA 4FZFB 2P3GX 4E1ZA 3F5PA 4FSZA 4ANQA 4DFBA 3NVKI 2JDSA 4X2KA 3ZCLA 4B9DA 2WO6A 3RTPA 4C35A 3NUNA 2GNGA 3V5TA 3WOWA 4EH5A 4Z16A 5CY3A 1UNGA 4EUTA 2IJMA 3MPMA 3R9OA 3HP5A 3MW1A 3C4CA 4PWNA 2XCHA 4XRJA 4FSYA 4ID7A 5CEIA 1MQ4A 5KMLA 2VWUA 3DGKA 1ZARA 4HZSA 2HXQA 4D0XA 4E8AA 4YSJA 2I40A 1IAJA 3F3ZA 4HGLA 5E8WA 4B6LA 4AUAA 4KUJA 5IQAA 2J0JA 3K54A 4U42A 4JBQA 4A4OA 2W1HA 1OUYA 5GJGA 3HYHA 4RX5A 3MA3A 4IX6A 2R3LA 4RWKA 5EW9A 4EK6A 5DLSA 4FEVA 4LMUA 4BTKA 2WOTA 4DEHA 4K11A 2X8IA 5IKWA 4M7IA 4R3RA 5HHWA 4CKRA 3EHAA 3PA4A 4J98A 4G6NA 4HPTE 4LL0A 4RBLA 5KKRC 2Q0BA 5AFVA 3CQUA 3LMGA 3CPCA 2VTJA 4RMZA 3BHTA 3FZOA 4AA4A 3PSBA 4R5YA 4DH5A 4K33A 5DPVA 3ZXZA 3K3IA 4JX7A 5FXRA 5AR5A 1S9JA 2J9MA 3Q5ZA 4YJOA 4A9YA 4DT9A 5JFVA 1RW8A 3F6XA 1FOTA 2R9SA 5CI6A 4DTAA 2UUEA 1O6KA 1R0EA 3MH0A 2W4OA 4QP7A 2YJSA 3LFSA 3DB6A 3BGQA 4AW2A 1DI9A 4APCA 4BDFA 4X7QA 4CV8A 3TKUA 1R1WA 3UZPA 4FYNA 5EM5A 1P4FA 3QFVA 2YHVA 3R8VA 3RINA 3KK9A 4ZMFA 3SOAA 4F0GA 1ERKA 3OBGA 3Q4CA 2IVSA 3CKXA 2VN9A 3OG7A 3O8TA 1QPEA 4WG3A 3R1SA 5E8TA 4EQMA 4Z7GA 3L8PA 4Y46A 3TWJA 5C1QB 4QMYA 4QMZA 5GHVA 3RI1A 3QA0A 3DA6A 2PUIA 3V04A 4GCJA 4G3DA 3E8EA 2OBJA 3NUPA 5DHJA 1XBBA 2OZOA 1ZMVA 2QOBA 4O1OA 5I4NA 1M14A 2X2MA 2Y6MA 2W1ZA 2GCDA 2G2IA 3G6GA 4QMXA 3OUNB 4ASEA 4C7TA 2WU7A 3E3PA 2Y4IB 4E73A 4MQ1A 3KXZA 1OL2A 1M2QA 5LMBA 2BHEA 3WF8A 4E5AX 1IR3A 3WF5A 2B7AA 3QLGA 4FG7A 3PY1A 1G8SA 4BVUA 4G17A 1H24A 3GC7A 3D7ZA 4ZTMA 2CLXA 4CFXA 1BX6A 5KZ0A 2QI8A 1Z5MA 2QU6A 3JR1A 5I9ZA 3KF7A 3H9FA 4MF0A 4RVKA 1H08A 1KSWA 5F4NA 3RM7A 2GFCA 2X0GA 2O5KA 5CVGA 4F9BA 3UP7A 3H10A 4PMMA 5CF4A 3O2MA 2R3MA 4J53A 4PX6A 3KK8A 3ZC6A 3PLSA 1UA2A 4D55A 4IW0A 3T9TA 3G33A 3JXWA 5L8JA 4OTFA 4G6LA 4TNBA 1TQIA 2ETKA 3ZZEA 4IDTA 5J5TA 5LMAA 4EYMA 4EOLA 4QPSA 4YZBA 2JBPA 3PP0A 4FR4A 4P2KA 3I6UA 3HVCA 1KE7A 3E7OA 5HE3A 1ND4A 1M52A 4RC4A 5ETIA 5I9VA 2RG6A 4EOSA 4BN1A 4U8ZA 5IH6A 3WE8A 2JFMA 3BHUA 3HA8A 4FV2A 5AAGA 2VO3A 3SLSA 4RRVA 1IA8A 3FDNA 1STCE 1QPJA 4NCTC 3VWAA 4C0TA 3QQHA 4YZMA 4JQ7A 4BDJA 5AUTA 3DJ5A 3DLSA 4MX9A 3F5UA 1K3AA 3BZ3A 4IM2A 5LWNA 5CSPA 3A7FA 1J91A 3DK6A 2VRXA 3OP5A 4WBBB 3R00A 4NU1A 3GU6A 5IZFA 4AZVA 4W9XA 3ORZA 5FXQA 1XO2B 3BPRA 5J1WA 1ZAOA 1O6YA 2W1EA 5H8BA 4WNPA 2UZNA 4FIIA 4L46A 2YLFA 3LAUA 4IAAA 4EZ3A 5IH5A 1ZMWA 3BLQA 3QKKA 3GENA 1IEPA 2Y8OA 2ITPA 5A4CA 4YTIA 2E2BA 4PL3A 2J7TA 3KN5A 4RFYA 4B8LA 3UGCA 3PA5A 2CGVA 2BZJA 3LXLA 3S0OA 3ORMA 3F88A 5KMIA 4NM5A 1JSUA 3Q52A 4G5PA 2H6DA 3BYUA 2QCSA 4GUEA 3E62A 4MAOA 5J7HA 3MY5A 3NRMA 4FGBA 3EL8A 4LGHA 5F94A 3FEGA 3BX5A 2C0IA 3TEIA 4QTAA 4O7TA 5M06A 4AOJA 3A61A 2XJ2A 5J95A 3UG2A 1KE5A 3UQGA 2XEYA 3QRJA 4FIEA 3BEGA 2XRUA 4O0WA 4S32A 3R21A 4YSMA 3M11A 1DS5A 2OIBA 2R3FA 4HZRA 2X8EA 2EXEA 3VBWA 3OY1A 2REIA 3ZFYA 4O6LA 4C4FA 3AT3A 4R8QA 3IDBA 4XOYA 3KXMA 4L45A 4FSRA 4WUNA 5AR4A 4XV2A 2VWYA 5J8IA 4C2WA 3ZO4A 3DTCA 2JAVA 3K2LA 3FL5A 4OTIA 5L2TA 5AAEA 4CGAA 2A1AB 2FGIA 3OBJA 4EOPA 3PVWA 5EHOA 4R6VA 4TTHB 2OG8A 3E87A 3UMWA 5HZNA 3BV2A 5E9EA 5FEEA 4E4LA 1O6LA 1T46A 4CZTA 2Z7LA 3PG1A 4KABA 4NUSA 4RIXB 4MNFA 4ZTNA 2VU3A 3ZS5A 4TWOA 2BDFA 2OGVA 1QPDA 2VO0A 4LGDA 4RWLA 2BDWA 4DFZE 3QQKA 4BC6A 3KGAA 4U43A 3LFFA 2WMXA 4HJOA 5CQWA 3EQDA 4ZSGA 3UOHA 2GQSA 1OL7A 4IEBA 5GZ8A 2VO6A 4OBOA 1NA7A 4J1RA 5HG8A 4IJ9A 3QRTA 3W2PA 3R71A 4J8MA 3SXRA 4USFA 3ZLXA 1M2PA 4J97A 5LMKA 5E4HA 2HZIA 1A06A 3QUDA 4J7BA 2Z7QA 2WMAA 4CQGA 4E6QA 3W8LA 4FT3A 4TYJA 4ZOGA 3QD0A 3LW0A 3A8WA 4A9UA 1L3RE 4KAOA 4KNBA 4H3PA 3BGZA 5AUVA 3QYZA 4GU9A 3PVGA 3K3JA 3CD8A 3DLZA 3D5UA 2J90A 3FLQA 4AGDA 4CV9A 3I81A 1BL7A 3LCDA 3NW7A 4XG8A 4R77A 1YI4A 5HQ0A 2YM5A 1XH4A 4O7YA 4GK4A 2QOCA 2C6EA 3QXOA 3OS3A 4A7CA 4ACCA 4BBFA 1YDRE 4QQTA 5DWRA 3EQBA 4II5A 2XK6A 3WYYA 5JRQA 4DG3E 1E9HA 5EQPA 4UBAA 3EFJA 4AE6A 2A27A 4L01A 4PMTA 1WCCA 1OIYA 4AZEA 2XS0A 3IGGA 5CU3A 