1Y6BA

Crystal structure of vegfr2 in complex with a 2-anilino-5-aryl-oxazole inhibitor
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
350
structure length
266
Chain Sequence
b'RLPYDASKWEFPRDRLKLGKPLGRGGQVIEADAFGIDKTATCRTVAVKMLKATHSEHRALMSELKILIHIGHHLNVVNLLGACTKPGGPLMVIVEFCKFGNLSTYLRSKRNEFVPYFLTLEHLICYSFQVAKGMEFLASRKCIHRDLAARNILLSEKNVVKICDFPLKWMAPETIFDRVYTIQSDVWSFGVLLWEIFSLGASPYPGVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTMLDCWHGEPSQRPTFSELVEHLGNLLQANA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Discovery and evaluation of 2-anilino-5-aryloxazoles as a novel class of VEGFR2 kinase inhibitors.
pubmed doi rcsb
molecule keywords Vascular endothelial growth factor receptor 2
source organism Homo sapiens
molecule tags Transferase
total genus 92
structure length 266
sequence length 350
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2004-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1y6bA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1y6bA01
1OPJA 3RPSA 2BMCA 5ANGA 4JDHA 3RJCA 2H9VA 1J1CA 1H26A 4FICA 2UVZA 3U55A 4BCPA 4O81A 4HPUE 1PMUA 2QR8A 2VWYA 3BYUA 2G01A 3MWUA 4K33A 5JEBA 5HTBA 5CLPA 3RHKA 4FE2A 4YTIA 1WBSA 4NIFA 3OTVA 4QD6A 3OY1A 4J8NA 3BYOA 3DDPA 3VVHA 4M3QA 1YXUA 3IG7A 1QCFA 2BTSA 5CEIA 4O0SA 1H0VA 1WVYA 3HGKA 1W8CA 3KCKA 4E8AA 3KXMA 2EU9A 4MBJA 3KMMA 1PRYA 3CKXA 3GQIA 4XJ0A 4ACMA 4EZ7A 4CNHA 4GMYA 3W32A 1MQBA 4ZS4A 4YJOA 2VV9A 3PJ3A 4FIEA 2VWUA 5J5SA 2XK7A 4FX3A 4KB8A 3UNKA 4CG9A 5AAGA 4MQ2A 4NKAA 2ITZA 5HBEA 3UO6A 5EQPA 5HO6A 1YDSE 4U44A 1KV1A 3AD4A 2YLFA 4JIAA 3DKOA 3OVVA 4RC2A 2UZUE 4JBQA 4IIRA 4ZTRA 1PYXA 4S34A 2BUJA 4OBQA 5AUTA 3DOGA 2UVXA 2XIXA 1YXVA 3NYVA 3GB2A 3O96A 4TZRA 3ZSIA 5IA2A 1OBDA 3CXWA 3NUUA 4C38A 4ZY4A 3QTQA 4LRMA 4CKJA 5JZNA 2HWPA 2HYYA 4YHTA 1LEWA 4YC3A 2X6EA 3DFCB 