1F5QA 3DBFA 4ASZA 3MGYA 2XNBA 4XYFA 2UW5A 3O71A 2PVFA 4RQVA 4ANLA 4GRBA 4L44A 3GP0A 3FXWA 2GNFA 4IX5A 4CFMA 3SX9A 2BRMA 4ZY5A 4RVTA 5LWMA 4FSWA 3MSSA 4IWQA 5A14A 4NW5A 2WQMA 2QOIA 3MIAA 3SW4A 2JDOA 2OI4X 5CZIA 3ZSGA 4C38A 5L6OA 3VBXA 4KSQA 2B9IA 4I0RA 4W9WA 5JSMA 1U46A 2FSTX 4I20A 4RIYA 3WZKA 2VTRA 3PXKA 4IXPA 2PZPA 2WMBA 4FT9A 4O1PA 5BVWA 4DGGA 4E6DA 4F08A 4ZXTA 5CAQA 2B0QA 1F0QA 3DB8A 2J51A 4KD1A 3GU4A 1UU9A 4FV4A 4ZY6A 3ZU7A 4C4IA 3NSZA 3G0EA 4RJ6A 1U59A 5JH6A 4A4XA 4FVPA 5CT7A 2EXMA 2QO2A 3PVBA 3QRKA 3EIDA 4AW1A 5HO6A 3DKCA 2EUFB 2F2UA 3FZTA 2OF2A 1WBNA 3I0OA 1WVYA 2BRNA 4PY1A 4QYHA 3KC3A 3V5WA 4EK3A 3HKOA 3MY0A 4PTEA 3G15A 2GFSA 2XRWA 4ZZMA 3NYNA 4JDHA 4P5ZA 1UWJA 4FKRA 2IW8A 5FD2A 2JIVA 3GOPA 4C34A 3GQLA 1FGKA 1OM1A 2HELA 3OOGA 2QHMA 4I6FA 3M42A 4GVAA 4QMLA 4AW5A 4F9CA 5AUUA 5ICPA 4GYIA 4ACMA 5JGBA 3FLSA 5KMJA 5EW3A 1XH8A 4C37A 3FKNA 4RIOA 3EH9A 2RL5A 3E93A 4FV5A 4L6QA 3FC2A 3TIZA 3V01A 2PY3A 2I1MA 4G5JA 5L8LA 4F65A 3NW6A 3DOGA 3EOCA 4JAIA 4E26A 4IZ5A 4U41A 3EQHA 2CGWA 4TYHB 2VX3A 2V62A 3BI6A 3NGAA 4FIJA 2CN8A 2Y0AA 3HX4A 4LL5A 4GS6A 4PPBA 3U4UA 1YOMA 4XG7A 4XBRA 4DFUA 3UODA 3HLLA 4ACHA 2DS1A 3GC9A 1JKKA 2QURA 4MWHA 2XK8A 3TJCA 4H36A 5LCJA 3LJ2A 4N70A 3R04A 4USDA 4KBCA 2GMXA 3POZA 2EXCX 3VW6A 3BV3A 4QNYA 4JG8A 4GH2A 1GIJA 1WBOA 4F70A 1M2RA 1JNKA 4ALVA 4EOKA 5BNJA 2YWVA 2YDJA 5C9CA 5DRDA 5BVDA 1P5EA 5DRBA 3EJ1A 3I5ZA 4IFGA 4UB7A 2C3JA 3ZBXA 5M57A 3O50A 2DQ7X 2XNPA 1HCKA 2QU5A 2RKUA 1WBPA 2YISA 3H3CA 3C5UA 4FKLA 4O0UA 3QX4A 4YJSA 1SMHA 4M15A 2W1IA 4BGHA 4D5HA 4HVDA 1J7IA 2PL0A 3AT2A 2BPMA 3Q6WA 3P5KA 5AADA 4FKWA 3FXZA 3GCUA 3GCVA 3IW5A 1JKSA 2OH4A 3R73A 2J0MB 4D4SA 2VV9A 1IASA 1GOLA 3CY2A 3NNXA 4PQNA 4QD6A 3SDJA 3TKIA 4D2TA 4EH4A 5F1ZA 4ANBA 3D5VA 2X4ZA 4W4VA 4N6ZA 4BCKA 1JSVA 2GS7A 2UVZA 2OXDA 4FICA 5M07A 1UNHA 2A2AA 4X21A 5ANKA 5I9XA 4MXYA 4HGEA 3VBYA 3ZC5A 4ASDA 4EH7A 2HYYA 2IW6A 3V5JA 3KRJA 3U6HA 2UZTA 3SG9A 3C51A 4FC0A 3FLWA 1Q61A 5CYIA 5EK7A 2HOGA 2XIZA 3OTVA 3RAWA 3UYTA 3TUDA 4C57A 3PY3A 2NRUA 3L8SA 3TJDA 4ZZNA 4FTTA 3O17A 4DH1A 2UW8A 3FPMA 3ITZA 5M4FA 3D15A 3Q60A 4FSUA 4AA5A 3B2WA 3H0YA 4FNZA 4GVJA 4I92A 4KKHA 4PP9A 2ITTA 4DBXA 4LUDA 4IQ6A 4ITIA 4ZZOA 4AZFA 2HENA 5TE0A 4JVGA 2X81A 4MQ2A 3F82A 4FTUA 4FTCA 5AWMA 5HE2A 3LVPA 2YIWA 4S2ZA 5C8MA 1GZOA 2WTDA 1H28A 3IECA 3PYYA 4XV9A 5FTOA 1FPUA 4YC6A 3AD4A 3Q04A 3MFTA 5E8UA 4QMQA 1Q41A 2UVYA 2W1FA 2Z8CA 2XNOA 4FX3A 4G34A 4XV3A 4H3QA 4KRCA 4O21A 2YCFA 3OXTA 3OVVA 3R0TA 2PVJA 4QOXA 5CWZA 3TNIA 4ANSA 5IPJA 4NL0A 4AX8A 2ZM4A 4TY1A 3NWWA 3UC4A 3ZSHA 1RJBA 4OR5A 4AZSA 4Q9ZA 5FEDA 3LXPA 3RMFA 3E63A 3BLHA 2ZV2A 3NX8A 5J1VA 3D94A 3KULB 3RAKA 3N4VA 2W5AA 2PUNA 4QP4A 3O0GA 1YWNA 2ONLA 2XNEA 4CMTA 3LFQA 3R7UA 1LPUA 4O0TA 4F0FA 4GSBA 1MP8A 4WG5A 3Q9WA 5E8VA 5B2KA 4P4CA 5HCXA 4MBJA 2OLCA 1BMKA 5IMXA 3NNWA 3LCTA 4TYEA 1Q4LA 4G3CA 4H39A 4FL1A 1GAGA 3DCVA 3R83A 4F99A 3PSDA 3MFRA 2B55A 3ORTA 2YFXA 1Q8UA 5HCYA 3FQHA 3I1AA 3TNPC 5AP6A 3AC3A 2ZJWA 2GHLA 3O7LB 3KRWA 3WZUA 4USEA 4RX8A 1BYGA 1TQMA 3RNIA 3D7TA 2XK3A 4RWJA 3DKGA 4D9UA 5AEPA 4C4JA 2C6TA 4EWQA 4G3FA 4DTBA 5D11A 4C2VA 4JQEA 5JGDA 1PKDA 4J95A 2ZVAA 2R4BA 3F61A 5HLPA 5BVKA 4BCIA 4TRLA 4D2SA 1CTPE 4F64A 2ZM1A 3VHKA 3EN5A 1E1VA 2WKMA 3FPQA 4BIBA 1Q24A 3ZEWA 4E4XA 4E4MA 2KULA 3G90X 4IDVA 4UMPA 3QTRA 4ZLYA 2GTMA 4I6QA 3MH2A 2BAKA 3TL8A 5LVMA 2A19B 3BQCA 3D2KA 3FAAA 4YLLA 3WYXA 2JD5A 4MXXA 4O81A 3NIEA 3HDMA 3LCKA 4O38A 4FT0A 3U9NA 4RA4A 4ZTHA 3WZDA 1Y57A 2PVYA 3VS1A 4CCBA 5FM3A 4AGUA 4ANMA 1BUHA 5BVEA 2C3IB 5KHXA 4DITA 3RPRA 3QAME 3WIKA 3C4WA 3NNUA 4FL2A 5CXZA 5HTIA 3LKMA 2A0CX 4KIQA 5EYDA 4G2FA 3TZMA 2XKFA 5E8ZA 3HNGA 4IWDA 3TV7A 3V8TA 4QMSA 1Q3DA 3FHIA 2FB8A 2OIDA 4NFNA 2XZSA 4BFMA 5JFXA 4F0IA 4MTAA 3CQEA 2VTPA 4CFNA 3RVGA 3PTGA 2OO8X 4RIWA 4GJ2A 3UG1A 2Y4IC 3QC4A 4BWPA 4XBUA 3Q96A 2GNHA 4QQCA 4EH9A 4F6WA 3TUCA 1H8FA 2C1AA 3B8QA 2OFUA 5ANIA 2VX0A 1FVVA 4G9CA 4A07A 3EQCA 4GMYA 1B6CB 5AIRA 3N4TA 2WOUA 3HMIA 5DIAA 4EC8A 5LCKA 3U55A 3Q4UA 3L9MA 3MY1A 1NW1A 3AC5A 4XJ0A 1VYZA 4GT3A 4WNOA 3COMA 1NT2A 4BDCA 4E20A 3ZEPA 3ORPA 4EQUA 3KN6A 5I0BA 4IMYA 5IQCA 4W8DA 4QP6A 3SVVA 4AT5A 2XK7A 3UMXA 3UNZA 2EB2A 1PXLA 3KFAA 1UU8A 4I6BA 4DEEA 3MJ2A 3LIJA 2B53A 3ET7A 3LE6A 2G2FA 3FMDA 2YCRA 4Y73A 2C5OA 2PMIA 3A4PA 4MWIA 4RQKA 3C4FA 4BZNA 5KNJA 3W2QA 4QMOA 5KUPA 3N4UA 4Y72A 3MA6A 4HCUA 4IJPA 4UY9A 3WZEA 3C5IA 4O7SA 4HW7A 3R2BA 3HEGA 5EQYA 3BRBA 3GC0A 2YA9A 3VS7A 2X1NA 2X9EA 3HRBA 4G3GA 4G6OA 3GCPA 5HX6A 5HTCA 5DR9A 2R3OA 4JI9A 4W4XA 3EWHA 4FZ7A 1Y8GA 5J5SA 3ANQA 3FMHA 4PNKA 2UZWE 4CFFA 5CT0A 5AM6A 4BHNA 4I4EA 4CLJA 4NK9A 4XP3A 3EYHA 3DJ7A 4R7HA 5L3AA 3CY3A 5K4IA 3KRXA 3PXQA 5E91A 2WIHA 3RCDA 3LLTA 5K0XA 2B9FA 4DBNA 4E93A 5EH0A 3E8CA 2WELA 4WUAA 3QRIA 2RG5A 3LCSA 3I7CA 5LVOA 1L8TA 1FGIA 3HMMA 1OKWA 2ZV9A 4L00A 3PPJA 4U40A 1LR4A 5AR3A 5M4CA 4HCTA 1PYEA 1W8CA 1ZZLA 3UIMA 4EUUA 5B0XA 1ZYLA 4FTNA 2YACA 5TT7A 3W55A 4F9YA 3MS9A 5CU4A 1E1XA 1WBSA 3I4BA 5CF6A 1OI9A 1U54B 1RE8A 2WTWA 4JAJA 5FTGA 5HD4A 3R28A 2XIKA 3VUTA 3ZRLA 5EM7A 2AC5A 1PMNA 4PTGA 3P1AA 3ZUVA 4QTCA 3HMPA 3A4OX 3UIXA 4CRSA 1PMUA 3R8LA 2VWVA 3SG8A 4CD0A 4RVMA 2QVSE 1PXPA 3AD6A 3DU8A 3LM5A 3PXRA 5GJDA 3UOKA 5IQIA 4K6ZA 4YC3A 3ZZWA 4UYNA 4AT3A 4FE2A 2PZRA 1ZXEA 4BCGA 3A62A 5TOZA 3V3VA 4NM7A 5E1SA 5AP3A 4YJTA 5DVRA 3EQFA 2NO3A 4Q5EA 4JQ8A 3OEFX 4S30A 3CEKA 4IC8A 4NEUA 2ZMCA 3Q4TA 4WKQA 4UX9A 3FY2A 2F4JA 3R6XA 4O7RA 4NZWB 2XA4A 3HRCA 2X6EA 4QYGA 4UXLA 3MTLA 4YBKA 4YNOA 4DA5A 4UMRA 4NFMA 4YHFA 3P7BA 4AOTA 2XBAA 4C4HA 3IONA 2XNNA 5AP5A 3UDBA 2WZJA 3FY0A 2OJGA 3RHXA 1Y6AA 4BTFA 4CFVA 4FV3A 3DZQA 2VAGA 2O65A 1GIIA 4KS8A 3UP2A 1UV5A 2X2KA 1G8AA 3EQIA 4JBPA 4U7ZA 4QYEA 4ORKA 3A7IA 1B38A 4AU8A 4I5PA 3QHRA 2W1DA 5IG1A 4MKCA 4I1ZA 4FTMA 3FKLA 2YZLA 1REJA 4AOIA 4BKYA 2QLQA 3E8NA 4ERKA 4Z55A 1B39A 2KTYA 3PWYA 4QT1A 2EWAA 4AF3A 3OXZA 4TKSA 2QO9A 4NIFA 5HVKA 3GU7A 4NH1A 1NY3A 3MI9A 2IZUA 3C1XA 3VJNA 1TKIA 4ARKA 4EL9A 1Z9XA 2C4GA 4S31A 3ZUTA 3RAIA 2OK1A 4PPCA 3JVRA 4JJRA 4C62A 4DLIA 1IG1A 3E92A 4O0SA 4DE4A 3ZLYA 3VS3A 3W2OA 4A06A 4N57A 1NVQA 3TI1A 2I0HA 4JOAA 4FSNA 2XCKA 2LGCA 2UZLA 4FK6A 4FOBA 4RJ5A 3ZM4A 4DEIA 3BBWA 4O84A 1W84A 2QOFA 2W4KA 3AQVA 3G9NA 2WXVA 3NPCA 4WO5A 4O0VA 3ULZA 1OL5A 3CR0A 3R7GA 4OBPA 4XG6A 4R3PA 3OW4A 3PLAE 2QC6A 4RT7A 3VUGA 3I0QA 5GIOE 3TIYA 4O0XA 4WIHA 5L4QA 2C5YA 4O83A 2YIQA 3MB6A 3COHA 3DBDA 2QODA 5ACKA 5EHLA 1H1RA 2ITYA 3S00A 2YM4A 2I6LA 3AMYA 1R0PA 2WPAA 5D9HA 3S4QA 5KO1A 4KBKA 2R7IA 5DE2A 5BYLA 4LOOA 4OLIA 3MPTA 1Q5KA 3KXNA 4GUBA 4FIHA 3ZO2A 3E8DA 2JKQA 4MH7A 1OIRA 3P4KA 3V6RA 3HAMA 3EQRA 4QMMA 5E7RA 2C6IA 2R3GA 3QBNA 4WG4A 3BIZA 2W1GA 4MNEA 2ETMA 2PE1A 2IZSA 4GFMA 5C4KA 4PP7A 3NLBA 2GU8A 2G2HA 3PE1A 3RP9A 5M53A 4DGNA 5JZNA 3QQLA 4EEVA 3PJ8A 4XUFA 3ID6C 2ACXA 2G9XA 1LEWA 4FNXA 3FZPA 3SOCA 4Y95A 4U5JA 5IEYA 3OROA 3QKMA 4K18A 4U0IA 3R7OA 4BI1A 5K0KA 1J7LA 1W98A 1P14A 5BUIA 1WBTA 2Z7RA 1H07A 3OC1A 5HD7A 5LQFA 2QR7A 4IVDA 4O7WA 4H1JA 4DG2E 1FQ1B 4JDKA 5KX8A 1WAKA 3K5VA 4KWPA 4M12A 2WTJA 2YDIA 4ZJVA 4FG9A 2H34A 4ALUA 4PDPA 2C6OA 5CNOA 1HOWA 3O23A 4ZS4A 2W9ZB 1OKYA 4Y5HA 4EHVA 5HICA 2WQNA 3MTFA 1OBGA 5CSHA 2VX1A 1CKIA 1Q8YA 1XJDA 2ZDUA 5B2MA 1A48A 3DNEA 4F6SA 2QOOA 4R3CA 3C50A 4RJ7A 2OKRA 1H4LA 5CNNA 3W16A 3E3BX 4FEXA 2CLQA 5BUJA 3PPZA 4WSQA 3VN9A 4BF2A 1G3NA 3QQGA 3W1FA 1PW2A 4LV5A 2GPHA 1SM2A 3KEXA 4O2ZA 5A3XA 3ACKA 4FV8A 2CNUA 4O2PA 4O27B 1YHVA 3C13A 4DINA 3MESA 3P86A 5GIPE 4O91A 4MCVA 2UZDA 4ZS0A 3F69A 1NVRA 3QLFA 4RLLA 5GNKA 2UZOA 4LYNA 2W1CA 4H3BA 3E5AA 2XIRA 3QTSA 4HCVA 3QZFA 3FHRA 4QMTA 4FUXA 5HIDA 3UO4A 1U5QA 2R3RA 4IAKA 4KIKA 3CSVA 5JQ5A 4O7LA 5AUWA 4CMOA 2UW7A 4RZVA 3SD0A 3FYKX 4FT7A 