3EYHA 4NEUA 4UMPA 2CLQA 2QU6A 4Y73A 3R71A 4PTGA 1GIJA 4UB7A 4C33A 3EKNA 1KOBA 2XZSA 2VX1A 2QOLA 4JJRA 2WIPA 3FSKA 2YIRA 4TKSA 3QRJA 3SXSA 2G9XA 3BX5A 3V6RA 4DFXE 4QMSA 5K4IA 1O6LA 4X2GA 1OIRA 5K5XA 3WZDA 4LGHA 4KABA 3F66A 3GCSA 3ACJA 2HW6A 3DTCA 4YJRA 1ZWSA 2BIYA 3F2RA 1S9JA 5D7AA 4BDHA 1V1KA 1Z5MA 4IVCA 4RWJA 5EW9A 3VRYA 1KE5A 4QRCA 1ZAOA 3UOLA 4WUAA 3TIYA 4NYEA 4J53A 3BCEA 3FI4A 3AMAA 4X3FB 5FG8A 3Q2JA 1DM2A 3EN4A 3K3JA 2H8HA 2W1HA 2AUHA 3VO3A 1P14A 5A46A 3TEIA 3D5VA 5E8YA 4MNEA 2UZOA 4APPA 3AD6A 5AUWA 2JDOA 5LVPA 2R9SA 3BBWA 5CT0A 5KMKA 4DLJA 1AGWA 2X9FA 1U4DA 4QYYA 3BYVA 1GZKA 4N70A 2CGUA 4J97A 1XH9A 5EYDA 4RIWA 4OBOA 4CKRA 4M8TA 2FYSA 3FLWA 2I40A 4D4VA 1ZY4A 4NKSA 5JRSA 4WRSA 2E9OA 2BCJA 4QMLA 3BGQA 3WZJA 3DA6A 3TZMA 1ZYSA 3HAVA 2J6MA 2XNOA 3OWJA 3D2IA 4LGDA 2ZDTA 3OFMA 5BYYA 4BTJA 3TNIA 4F4PA 3R9OA 1OITA 4BCGA 5BVKA 4RQKA 3NX8A 4RT7A 4WO5A 3ZRMA 3LPBA 2OZOA 2YJRA 3VIDA 4YMJA 3MIYA 4X7QA 3DZOA 4IACA 4U45A 3QUPA 4A4LA 3CGOA 4I6FA 1XO2B 2BRNA 4O7VA 3IGGA 3O17A 4FSTA 3U51A 5CT7A 1XKKA 4KBKA 4KWPA 3S2PA 4FT9A 3RWPA 5HG5A 1KE6A 3GCVA 2PULA 3NUNA 4CSVA 4QQCA 2WELA 2IZUA 4CFWA 1RW8A 2ZM4A 3LFBA 4EH5A 4UMTA 4BGHA 2BAQA 4IX4A 1GOLA 3KRRA 3ENHA 1UKHA 3C7QA 3LLTA 4BCQA 2WTDA 3GU4A 4XEYA 4IWDA 3PRFA 2PVNA 2RFEA 4M67A 2QLUA 3WYYA 5IDPA 4DBXA 4D58A 1WAKA 3NUPA 4C4JA 3PZHA 4U40A 4V05A 4O27B 2BTRA 3OOMA 3RKBA 2BZIB 1K9AA 4R8QA 4FV0A 4PDYA 3Q52A 5AV4A 2GTMA 4J8MA 3R7GA 3G2FA 5AP7A 2HENA 1PXMA 4L53A 4B6LA 3NW6A 5IU2A 2OFVA 4QMWA 3G90X 2A4LA 4EBWA 4F6WA 3QYWA 3QUEA 3L8VA 5CSVA 4PX6A 2O5KA 4MD7E 4D2RA 5ICPA 2O63A 5DMZA 2XRWA 5ANKA 3KXGA 5IF1A 4I6HA 2YM8A 3RINA 4EK4A 3QCQA 4WIHA 2ETKA 1H07A 5HVKA 1JSUA 2WTWA 5M4IA 3OTUA 4YURA 1JAMA 4ZK5A 1YQJA 2F7EE 3E7VA 4L9IA 3NVMB 4PTEA 4QP7A 2WMVA 4Q5EA 3NAXA 4E93A 1B6CB 2RFSA 2GCDA 4GCJA 3HRCA 4FV7A 2JFMA 4FV9A 2B55A 1FVVA 1Q8ZA 5CU3A 2IWIA 1YRPA 3UOKA 2XKDA 3OXTA 4WKQA 3ZZEA 4LMNA 1H01A 2C68A 4RX5A 4YSJA 4EQMA 3NVKI 3DNDA 3G33A 4GV1A 2V7AA 3KN5A 5CAPA 4AGUA 3UDBA 4MXXA 4R5YA 4F7SA 1KV2A 5HBJA 1XQZA 3QU0A 3HUCA 3SVVA 3E64A 1UVRA 1Y6AA 2R3RA 4LL5A 1VYZA 3O51A 2BAKA 4A06A 3N4UA 4FGRA 5C01A 4FTUA 3QQKA 4EH2A 2VD5A 4NFNA 3VJOA 5JKGA 2BROA 2HW7A 4E4LA 5EM7A 2OG8A 2AYPA 5DT0A 5GJDA 2X8IA 3BGZA 3COMA 2R3LA 2VU3A 5IEXA 1PW2A 4CRLA 1J91A 2SRCA 3A2CA 4EORA 3R9DA 2C1AA 3NYNA 4FZ6A 5CAOA 5IQDA 3CBLA 1GJOA 3I79A 1YI6A 5EHYA 3EQCA 3T9IA 4JOAA 5FTOA 3IDCA 1M2RA 4FKIA 3DU8A 3KU2A 4O1PA 3MBLA 3PSDA 3ZO2A 2X39A 4O7LA 3TWJA 4EH3A 2CKQA 2QOCA 5CSHA 4AGDA 3F7ZA 5BVOA 4C35A 3DJ6A 4J52A 3QD3A 2UW8A 1SVHA 4FG9A 3HMIA 4RZWA 5DNRA 5B2LA 1P5EA 4ZP5A 5CU4A 2QOOA 2ESMA 3MY0A 4FEXA 3HECA 3C5IA 4EC8A 4O7NA 2IVUA 5FUTA 1TVOA 2REIA 2W99B 4YR8A 4XV3A 3HYHA 4O0RA 5I9YA 2XNPA 3DBDA 1ZMWA 5EDQA 4KAOA 3CGFA 4RJ3A 3UMXA 3VF9A 3PPKA 3K5VA 4S31A 2VNWA 3QC4A 5JT2A 4FZ7A 2OIBA 4ZXTA 4G6LA 4QMOA 4CVAA 3NIZA 3KK8A 4IQ6A 2DWBA 3V5WA 3Q60A 4DYMA 3QQFA 1ZOHA 2UW5A 2YJSA 4NCTC 4ZTNA 3IDBA 4L01A 3T3UA 4D1ZA 2O8YA 4MF0A 1SVEA 2CPKE 2VTHA 1UU9A 4W4WA 1YWVA 2JKMA 2JLDA 2PUPA 1P4FA 1QPEA 3VHKA 5D7VA 4FT7A 3FZSA 4FTCA 2CKEA 4QOXA 3KQ7A 3V8WA 5EQEA 2W5BA 4AW2A 3SX9A 1GZ8A 3C4EA 5AR2A 1JBPE 3BHTA 4A9UA 4O0TA 4GVAA 4DH8A 4WUNA 5FBOA 2CN5A 4N4SA 5J9YA 4ASXA 5M4FA 2CNQA 3FLZA 3LQ8A 1GNGA 1BMKA 5H3QA 1F5QA 4RPVA 3OF0A 2XNEA 1PXIA 4IWOA 4D5HA 2E9PA 3P0MA 4FKGA 1Q8WA 2YIQA 3B8RA 3R9RA 4ANMA 2R0UA 1J7IA 5E1SA 4U8ZA 3GC9A 5K3YA 4NUSA 2OJ9A 3MFRA 4QTDA 3VUGA 3C4FA 4I5MA 3VQHA 3U8WA 3QBNA 3ZUUA 4QMNA 1M52A 2V62A 4D9TA 2OJJA 2YIYA 4J71A 3WF5A 3TKIA 4UMRA 1I44A 2QD9A 4N6ZA 5GIOE 2J4ZA 5CWZA 3OXZA 3U9NA 4UMUA 4BDEA 4W8DA 4G5JA 2Z8CA 2PVKA 3RCJA 4DEIA 3V51A 1T46A 5JZJA 3RAWA 4UWBA 3FMJA 3PE2A 2PHKA 3LMGA 4C3PA 