4BWKA 4GK2A 4YTFA 1W0XC 4QRCA 5EI6A 3O8PA 2PSQA 2JDTA 3ENMA 3GCQA 4NSTA 4R1YA 2DWBA 5E8YA 2XB7A 3A2CA 4IB5A 3D83A 4UWBA 3VUDA 2R3IA 4GEOA 4F7NA 2VNYA 2WAJA 5K4JA 1V0BA 4W4WA 3VBQA 1XH7A 2W99B 3A8XA 3DJ6A 3GXLA 4GG5A 1W82A 2XKDA 3QF9A 2XNGA 3F5GA 4N4SA 4FA2A 5K3YA 1Q97A 2JBOA 3BHYA 5BUEA 1AD5A 3KVWA 4NWMA 4JRNA 3LFBA 4A9TA 4AZWA 4H05A 2GQRA 2XJ0A 3H4JA 2PVHA 4YHTA 4BCQA 3I79A 3KMMA 4XH6A 4ERWA 5CEKA 4EC9A 3LJ0A 4LI5A 2BILB 2VTNA 5FP6A 2J5EA 5H8EA 4BCMA 2ZDTA 3AMBA 5DH3A 3ZONA 4QNAA 3BBTB 1YXTA 3PJ2A 4L3PA 5HO8A 3KCFA 3VQHA 1Q62A 4IADA 3G2FA 4GKHA 4QO9A 1UKHA 4OW8A 5IA5A 4RSSA 2CHLA 2WQBA 2R3KA 3FC1X 2OW3A 4IB1A 4U80A 2ZYBA 5HI2A 4CFUA 4EH2A 3V5LA 4DAWA 3QU0A 2O0UA 3QGWA 3IW6A 2OZAA 3LXKA 2VTOA 2DYLA 4AQCA 4EORA 4BCFA 2ITQA 4OAUC 2YITA 2FVDA 3HV6A 4V04A 3EKNA 3KXGA 5JK3A 2C6LA 3FMNA 4FODA 3LFEA 4AP7A 3ZBFA 3D5XA 2B1PA 2C47A 3L8XA 3IQ7A 1ZRZA 5H2UA 4CZYB 1OL1A 5HU9A 4BKZA 4MHAA 2CKQA 2HAKA 2HWOA 4C4GA 5K5XA 4MVFA 4FMQA 1WZYA 4IE9A 2YLEA 4MBIA 3RCJA 3ROCA 1Q8ZA 4EHGA 2XNMA 4A4LA 2UW0A 4XP2A 3GC8A 4QYYA 1KUTA 1ZYDA 4LOPA 3COKA 4WOVA 1K9AA 4FEQA 3A7GA 4BKJA 4DGLC 3BQRA 4ITHA 4LG4A 3SXSA 5CAVA 4C59A 1JWHA 3Q2JA 4YO6A 2HWPA 2ONLC 2XM8A 4HPUE 4W8EA 2QG5A 5A9UA 3WBLA 2OJ9A 4M8TA 2A4LA 2BIYA 2R0IA 4YJNA 4FKUA 3T3VA 3NUYA 4M0ZA 4XG2A 4GL9A 4UMQA 2J0LA 4AN9A 4X0MA 3ZXTA 4EH8A 1V0PA 4MXAA 5AA9A 2F7ZE 2VGOA 3MVLA 4I41A 4PMSA 2HY0A 3Q2MA 5FTQA 2PU8A 1VZOA 2QONA 3DV3A 5G1XA 3ZRKA 5LVLA 3BGPA 4RIYB 3LFCA 4PMPA 4BYJA 2EB3A 1GY3A 4CVAA 5CANA 1JLUE 3RHKA 5DGZA 4JL9A 5JEBA 3MN3A 4M0YA 5IISA 5H3QA 4QTEA 3TDVA 2IW9A 2DUVA 2CKEA 3QUEA 4EYJA 4BBEA 1JKLA 5B7VA 4AFEA 2ITWA 3R01A 4MD9E 5FBOA 5AV0A 1SVHA 3VRZA 5A6OA 1MRVA 3TM0A 3LXNA 4R7BA 3R22A 4E3CA 4M69A 4YLKA 5FXSA 2J5FA 1UU7A 2VWWA 3PIYA 2FO0A 4I0TA 4BGQA 3RZFA 1CMKE 1PXIA 4GFGA 4ZP5A 4DFLA 5FDPA 4WSYA 1WMKA 3HAVA 4QP3A 4FSTA 4JBVA 3V6SA 4QQ5A 5IQGA 4J96A 4IB3A 4FTRA 5TKDA 2PVRA 3ODYX 4MF1A 2YDKA 4NCTA 5I5ZA 3S1HA 1ZLTA 4J8NA 2Z60A 3FWQA 1SYKA 4YJPA 4L67A 4FTKA 2WIPA 1X8BA 2BDJA 4FKPA 2B9HA 3DBQA 5CU6A 1IAHA 1H0WA 5AJQA 3UVPA 4DH7A 4EBVA 1YKRA 2OU7A 2C0OA 5HBHA 5HBJA 2FSMX 4X3JA 5EI8A 3WARA 2YIYA 1Y6BA 3DPKA 3F7ZA 2WB8A 4GT4A 3BWFA 4ZIMA 3UNJA 4FEWA 1OKZA 2G1TA 3QTQA 3NUAA 3QQJA 1YXUA 2YERA 2C3KA 3KF4A 4V0GA 2PPQA 4YBJA 3TNHA 3UO5A 3LPBA 3RWPA 4F4PA 4FZDB 4BCJA 5JKGA 3I60A 1H0VA 3QA8A 2FUMA 4TWPA 4F6UA 5HE1A 3OZ6A 3HUBA 3QTZA 4YR8A 4Y5QA 4XX9A 5HIBA 5IU2A 5HCZA 4NW6A 4CMUA 5EM8A 3BEAA 3DZOA 3RPOA 3VS0A 4YZDA 4O96A 3GFEA 2C30A 2NRYA 4AFJA 3HUCA 3VULA 3P9JA 3A7JA 4WHZA 5ETCA 5IMEA 4O22A 2R7BA 4JG6A 2XF0A 3TUBA 3DKFA 2YIRA 2CJMA 2R0UA 3Q3BA 5ANOA 4P7EA 5HNBA 4K9YA 5D12A 3IKAA 3QCYA 2WEIA 3HL7A 4IZAA 2Q83A 4XCUA 1Q99A 5FP5A 2WFYA 3PXYA 1OUKA 3P08A 4PNIA 5AP4A 4CEGA 2B4SB 4Y83A 2O8YA 2C5NA 1WVWA 3FV8A 2BROA 4ACGA 4YC8A 5KCVA 4FNWA 4L7FA 3ERKA 3OTUA 2X9FA 4IIRA 3ELJA 2PE0A 2R3PA 3I7BA 4EK4A 2XH5A 2PHKA 5T68A 2R2PA 2XKEA 5AM7A 4D1XA 3TKHA 3Q32A 5CEOA 3KXXA 4OUCA 3U6IA 4G31A 4AGWA 1PXKA 3QXPA 2HZNA 2ETRA 2XP2A 3LHJA 3F2AA 4DFNA 3UPXA 2OXXA 3TZ8A 3QKLA 4HVSA 5JRSA 1DI8A 3LZBA 2WQOA 3N51A 4FZAB 1UNLA 4M66A 4O0YA 2YAAA 4J52A 5CXHA 4ZTQA 3ORLA 3UZRA 2GS2A 5CALA 3QWKA 3RNYA 3IDCA 2OF4A 3QHWA 3ZO1A 2GHMA 3TTIA 3VUIA 2OICA 4LUEA 2WEVA 1OL6A 2ZV7A 3Q6UA 4QMPA 3NYOA 1KOAA 2E9PA 2PUUA 1V0OA 2WMQA 3QTXA 4L9IA 3MWUA 2HZ0A 3ORXA 1H26A 5I9UA 4BYIA 2OWBA 5DG5A 5CAUA 1ZYCA 4AXAA 4CG8A 3EZVA 2EVAA 3ZSIA 3ORKA 3E88A 3POOA 3C4ZA 4ZK5A 2RFNA 3L9LA 5A4EA 4IWPA 2UW9A 3HMNA 2RFDA 5I9WA 2VUWA 2IVUA 4BGGA 3NEWA 2VTHA 4FBXA 4OTRA 2IPXA 2F7EE 5DT3A 3ZDIA 5C8KA 1A9UA 2JIIA 3BLRA 4EKKA 3DNDA 2UZUE 2W0JA 3KY2A 4BB4A 2CCHA 2YIXA 4YGAA 1KE9A 2PK9A 1MRUA 3ZMMA 4ZTSA 4C02A 4CCUA 5KMOA 4YJQA 3BHVA 2WTKB 1CKPA 4FKOA 3RALA 2BCJA 3FI2A 3FXXA 5HTBA 3L8VA 3FL4A 4BBMA 2PWLA 2X6DA 4C58A 