3E3PA 1DAYA 3DJ7A 2IO6A 3HEGA 5CZIA 3R8VA 4C57A 4MWHA 5IA0A 2O65A 2ZV7A 3F3UA 2XYNA 3GOKA 4JLCA 4LQMA 1OUKA 2W4KA 3PG3A 5IQGA 4L8MA 4PL4A 4JG8A 4D0XA 2QODA 4QMTA 4BDBA 1A48A 4AT4A 4DHFA 5KE0A 2C6OA 2PPQA 4JDKA 3BQCA 1ZRZA 2G1TA 2ERZE 4H05A 3ROYA 3VULA 5LVMA 1APME 4QT1A 4F0FA 3LKMA 2GS7A 4OLIA 2C6MA 4I3ZA 2J0KA 4NCTA 3ET7A 3C5UA 3K5UA 4KKEA 4EKLA 2BVAA 5E92A 5IH5A 4FOCA 3PA4A 4I4FA 3PXYA 5J95A 2Z60A 4IC7A 2R64A 4F1MA 2JIIA 2YM4A 5CU0A 4RVLA 3ZDIA 4YZDA 1S9IA 5LXMA 1Y8GA 3F7WA 3HDMA 4FZFB 5AR3A 4EL9A 2C5XA 5T68A 3FBVA 4YUQA 5HKMA 4UXQA 3OY3A 3DB6A 4CCUA 3QQUA 4TYHA 3JY9A 3GU7A 2Z7RA 3PVBA 3U4WA 1UV5A 2W4OA 3D7TB 5AP4A 4I6BA 5I3OA 4QO9A 2YERA 3TT0A 4AACA 5IPJA 1ZMVA 3VUDA 3JS2A 4GYGA 2JEDA 2GNFA 5JFXA 4EH6A 2GNHA 3EN5A 3VBVA 3M11A 1R78A 3MH3A 3PY3A 2ACXA 2VWBA 4OTPA 4X0MA 5FGKA 3D14A 5HIEA 2XM9A 2FB8A 2PVRA 3Q6UA 2YM3A 1JVPP 3E7OA 2XKFA 4ITIA 3QKKA 3LE6A 5EDPA 1SMHA 3CKWA 3MVMA 3M1SA 3DAKA 5CENA 3DKGA 5CNNA 3TUCA 2VRXA 2W9FB 4Y72A 3FKNA 4L43A 2C5NA 2JITA 5AP1A 5AX3A 4HW7A 5DRDA 2JDVA 5EOLA 3MY5A 4IZ7A 1BUHA 2BFYA 5GNKA 3V8SA 3K3IA 3NW5A 1URWA 2QR7A 3ZOSA 3FMMA 4FL2A 1H28A 2R3PA 5AMNA 3LZBA 4A9TA 4BYIA 2A1AB 1IEPA 3R1NA 3LXLA 4WG4A 4E5AX 3TIZA 2WTCA 2XCKA 3Q6WA 4DA5A 3UIBA 1ND4A 2OFUA 5KZIA 5TE0A 2XVDA 5EYCA 1M14A 1BL7A 2C0TA 4JRNA 4WT6A 2OU7A 3F9NA 2JD5A 3AC2A 3SC1A 4CCBA 2Z7SA 5B7VA 3DBEA 3FHIA 4HYSA 3WBLA 4DT8A 4PP7A 5I9XA 4AA4A 4AOIA 3PSBA 2GS6A 4C59A 5IUHA 4E4MA 1WVWA 3AC1A 4FT0A 5D41A 2QO7A 4CEGA 4YZBA 4C3FA 3WF6A 1TQIA 4FV8A 2J90A 3QQJA 4LRJA 3R73A 3LMIA 2A27A 3SXRA 3L8XA 3SOAA 2PMNX 3QA8A 4K18A 4MK0A 3QHRA 4TY1A 3ZSGA 3TNWA 5KBRA 3PIZA 4ZOGA 1QPCA 4U42A 4IJPA 1IRKA 2YLEA 3MDYA 1CMKE 5BMMA 4GT3A 5FXRA 3RPVA 5FP5A 5LMKC 5CF6A 4EEVA 4CFVA 3QTIA 1H24A 3A99A 4FEVA 4ZZNA 4BZNA 2YZLA 5HNBA 3AC5A 4BTMA 4D2WA 5DE2A 1Y91A 2PL0A 3FAAA 4BCIA 