2CN5A 3QD4A 3R7VA 3VBVA 4E6AA 4D4RA 4YZCA 2GTNA 1KOBA 1ZYSA 5CAPA 4UWYA 5IQBA 3ZRMA 3F3VA 2IVVA 4I5CA 1LP4A 4JX3A 1VEBA 3R7IA 3EL7A 5EQEA 4KB8A 3GU5A 3QX2A 3UVRA 2HW7A 4CYIA 4IH8A 4EOOA 4EWHA 4I5MA 4IC7A 4YUQA 5GJFA 4YZ9A 3SGCA 4FG8A 4OGRA 2YEXA 2VTQA 5DOSA 2ERZE 2GNIA 3GQIA 2CKOA 3ZUUA 3JPVA 2UW3A 3AG9A 5IDPA 5J79A 4NT4A 2Y9QA 4RJ4A 3QZHA 4FTQA 3ZTXA 5C4LA 2QNJA 3D7TB 4XG3A 4I22A 4CNHA 2W05A 3VVHA 3GT8A 4V01A 3R30A 2XK4A 4GT5A 4WT6A 4JXFA 5I3RA 3ZO3A 3H30A 1SVEA 4MYGA 3PG3A 4RX9A 3M2WA 4WNKA 5IA0A 5IEVA 1APME 4TYGA 5D10A 5EOLA 1BL6A 2GHGA 1OVEA 5D7AA 3W2RA 3I5NA 5LVPA 3KREA 1SZMA 4ZSJA 3U6JA 4TXCA 4DCEA 1XBCA 3CGFA 3FI3A 4OTPA 3Q4ZA 1YWRA 5ANGA 1ZZ2A 2C6MA 2PMOX 2QQ7A 5K9IA 3P7CA 3GGFA 3ATTA 4GG7A 4A9RA 4QMWA 4UMUA 1CSNA 3F7WA 3DAJA 3VIDA 5ETAA 1U5RA 3S2PA 2F7XE 2FH9A 4D1ZA 3C0HA 4JDJA 5IQEA 2OSCA 1H01A 2VTTA 4M97A 5C01A 3WF6A 1VJYA 3TTJA 4BTJA 4D0WA 4DEBA 2YM7A 4ANNA 4FTIA 4M67A 4TN6A 3VC4A 3RJCA 4YZNA 1EH4A 5EYCA 2WHBA 5DYJA 4CG9A 3AC8A 4D5KA 2JDRA 1G5SA 4YU2A 4XOZA 4RIWB 2X7GA 3PWDA 5EKNA 2J50A 2YABA 3P0MA 2Y4PA 2PULA 4OAVB 1J1CA 3UIUA 2Z02A 4TZRA 3QD2B 3KMWA 3R1NA 3BYVA 1PXOA 3FE3A 1SNXA 5HLNA 4YTHA 1OBDA 4L43A 3OHTA 2XKCA 5HNIX 3NYVA 4NKAA 5BMSA 3W32A 4EHEA 2JKMA 3NZ0A 4UMTA 4D2RA 4GU6A 4F7JA 2UW6A 2WD1A 3MB7A 3OMVA 5AX3A 3FMKA 1YOLA 3MFUA 4HGSA 3V8SA 2CGXA 4ZSLA 1PYXA 4JS8A 2ZMDA 3LFDA 3HZTA 5D1JA 4F7LA 1ZOGA 2P2IA 2YM6A 4AS0A 4FK3A 1YQJA 2YAKA 2W5BA 1OECA 3RKBA 3OT3A 4RX7A 3DDQA 3FLNC 2GDOA
chains in the Genus database with same CATH superfamily
5DEWA 1OPJA 2VTSA 3PZHA 3VAPA 2C6DA 4XMOA 3UOLA 5BVOA 3W0NA 2RF9A 3GUBA 4U3ZA 4YURA 4QPAA 3PRFA 3UTOA 4O4DA 5FG8A 4C8BA 4AZTA 4FV7A 2CSNA 2ITOA 3PY0A 3C4XA 1JAMA 4FV0A 3WI6A 5HKMA 5L6WL 4BDKA 4DH3A 2AUHA 2WMTA 5CSVA 2J6MA 4D2VA 2X39A 5KBQA 1FVRA 4RFZA 3UC3A 3LFNA 4X3FA 2BFXA 1YOJA 5CU0A 2VD5A 2VWZA 4MEDA 4ZMEA 3FJQE 2O64A 1OB3A 5TF9A 2FSOX 3PXZA 4OT6A 1ATPE 3MDYA 4NTTA 2I0VA 4YO4A 4B99A 2VWIA 5KMMA 4LQMA 2FA2A 4BZOA 4U44A 4BTMA 3OWPA 2GSFA 4GV1A 4B0GA 4GIIA 3HV7A 3ATSA 4X3FB 3C7QA 1WVXA 2NP8A 3R63A 4TPTA 3VW8A 3PUPA 5DFPA 4MXZA 2QG7A 5J9LA 4D4VA 5CI7A 5DA3A 4ZLZA 4GK3A 5FBNC 3ZH8A 3IW4A 4G16A 1Q8TA 2ZB1A 1YWVA 2QOQA 3CIKA 3UDZA 3R2YA 2W06A 4JT3A 4EH6A 5DMZA 1JQHA 3R9NA 2PVMA 4O82A 3N9XA 4AW0A 2QKWB 4UV0A 3R7YA 5FUTA 4M14A 5HLWA 3JY0A 4OTWA 3A60A 4PUZA 3WF7A 4YLJA 3EZRA 4FKGA 4QPMA 5KE0A 2C5VA 2CKPA 3DDPA 3JS2A 3AC4A 5AP1A 1PKGA 4L53A 3M1SA 5D7VA 5HG9A 2RFSA 3OF0A 4QP8A 2ZOQA 3FMMA 3P23A 4XLIA 4IM3A 5FEQA 4HVHA 1OKVA 3B8RA 5BVFA 4TW9A 3C0GA 5EDQA 2IVTA 3CE3A 4CTBA 2F2CB 2JIUA 3QTWA 3KU2A 2X7OA 5EKOA 2BMCA 4L8MA 1SNUA 3SRVA 3BU5A 3PA3A 4DHFA 5HBEA 2XARA 4J99A 4DT8A 4BICA 2ZV8A 3KL8A 4RPVA 3HV4A 3QCXA 2W17A 2SRCA 4D1SA 4WRGA 3CTQA 4OT5A 3ZLSA 2CGUA 2PUPA 4ZEGA 1RDQE 3OCTA 3WIGA 3LMHA 4AWIA 2BVAA 2WMSA 5L2IA 3O7LD 3SRVB 4ITJA 5LMKC 3DQWA 4EK8A 3E7VA 2CNQA 2I7QA 1I44A 1URWA 5BYYA 5J87A 5L2WA 5HX8A 5M51A 3TDWA 3U8WA 3PE2A 3VQUA 3GU8A 1OPKA 3SA0A 3KRLA 3NIZA 2C1BA 3W0OA 3ZM9A 5HG7A 4HYSA 3FMLA 3CGOA 5AX9A 5M55A 4C36A 4NIFB 2CNVA 2YZAA 1BI8A 3GOKA 4S34A 4QQJA 2V22A 3FQSA 3H0ZA 3OXIA 1UVRA 4ONAA 5CSWA 5H9BA 4DEAA 5KHWA 3CLYA 2WMUA 2O2UA 3RBWA 1PXMA 2IZTA 3R9HA 3H9RA 3VBTA 1Y8YA 1GJOA 1GNGA 2VO7A 3JYAA 4K2RA 5CX9A 3NVMB 2X0QA 4KINA 4TNDA 4H1MA 4EOMA 5EI2A 1CKJA 5AV1A 4ZJJA 3JVSA 4GFOA 4PV0A 4FL3A 5AMNA 2VZ6A 1JOWB 3NUUA 4NTSA 4ALWA 4CLIA 3PUFC 2R5TA 3FBVA 3IS5A 4OTGA 4PDOA 3RK7A 4FF8A 1JPAA 3KRRA 2VWBA 3PRIA 3UE4A 3F3UA 4BZDA 3IGOA 4ZSAA 1YDTE 4L68A 2WTIA 4C33A 1YXVA 3ORNA 3L9NA 4XRLA 4C61A 1OPLA 3F5XA 5AUXA 5EOBA 4EONA 2F9GA 5I9YA 4O0RA 4FV6A 1O9UA 4PDSA 5IF1A 5A4LA 4JIKA 3LLAA 4NJDA 5CENA 3QTIA 3R02A 2AYPA 3HGKA 5JN2A 3BCEA 2BTSA 3F2RA 3TNQB 4R7IA 3EFWA 4TYIA 2PVNA 2RIOA 3IPHA 4BR3A 1JKTA 3QQFA 1W2DA 1CDKA 3RK9A 4C3RA 