2CDZA 4ZSEA 4EHVA 4CRSA 5FTGA 4CZYB 4O7ZA 1ZZ2A 3ORNA 3RTPA 3VUIA 1W0XC 3ULIA 4EJ7A 5HO8A 4O86A 2F9GA 3HA8A 4FI1A 3ZO4A 4ACHA 1SVGA 1CM8A 4ZY6A 3OUKA 3HRFA 2J51A 5DH3A 3ZZWA 2VN9A 3LFFA 2XCHA 3QX2A 2EXEA 1TQMA 4GKHA 4ANSA 4LUDA 4XRLA 2NO3A 4GK4A 5HE0A 1ZMUA 2R3HA 1ZYDA 5K9IA 1CKIA 4RIXB 4F64A 5C4LA 2J0IA 2XKCA 3Q9XA 2CCHA 3OW3A 3H0ZA 4JX3A 5J1VA 4ANQA 4GH2A 3ZFXA 3KY2A 3RI1A 1KE7A 2JDSA 4RGJA 3R7OA 2C4GA 4ZAUA 2EB2A 3FXWA 4BWPA 3DXNA 2XM8A 5H8GA 4ZJJA 3OT3A 3BLHA 1YXSA 2OI4X 3BGPA 2RG6A 4NH1A 5M08A 1M2PA 5HHWA 5CALA 5EI6A 2ZOQA 1W7HA 2WQEA 2X4FA 3HMMA 2JAMA 1LR4A 2XIRA 4CFUA 5CF5A 3KVXA 2ZM3A 3QQHA 1OIUA 1RQQA 4IX5A 4DFUA 2X8DA 4O0YA 4FG7A 3WZEA 4BI0A 3C51A 3PFQA 4TNDA 3DBQA 4I92A 5CYIA 3F2AA 4QQ5A 3ZLYA 2BZJA 2YFXA 3F5GA 3E8CA 1IA9A 3GOPA 2RSVA 1PMNA 4IVDA 4QP3A 1BLXA 3FI8A 1ZZLA 4BZDA 5DYJA 2EXCX 3GGFA 4XH6A 1AD5A 4CXAA 5LMKA 4YZ9A 3KMWA 3OBGA 5LMAA 4EQUA 4AS0A 1WBOA 3EMGA 5AA9A 4XBUA 5EI8A 2CNVA 3FLYA 4FGBA 3HRBA 3CJFA 4IWQA 2R3NA 1YHSA 3FI3A 4FTRA 4O2PA 2X0GA 3W33A 4BWKA 5M56A 4CFNA 2J50A 3FWQA 3COKA 4NIFB 1ZYCA 4O22A 4UBAA 4C4GA 5L8LA 1OM1A 4L45A 4S30A 4WOVA 1PXPA 1T45A 2QONA 2Y4PA 3KC3A 3MFSA 4IB0A 5LWNA 2HOGA 4O7YA 3PWDA 3C0HA 4XOZA 3QRTA 4DN5A 2BRHA 2J0MB 2VAGA 3O8TA 5M06A 4LFIA 1YI4A 4R6VA 5I5ZA 3UO4A 4Z55A 3UJGA 2PUNA 3R0TA 4EHGA 1JKSA 1QPDA 2WTKB 1CKJA 4PDOA 2OF2A 4X2NA 1W83A 1IAJA 1LEZA 4J98A 2VO0A 3AD5A 4G34A 4EH4A 4WRGA 3AT3A 4TRLA 4R3CA 2XNNA 4JQ8A 3ZM4A 5CVFA 2VTMA 5KNJA 3QTZA 4EWQA 4M14A 2OJFE 3GI3A 2F7ZE 1RDQE 4C3RA 3PA5A 3F6XA 1Q4LA 2UVYA 3EQRA 3F88A 2PYWA 4FSUA 5L4QA 5TF9A 1EH4A 2PMOX 3VN9A 3TZ8A 1Q5KA 2YACA 4OBPA 2GQGA 1YW2A 3ODZX 3UODA 4R3RA 4LOQA 3LQ3A 5CEPA 3I7CA 4XBRA 2QO9A 2FO0A 4IAFA 3ORIA 5AV3A 4QYFA 2OJIA 2WGJA 3CQWA 2XIYA 5EDRA 2ZDUA 1FGKA 3PG1A 4RIXA 3O8UA 3QUDA 4HVIA 3SRVB 2B7AA 4RMZA 2GFCA 1PKDA 1YKRA 