4MNEB 1XR1A 4YMJA 2OIQA 2BAQA 5M4IA 3AKJA 3UDSA 2Y7JA 4O86A 1PMEA 4KRDA 4AACA 3G5DA 4FKJA 3ZHPC 4F63A 4GYGA 1M7NA 3CPBA 3P79A 3Q9ZA 3V5QA 3P78A 4RG0A 2ITVA 3MJ1A 3PXFA 4EQCA 4RFMA 2NNWB 4GKIA 1QPCA 1YDSE 2GQGA 4DEDA 5AAFA 5C03A 4P5QA 5HNGA 1YXXA 2JC6A 3V51A 2EU9A 5AR8A 5J9YA 4LRMA 1S9IA 5ACBC 5IDNA 3ML1A 5DR6A 3LCOA 1FVTA 1OITA 5IA3A 4Z3VA 4YJRA 3DAKA 3DXPA 3O5AA 1XQZA 2BALA 4I3ZA 3QQUA 2C69A 4Z9LA 2Q0NA 3R8UA 5A46A 3IW7A 3D4QA 1PF8A 5EYKA 4AE9A 5BPYA 4YPDA 3BU3A 2WQEA 4JG7A 4L42A 3NMUF 2R3HA 4WBOA 3GVUA 4ANOA 4ZTLA 3HV3A 5TR6A 3L1SA 1RQQA 1K2PA 4K0YA 2YWPA 4HVIA 1BKXA 4N0SA 4I5HA 2B52A 2HXLA 2C68A 3FZRA 3QD3A 3P7AA 2VNWA 5G6VA 2C0TA 4YP8A 1FMKA 3EN9A 3F66A 1DM2A 5IUGA 4EOJA 3ULIA 2V7OA 2IEWA 3KXHA 5HEZA 3UZTA 2FYSA 3CD3A 3TZ7A 1ZOHA 3DKOA 2WNTA 4HNFA 3OWKA 2PZIA 4EOIA 1ZYJA 4FSMA 1Q8WA 4DC2A 2RFEA 3MV5A 3PPKA 4FUYA 3AXWA 3HV5A 3FQEA 1PHKA 4X2GA 3UPZA 4IX4A 5CVHA 4FI1A 3RPYA 2XVDA 2VTLA 4FKIA 3ODZX 4FTOA 4D2WA 5BX0A 2JAMA 3PDTA 2V7AA 4RC2A 2UW4A 4FNYA 4X6RA 2JDVA 3MYGA 4FVQA 4CTCA 5KMKA 2WTVA 3GBZA 3DBEA 1UU3A 5L2QA 5CEQA 3SHEA 4HYUA 2HZ4A 2W9FB 4CXAA 3DK7A 1BI7A 4BIEA 4BRXA 2V5QA 3DXQA 1H1PA 4X2JA 2P55A 4FOCA 4A9SA 5AR7A 4KIKB 1MQBA 2V55A 3RPVA 4U6RA 3MVMA 4EOQA 1PJKA 3BYOA 4DN5A 3F3WA 3KB7A 1QL6A 3R1QA 4FT5A 3W0RA 2PE2A 2UZVA 3A7HA 4K1BA 4J71A 4ASXA 2I0EA 4FSQA 4KIPA 3BELA 1CM8A 4IX3A 3TACA 3VO3A 4BDHA 1LUFA 4JLCA 4K8AA 5ETFA 4RIXA 4BHZA 1V1KA 1KE8A 2CMWA 3PVUA 5CZHA 5HE0A 2XM9A 2P4IA 1PXJA 3EQPA 5HORA 5K5NA 4IZYA 3FI8A 2V0DA 3DQXA 5I3OA 1W2CA 4P90A 5IA2A 2IWIA 3TT0A 3LQ3A 1R39A 1T45A 5CS6A 1IRKA 4JR7A 3ETAA 2BUJA 2OH0E 2JITA 3H9OA 3ZDUA 2IG7A 4ACDA 1NXKA 2XIXA 4IM0A 5CASA 3AGLA 5IQDA 4KSPA 4IVAA 5T3QA 3S95A 1ZOEA 3D14A 4YTCA 3PJCA 1OIUA 4FGRA 2BRGA 3VNTA 5M44A 3ROYA 5H8GA 3UYSA 4DHIB 3NCGA 1VYWA 3MVJA 4RVLA 5LJJA 3NCZA 4WNMA 4DEGA 3CXWA 2QLUA 5KKRB 3NYXA 1BLXA 1KV1A 2OZAB 2AC3A 4AN2A 2E9VA 4FTJA 3UQCA 3AOXA 3QC9A 4HGTA 4AG8A 5A54A 3EQGA 4HYIA 4O4EA 3T9IA 5A4QA 1GIHA 4I24A 2VWXA 3W2SA 5JFWA 5J9ZA 1QCFA 4IZ7A 5JZJA 3T3UA 3VRYA 4NJ3A 1IA9A 3BKBA 2O63A 4IWOA 2WTKC 5E92A 3UBDA 5IQFA 4BY9E 2B54A 1WBVA 1XBAA 2H96A 2JKKA 4HVGA 4BDEA 4O7VA 3FSFA 2YN8A 2WTCA 4KA3A 4MBLA 5DT4A 5FDXA 3D9VA 3SAYA 4EZ7A 5M56A 3GFWA 2ERKA 5M4UA 1HCLA 4FEUA 2PZYA 5DNRA 3LJ1A 3OT8A 5AR2A 4IAFA 2BAJA 4NM3A 5CF5A 3DT1A 4XV1A 4FYOA 1DAWA 5F95A 5E90A 3TXOA 3COIA 5AV3A 2BZIB 4D4YA 3UNKA 1OMWA 2OXYA 4ZSEA 1YHSA 5FGKA 4CZUA 3PFQA 4DH8A 3MPAA 4CKIA 3ACJA 3DXNA 4GIHA 5ANEA 5CAOA 3DTWA 3QCQA 4ENXA 3PJ3A 4FTLA 3MFSA 3AGMA 4O4BB 4Q5HA 2BKKA 4U79A 3D2IA 3ANRA 4CT1A 3PFYA 1WFCA 5CTPA 2YCSA 4EI4A 3KMUA 2HK5A 2QO7A 4UZDA 3AKLA 4C4EA 5EYMA 1GZKA 4R1VA 5HO7A 2R64A 3VF8A 1GZ8A 4UWCA 2VTIA 2BZKB 3ALOA 4TWCA 2R3NA 4ZAUA 2NPQA 2WMVA 2IN6A 5BQ0A 4LRJA 1XH9A 3WE4A 3II5A 3PZEA 3CTHA 5TO8A 3TCPA 3AD5A 4HNIA 4L52A 2BHHA 3CCNA 3THBA 2VTMA 5CLPA 3AC1A 5AV2A 2Z7SA 4QMVA 4UALA 4M69B 5BMMA 3AC2A 3CBLA 4B8MA 1Z57A 2UZEA 3DFCB 4PL5A 4TYHA 5CVFA 3R1YA 4PPAA 2P0CA 5E8XA 4UN0C 2GS6A 3FI4A 4CYJA 4OTQA 4IANA 2YM8A 3CC6A 4BCPA 2XBJA 3NS9A 5B2LA 2XYUA 3LM0A 4QP2A 3LQ8A 5CSXA 5HIEA 3SV0A 3D0EA 4JR3A 1ST0A 1P4OA 4IHPA 4XNEA 4Y85A 2HCKA 1H1WA 3O8UA 3HP2A 3FZ1A 4I21A 1H25A 2W96B 2XYNA 3CS9A 4S33A 3C4EA 4IVCA 5HVJA 5J7BA 5AP0A 4KBAA 4F7SA 3K5UA 3SXFA 2QR8A 3G9LX 4RJ8A 1H1SA 2ZB0A 2BRHA 2VTAA 5CF8A 3AT4A 3FMJA 4LOQA 1UKIA 4IACA 2VGPA 4M68A 3FLZA 1QMZA 3EB0A 4V0GB 2F49A 5DT0A 2Z2WA 3IW8A 2BZHB 3NNVA 4Z7HA 1UWHA 2X4FA 4HOKA 5L6PA 2JLDA 4CQEA 3LMIA 5HG5A 4F9WA 2PTKA 3G6HA 4AAAA 5LXMA 3Q9YA 4FV1A 5IQHA 4NKSA 2J0KA 4FV9A 2CDZA 4FVRA 3OCSA 2WGJA 4UZHA 5LVNA 2XUUA 3HECA 3W10A 3LOKA 4BCOA 3RM6A 5ANDA 3TV6A 1ZY5A 1KE6A 1PRYA 3I6WA 4W4YA 3KCKA 4XHKB 4EH3A 5FLFA 3C9WA 5AUZA 4E5BA 1XKKA 3KKVA 2JGZA 3RK5A 3W33A 5JMSA 4MK0A 2X8DA 3QZIA 4AXEA 3EFKA 1OGUA 