1JKLA 3JYAA 4U41A 4JBOA 1ZLTA 4FR4A 5TT7A 1VEBA 2CCIA 5JFWA 3U54A 2CLXA 4LL0A 2ZVAA 4DGNA 3V8TA 3SDJA 5IA1A 4BF2A 3BWFA 3EKKA 3QWKA 4DFBA 1H1SA 2HELA 2IW6A 4FODA 3MPMA 3F3TA 2XEZA 3VBWA 4FTOA 5AR8A 3EQIA 4FVQA 5E8XA 3SW7A 3FY2A 4Y8DA 1U59A 4JIKA 4C34A 5IQIA 2PVMA 3IOKA 4MD8E 4J99A 3PP0A 3M42A 3IO7A 3QQGA 4NM3A 2GPHA 3UYSA 2BZHB 3R63A 4EOOA 3O71A 3TTJA 1JOWB 5TR6A 5GJFA 4UALA 3ORTA 4AE6A 3CIKA 4BDDA 1J1BA 4MNEB 1UA2A 1TKIA 3UZRA 4FKVA 2Y4IB 1OI9A 2F57A 3EFWA 3HUBA 3R22A 4JR3A 4MHAA 4PL3A 4PTCA 4GG5A 4RIWB 3P79A 4GU6A 4FKTA 4USFA 5AAFA 3UZTA 3UVQA 1URCA 5E91A 3KN6A 3DTWA 2VTPA 3N9XA 4HCVA 3TNPC 5CEKA 3AQVA 3TL8A 4XG9A 4D2PA 1YDRE 2XUUA 4FTTA 4Y95A 5E8SA 2Q83A 3JR1A 3ZU7A 5IQFA 2GNLA 3H9FA 3KULA 3ZMMA 4CFMA 2WMUA 4EUUA 4QMMA 4TWCA 1FINA 5FDPA 2IZTA 4ENXA 4DGOA 1O6YA 4E4XA 4FNZA 4E5BA 4J96A 4C4FA 3FZ1A 2GTNA 2W1FA 5A54A 1PJKA 2OICA 4M7IA 2Y4IC 3MY1A 4U43A 5K0XA 3FPMA 4BDJA 5GZ8A 4IH8A 4MF1A 3R21A 4YC8A 4EK3A 2P33A 1IA8A 5A4EA 2IZRA 5L2TA 4QNAA 3ZC6A 2EWAA 1H8FA 1REKA 3EFKA 4XCUA 1DI8A 1H1WA 3P9JA 3W1FA 4GW8A 3NWWA 2YIWA 4U5JA 3GCPA 4V0GA 3QTUA 5BYZA 4HYIA 4BDFA 1Q3DA 4RVMA 3VS4A 4QNYA 2IJMA 3C9WA 3L8SA 2YAKA 4O2ZA 4WBOA 5FEEA 3KB7A 3EL7A 3TZ9A 5FQDC 4LG4A 1O6KA 2FVDA 5KMNA 3PDTA 3BV3A 5EM8A 3KFAA 4DBNA 5I4NA 3EHAA 3WI6A 5AV2A 3DKCA 5EW8A 3U6IA 1K2PA 1Q24A 2IVTA 3G0FA 4UZDA 5GHVA 4EK8A 3UQCA 5IQEA 4ZS0A 1M17A 3CLYA 3QZGA 4H36A 3ENMA 3LFAA 4WD5A 2C69A 3TUBA 3R7EA 3A60A 3NLBA 1V0BA 3SRVA 5J9LA 2J5FA 1WMKA 3PUPA 1SNUA 4OTFA 3TNQB 5EM5A 3EFJA 3SD0A 5BUJA 2GNIA 4I1ZA 5HNIX 2WNTA 3NEWA 4YTHA 3PTGA 1PF8A 4TTHB 3ZO3A 3LCKA 5GJGA 4ZJVA 3H10A 4L6QA 4BN1A 4C4EA 5M09A 4DTKA 2VTNA 2YAAA 4ITJA 1HCKA 2GHGA 3ZCLA 4BB4A 3IW6A 5DA3A 3ZLSA 4DINA 4EYJA 3FQEA 2PUIA 3U9CA 2H6DA 3R30A 3KF4A 2WIHA 4E6QA 5HZNA 1O9UA 2XJ0A 5HIBA 3PLSA 4AA0A 4ZZOA 3BIZA 4TXCA 4PNIA 