5CU2A 5EM6A 1AGWA 4EBWA 1REKA 5JT2A 1TVOA 4M13A 3VS2A 2J0IA 4CT2A 4G3EA 5C26A 3OFMA 3B2TA 3TN8A 5DN3A 3MBLA 4RC3A 3VF9A 4D9TA 4DF3A 3IOKA 4JIAA 5E1EA 2PMNX 4L7SA 3QUPA 1FBNA 4MD8E 3NW5A 2UZBA 3CJGA 4RWIA 3PIXA 1KWPA 5DBXA 4CRLA 4IAIA 4LV8A 4XS2A 3VS5A 4DCAA 2B9JA 1J3HA 4FRFA 3GI3A 4G9RA 1OZ1A 3DK3A 4DTKA 4O7NA 3QTUA 2GNJA 2UVXA 2QOLA 3QZGA 2RGPA 2WMRA 4IVBA 5IH4A 4I6HA 3OEZA 1P2AA 2W5HA 4AN3A 3ZOSA 4FTAA 4KKEA 1TQPA 4KKGA 4X3FC 1YI3A 2YCQA 2ITZA 3C0IA 3W2CA 1TFFA 4EHZA 1NVSA 2ZAZA 1PMVA 1F3MC 3FSKA 5KZIA 4R78A 3Q5IA 2G01A 3UJGA 3G51A 4BCNA 5EDPA 5M09A 3F3TA 1JVPP 3NUXA 1JSTA 3W8QA 4DLJA 4Y8DA 3MH1A 4JNWA 3MIYA 4FZ6A 4BCHA 4DFYA 4F1MA 3ZFMA 1H27A 4ENYA 1Q3WA 2JFLA 3FMEA 2QOKA 3FLYA 3OY3A 3PP1A 4BI2A 2Y6OA 3KQ7A 3KULA 5CEMA 3UVQA 3ZYAA 4QP9A 2CCIA 4C3PA 3CP9A 4BDIA 3VHEA 2PZ5A 1OIQA 3BE9A 3TZ9A 4E7WA 3V5PA 1MUOA 4AGCA 4F9AA 4CSVA 2E9UA 5EDRA 5A6NA 4APPA 1R3CA 4DDIA 3EN6A 4DGMA 4GW8A 3CJFA 3VS6A 4DGOA 3O96A 2XANA 1H00A 2PVKA 2BRBA 3CKWA 4V05A 4F1OA 2PVLA 3NUSA 3R8MA 1GZNA 5D41A 1YXSA 4D58A 1AQ1A 4EJ7A 5M08A 1JBPE 3LQ5A 4KIOA 2XIYA 3IG7A 3QALE 4H58A 4FIFA 4YNEA 3R8PA 3R9DA 4PDYA 5AP7A 3WILA 1PY5A 3DBCA 3W18A 3UQFA 4LFIA 2QHNA 3RPSA 2OJFE 3EN4A 4I4FA 3BYMA 4C3FA 1Y91A 5DEYA 3L9PA 5KBRA 1W83A 1M7QA 3EKKA 4ZY4A 4QMNA 4RZWA 4E5WA 3EMGA 2C3LA 4XG4A 1H1QA 4MXOA 3JUHA 5AUYA 3DY7A 2XJ1A 4FIGA 2FSLX 2ESMA 4PTCA 3IOPA 5EW8A 3TV4A 3UIBA 3P5JC 3BE2A 4TWNA 3QCSA 4RJ3A 5F9EA 5DI1A 5F20A 4L3LA 3RGFA 3BL7A 3Q53A 4AT4A 5BVNA 3BHHA 2J2IB 4JDIA 4JRVA 1YRPA 2BTRA 2QKRA 4U9AA 3R9RA 3OW3A 4IB0A 1YW2A 2R3QA 3QRUA 5FQDC 5ITAA 5GZAA 4ZTRA 4GJ3A 3NAXA 4TT7A 4BDAA 2E9OA 4Q2AA 4B7TA 3WZJA 3ZLWA 3UOJA 4WA9A 1M17A 1R78A 2F57A 4I23A 4F1TA 3GEQA 3PIZA 4TL0A 4QMUA 2BFYA 3OD6X 2RSVA 4QYFA 1W7HA 2OJIA 3Q9XA 4CKJA 2W4JA 4YHJA 2BR1A 4O7ZA 4CFWA 3AKKA 2H8HA 4I94A 5AA8A 3E64A 1U4DA 3HMOA 4Q9SA 4FKTA 4IBMA 1PXNA 2WU6A 3R8ZA 4L3JA 4YJUA 3IK3A 1ZY4A 3IDPA 5GINE 3F2NA 3OWJA 1XH5A 3RAHA 3WF9A 5C8NA 2O3PA 3TG1A 2HIWA 3BYSA 2HY81 3REPA 3PJ1A 4E4NA 1XH6A 2IZRA 1KV2A 3D5WA 1ZMUA 2ITXA 4R5SA 2C6KA 4WD5A 3EYGA 4XG9A 2LAVA 3MVHA 1J7UA 5LARA 4FKVA 3KVXA 3RZBA 2QD9A 4DFXE 4X2NA 4EZ5A 5IA4A 2J4ZA 3CTJA 2YJRA 2X2LA 3G0FA 1SVGA 3UO6A 4UEUA 2X7FA 3SC1A 5IA1A 4YPSA 5GZ9A 3NAYA 3OUKA 4UXQA 5KMNA 4G1WA 4LM5A 4RLKA 4F09A 3OCBA 4BDBA 1DAYA 3U4WA 3U87A 4WRSA 3A99A 2JEDA 3QYWA 5IEXA 4LRKA 4QTDA 2W7XA 1FMOE 2CPKE 3ZFXA 2ITUA 4MD7E 4LMNA 2BIKB 5E8SA 4X2FA 1XHAA 5AIKA 3BU6A 3GB2A 5FM2A 1MRYA 4IAYA 3VUHA 3ALNA 5FRIA 4OTDA 1WBWA 3LFAA 4D28A 3FUPA 3MH3A 2ITNA 5DR2A 5BYZA 5EHYA 4U97A 4AA0A 3HA6A 3TNWA 5HU3A 5ANJA 5FWKK 5AP2A 3NDMA 2YM3A 3FZSA 4OTHA 5IUIA 2IO6A 2PYWA 3RWQA 1LEZA 2HW6A 4U81A 1YHWA 3VJOA 2NYAA 5JFSA 4K77A 2XEZA 2P2HA 3DFAA 4PRJA 4XEYA 4BWXA 4ZLOA 4PF4A 5CEPA 5IUHA 3QGYA 1XWSA 3T8OA 3AMAA 4XLVA 4E6CA 4RGJA 4X6QC 2ZM3A 4YJVA 3BWJA 4B4LA 5JQ8A 2XAOA 2G15A 4I93A 2GNLA 3OWLA 4KS7A 4ZJIA 2R3JA 3SW7A 3W0SA 3JY9A 4JBOA 4NM0A 3OOMA 4N6YA 3VS4A 4EKLA 3PSCA 5C27A 4DG0E 1YI6A 3EFLA 3IO7A 5HVYA 3U51A 3GNIB 2XMYA 3GCSA 4LGGA 2OJJA 4O6EA 5T6KA 3FKOA 5EFQA 5HOAA 3HDNA 5AV4A 1VR2A 3DS6A 3KA0A 4U3YA 4QTBA 3EN7A 4D2PA 4IFCA 2PMLX 5CQUA 5HGIA 4BL1A 4FKSA 2JKOA 4RA5A 3OCGA 4IAZA 4O4CA 5JGAA 3FYJX 4NYEA 4BI0A 4QP1A 5EG3A 2H9VA 1ZWSA 3W0QA 3SQQA 2I0YA 2WMWA 3R7EA 3SKCA 1U54A 5L8KA 4BDDA 2BKZA 2OFVA 2UV2A 1FINA 3O51A 3NR9A 4EK5A 5A4TA 3HRFA 3VUMA 3F9NA 1J1BA 3V8WA 3CQWA 2XK9A 4M84A 4HYHA 5HESA 3QWJA 5LOHA 3ENHA 1URCA 2E9NA 4EJNA 4BDGA 4XP0A 3ORIA 1I09A 3DAEA 5L2SA 4I0SA 3U54A 1YVJA 2X0PA 4DYMA 4M3QA 4UYAA 4BIDA 3W0MA 4PL4A 3S3IA 4OBQA 4FKQA 4U45A 3QL8A 3VUKA 3U9CA 4MXCA 2C5XA 2P33A 2QOHA 4FZFB 2P3GX 4E1ZA 3F5PA 4FSZA 4ANQA 4DFBA 3NVKI 2JDSA 4X2KA 3ZCLA 4B9DA 2WO6A 3RTPA 4C35A 3NUNA 2GNGA 3V5TA 3WOWA 3BLAA 4EH5A 4Z16A 5CY3A 1UNGA 4EUTA 2IJMA 3MPMA 