2OKRA 4E73A 3H9RA 3MV5A 3ELJA 1BI8A 4FKLA 1YI3A 1H0WA 2PMLX 3QCSA 4RX9A 3R8MA 3DXQA 4NL0A 4I24A 3GP0A 1XH8A 4IB1A 4L00A 4D1SA 4BYJA 4TT7A 3EN7A 2J9MA 4ASEA 3U6HA 3LJ2A 2C6EA 5A4QA 5ITAA 4I5CA 4KS7A 3NNUA 2FSOX 5HLPA 5JN2A 1GZNA 3Q4CA 4PMTA 1OL6A 1UNGA 5KMJA 4FEUA 2PZRA 5AWMA 5HIDA 4HNIA 3LCOA 3KRLA 3FMHA 4CLIA 2C1BA 3PJ8A 1MQ4A 3AG9A 3THBA 2XMYA 4U79A 2WMXA 4F7LA 5AADA 5BVNA 4BY9E 3FL5A 4JT3A 3HZTA 2VO6A 4MNFA 2C5YA 3KVWA 4U80A 3WYXA 1I09A 4Q9SA 3NCZA 2WOTA 4ZTSA 4CZUA 2BKZA 4CT1A 4FSNA 4I5PA 4TYIA 4IDTA 4E20A 4BDCA 5T3QA 3IW4A 2VTOA 5H9BA 3ID6C 4DG2E 4G31A 2GFSA 2QOQA 4NU1A 4UY9A 4QPMA 4L46A 3PPJA 3FXZA 3FYKX 3TM0A 2WU6A 2Z2WA 3FMDA 2O3PA 4OTWA 3HX4A 2UZTA 4WHZA 1DI9A 3PXRA 4IE9A 4IM3A 3R7IA 3SV0A 1JQHA 5AA8A 5C8MA 2OH4A 4CTBA 3QTRA 4IDVA 4BTFA 5HO7A 3BV2A 1XH6A 3CS9A 5IH6A 5BVFA 5DN3A 3SKCA 4CG8A 4MXCA 4D2VA 3GENA 4I22A 4O1OA 2XJ2A 5F4NA 1HCLA 5KMLA 1GIHA 4IB3A 3MI9A 5D10A 4C4IA 2Y9QA 3ZHPC 3CY2A 3OP5A 4L67A 4ACCA 4O7SA 3OWKA 4FKWA 3IW5A 4PUZA 4ACDA 5KMIA 5E8TA 3QRIA 4V04A 3DK7A 4X6QC 4R3PA 5CF8A 2RFDA 4MBLA 1MRUA 4IC8A 3HMPA 4FV1A 2C3IB 3KXHA 3WIKA 4FF8A 4ZLOA 5JQ8A 3BHVA 3BZ3A 3DLZA 5L3AA 1J7UA 4KUJA 4OTHA 2I0VA 4RWLA 5HGIA 4CMTA 4QP6A 2QURA 3EN9A 1G3NA 2B9FA 3R04A 4NZWB 4AOJA 3FZPA 3NCGA 3CQEA 5HEZA 4ANOA 2B9HA 1OVEA 1JKKA 3UO5A 2GDOA 2XIZA 2Y8OA 3PJ2A 4YGAA 4BGQA 4F70A 4B8MA 4BI1A 5C26A 5CAVA 5HTIA 1CSNA 4IMYA 1OZ1A 3GEQA 2HXLA 5AP3A 2BDJA 4ZSGA 3MPTA 5BVWA 3VBYA 5M53A 1OL5A 3FYJX 2WFYA 4JBVA 4BI2A 3WZKA 2BDWA 4CD0A 4O7RA 5ACKA 4EOSA 1SYKA 2PE0A 3MA6A 5D1JA 5ANIA 5G6VA 4WBBB 4LYNA 4YJQA 2VUWA 4AXAA 1FMKA 2WQNA 3DY7A 2IVSA 2P55A 4PL5A 2BIKB 5CEQA 4GRBA 5IG1A 5IH4A 3ETAA 3VJNA 1JLUE 3GQLA 4V01A 3QAME 5L6WL 3DXPA 2WO6A 1PHKA 3Q5IA 4I0SA 2WMQA 4PMMA 3LW0A 4ENYA 4XLIA 3LIJA 2G15A 3R7VA 4MX9A 5DWRA 4A9SA 2W4JA 5DT3A 1Q3WA 3FDNA 4QMVA 