3R9OA 3HP5A 3MW1A 3C4CA 4PWNA 2XCHA 4XRJA 4FSYA 4ID7A 5CEIA 1MQ4A 5KMLA 2VWUA 3DGKA 1ZARA 4HZSA 2HXQA 4D0XA 4E8AA 4YSJA 2I40A 1IAJA 3F3ZA 4HGLA 5E8WA 4B6LA 4AUAA 4KUJA 5IQAA 2J0JA 3K54A 4U42A 4JBQA 4A4OA 2W1HA 1OUYA 5GJGA 3HYHA 4RX5A 3MA3A 4IX6A 2R3LA 4RWKA 5EW9A 4EK6A 5DLSA 4FEVA 4LMUA 4BTKA 2WOTA 4DEHA 4K11A 2X8IA 5IKWA 4M7IA 4R3RA 5HHWA 4CKRA 3EHAA 3PA4A 4J98A 4G6NA 4HPTE 4LL0A 4RBLA 5KKRC 2Q0BA 5AFVA 3CQUA 3LMGA 3CPCA 2VTJA 4RMZA 3BHTA 3FZOA 4AA4A 3PSBA 4R5YA 4DH5A 4K33A 5DPVA 3ZXZA 3K3IA 4JX7A 5FXRA 5AR5A 1S9JA 2J9MA 3Q5ZA 4YJOA 4A9YA 4DT9A 5JFVA 1RW8A 3F6XA 1FOTA 2R9SA 5CI6A 4DTAA 2UUEA 1O6KA 1R0EA 3MH0A 2W4OA 4QP7A 2YJSA 3LFSA 3DB6A 3BGQA 4AW2A 1DI9A 4APCA 4BDFA 4X7QA 4CV8A 3TKUA 1R1WA 3UZPA 4FYNA 5EM5A 1P4FA 3QFVA 2YHVA 3R8VA 3RINA 3KK9A 4ZMFA 3SOAA 4F0GA 1ERKA 3TYKA 3OBGA 3Q4CA 2IVSA 3CKXA 2VN9A 3OG7A 3O8TA 1QPEA 4WG3A 3R1SA 5E8TA 4EQMA 4Z7GA 3L8PA 4Y46A 3TWJA 5C1QB 4QMYA 4QMZA 5GHVA 3RI1A 3QA0A 3DA6A 2PUIA 1XMLA 3V04A 4GCJA 4G3DA 3E8EA 2OBJA 3NUPA 5DHJA 1XBBA 2OZOA 1ZMVA 2QOBA 4O1OA 5I4NA 1M14A 2X2MA 2Y6MA 2W1ZA 2GCDA 2G2IA 3G6GA 4QMXA 3OUNB 4ASEA 4C7TA 2WU7A 3E3PA 2Y4IB 4E73A 4MQ1A 3KXZA 1OL2A 1M2QA 5LMBA 2BHEA 3WF8A 4E5AX 1IR3A 3WF5A 2B7AA 3QLGA 4FG7A 3PY1A 1G8SA 4BVUA 4G17A 1H24A 3GC7A 3D7ZA 4ZTMA 2CLXA 4CFXA 1BX6A 5KZ0A 2QI8A 1Z5MA 2QU6A 3JR1A 5I9ZA 3KF7A 4F78A 3H9FA 4MF0A 4RVKA 1H08A 1KSWA 5F4NA 3RM7A 2GFCA 2X0GA 2O5KA 5CVGA 4F9BA 3UP7A 3H10A 4PMMA 5CF4A 3O2MA 2R3MA 4J53A 4PX6A 3KK8A 3ZC6A 3PLSA 1UA2A 4D55A 4IW0A 3T9TA 3G33A 3JXWA 5L8JA 4OTFA 4G6LA 4TNBA 1TQIA 2ETKA 3ZZEA 4IDTA 5J5TA 5LMAA 4EYMA 4EOLA 4QPSA 4YZBA 2JBPA 3PP0A 4FR4A 4P2KA 3I6UA 3HVCA 1KE7A 3E7OA 5HE3A 1ND4A 1M52A 4RC4A 5ETIA 5I9VA 2RG6A 4EOSA 4BN1A 4U8ZA 5IH6A 3WE8A 2JFMA 3BHUA 3HA8A 4FV2A 5AAGA 2VO3A 3SLSA 4RRVA 1IA8A 3FDNA 1STCE 1QPJA 4NCTC 3VWAA 4C0TA 3QQHA 4YZMA 4JQ7A 4BDJA 5AUTA 3DJ5A 3DLSA 4MX9A 3F5UA 1K3AA 3BZ3A 4IM2A 5LWNA 5CSPA 3A7FA 1J91A 3DK6A 2VRXA 2A98A 3OP5A 4WBBB 3R00A 4NU1A 3GU6A 5IZFA 4AZVA 4W9XA 3ORZA 5FXQA 1XO2B 3BPRA 5J1WA 1ZAOA 1O6YA 2W1EA 5H8BA 4WNPA 2UZNA 4FIIA 4L46A 2YLFA 3LAUA 4IAAA 4EZ3A 5IH5A 1ZMWA 3BLQA 3QKKA 3GENA 1IEPA 2Y8OA 2ITPA 5A4CA 4YTIA 2E2BA 4PL3A 2J7TA 3KN5A 4RFYA 4B8LA 3UGCA 3PA5A 1ST4A 2CGVA 2BZJA 3LXLA 3S0OA 3ORMA 3F88A 5KMIA 4NM5A 1JSUA 3Q52A 4G5PA 2H6DA 3BYUA 2QCSA 4GUEA 3E62A 4MAOA 5J7HA 3MY5A 3NRMA 4FGBA 3EL8A 4LGHA 5F94A 3FEGA 3BX5A 2C0IA 3TEIA 4QTAA 4O7TA 5M06A 4AOJA 3A61A 2XJ2A 5J95A 3UG2A 1KE5A 3UQGA 2XEYA 3QRJA 4FIEA 3BEGA 2XRUA 4O0WA 4S32A 3R21A 4YSMA 3M11A 1DS5A 2OIBA 2R3FA 4HZRA 2X8EA 2EXEA 3VBWA 3OY1A 2REIA 3ZFYA 4O6LA 4C4FA 3AT3A 4R8QA 3IDBA 4XOYA 3KXMA 4L45A 4FSRA 4WUNA 5AR4A 4XV2A 2VWYA 5J8IA 4C2WA 3ZO4A 3DTCA 2JAVA 3K2LA 3FL5A 4OTIA 5L2TA 5AAEA 3NFGB 4CGAA 2A1AB 2FGIA 3OBJA 4EOPA 3PVWA 5EHOA 4R6VA 4TTHB 2OG8A 3E87A 3UMWA 5HZNA 3BV2A 5E9EA 5FEEA 4E4LA 1O6LA 1T46A 4CZTA 2Z7LA 3PG1A 4KABA 4NUSA 4RIXB 4MNFA 4ZTNA 2VU3A 3ZS5A 4TWOA 2BDFA 2OGVA 1QPDA 2VO0A 4LGDA 4RWLA 2BDWA 4DFZE 3QQKA 4BC6A 3KGAA 4U43A 3LFFA 2WMXA 4HJOA 5CQWA 3EQDA 4ZSGA 3UOHA 2GQSA 1OL7A 1W2FA 4IEBA 5GZ8A 2VO6A 4OBOA 1NA7A 4J1RA 5HG8A 4IJ9A 3QRTA 3W2PA 3R71A 4J8MA 3SXRA 4USFA 3ZLXA 1M2PA 4J97A 5LMKA 5E4HA 2HZIA 1A06A 3QUDA 4J7BA 2Z7QA 2WMAA 4CQGA 4E6QA 3W8LA 4FT3A 4TYJA 4ZOGA 3QD0A 3LW0A 3A8WA 4A9UA 1L3RE 4KAOA 4KNBA 4JMQA 4H3PA 3BGZA 5AUVA 3QYZA 4GU9A 3PVGA 3K3JA 3CD8A 3DLZA 3D5UA 2J90A 3FLQA 4AGDA 4CV9A 3I81A 1BL7A 3LCDA 3NW7A 4XG8A 4R77A 1YI4A 5HQ0A 2YM5A 1XH4A 4O7YA 4GK4A 2QOCA 2C6EA 3QXOA 3OS3A 4A7CA 4ACCA 4BBFA 1YDRE 4QQTA 5DWRA 3EQBA 4II5A 2XK6A 3WYYA 5JRQA 4DG3E 1E9HA 5EQPA 4UBAA 3EFJA 4AE6A 2A27A 4L01A 4PMTA 1WCCA 1OIYA 4AZEA 2XS0A 3IGGA 5CU3A 1F5QA 3DBFA 4ASZA 3MGYA 2XNBA 4XYFA 2UW5A 3O71A 2PVFA 4RQVA 4ANLA 4GRBA 4L44A 3GP0A 3FXWA 2GNFA 4IX5A 4CFMA 3SX9A