4AG8A 4EYMA 3B8QA 4AE9A 4M15A 4X21A 3ORZA 3TN8A 4HOKA 3NUYA 1OECA 3HP5A 2ZB1A 3N51A 1OIQA 1UU3A 2VTJA 3II5A 3IDPA 3ALNA 3Q9WA 2VZ6A 4FVRA 2WHBA 4L7FA 5CQUA 5HLNA 4EK5A 5FD2A 2Q0NA 3E93A 1J7LA 3PLAE 4FIFA 3AGMA 5KX8A 5CU2A 5BVEA 4ALUA 5D12A 3RWQA 2R5TA 5L8JA 3I1AA 2F2CB 5KZ0A 3ANRA 3WE8A 4YO6A 5DVRA 3ZEPA 5AP6A 3MA3A 3VNTA 3FMEA 4MQ1A 4PPAA 1U46A 1PYEA 5DR9A 5ETCA 3Q53A 4AQCA 1LUFA 1PXJA 5AEPA 1TQPA 5J87A 3WOWA 4F63A 3ZBXA 3R9NA 4UYNA 2GQSA 4UEUA 2KTYA 5M4UA 4G3CA 4DF3A 5IMEA 5D11A 5A14A 3EJ1A 3R7YA 4FSQA 3CD8A 4YLKA 4GS6A 1WVXA 4X6RA 5I9VA 4ZSAA 2UW7A 3O7LB 3BWJA 1GAGA 2OF4A 3W10A 2EXMA 1H25A 5L2QA 3O23A 2YCFA 2DS1A 4TYHB 5KMMA 3DAJA 1ZOGA 2ZV9A 1CDKA 3O7LD 4FTAA 1M2QA 3UOHA 5I3RA 3GBZA 2RL5A 3R00A 1UWJA 3QKLA 1QL6A 2X1NA 3P86A 2Y0AA 2ZMDA 3PSCA 5HX8A 5K5NA 1KE9A 4FKOA 4QP2A 5GIPE 3UVRA 4BCOA 4FV2A 5DOSA 3LXKA 3OT8A 5IZFA 4ZMEA 1M7QA 4G1WA 3R2BA 5CI6A 3H9OA 2AC5A 2J0JA 3N4TA 2HZ4A 4EZ5A 4AW1A 5KMOA 1YWNA 3W55A 3PWYA 4IAKA 3OD6X 4CQGA 2UZWE 4R1VA 3QRKA 4QMXA 5M4CA 2CHLA 2XK8A 3PXQA 5L2WA 3D7ZA 3BHHA 5HG8A 3V5QA 3UIUA 3ZDUA 1UKIA 2UUEA 2C6DA 3QGYA 4HCUA 3GVUA 4RZVA 2WTIA 3DDQA 5HCYA 3FUPA 4YJUA 2JDTA 1Y8YA 2H96A 3RNIA 2OGVA 3LFDA 5CSPA 4BL1A 5JH6A 4FA2A 3C4WA 4Z9LA 2ZAZA 2Z02A 5CF4A 4FTKA 2YWVA 3GXLA 4JNWA 4Z3VA 3AC3A 3FC2A 3MW1A 3U6JA 2QOFA 3EL8A 5AP0A 2QKRA 4CKIA 3G0EA 4KS8A 4Y46A 3S1HA 3I5NA 4GK3A 2ITTA 2XRUA 4AF3A 4F65A 5HI2A 3VC4A 4C37A 3LCDA 5HVYA 2QU5A 4EOPA 2IZSA 2OJGA 3FJQE 3MVJA 4K2RA 4Z16A 2O64A 4O84A 4ZIMA 1JKTA 3JPVA 3R2YA 1AQ1A 1U5RA 1LP4A 2GS2A 1DAWA 4G3GA 4O38A 3RBWA 4DFNA 4E1ZA 5JRQA 3F3VA 3QKMA 3FEGA 3G6GA 2QG7A 4D4SA 4UYAA 3MIAA 3OW4A 5AV0A 2OIDA 3GFEA 1G5SA 3BEAA 2WEVA 3ZRLA 4D5KA 4KIPA 4AT3A 1R0EA 5AUVA 4M69A 2OSCA 4OR5A 4YLJA 3TTIA 4L3LA 2V55A 2I0YA 4WA9A 4B0GA 4E6AA 4WNMA 2W05A 4CMUA 4FKPA 4FTIA 3F5UA 3GNIB 3Q32A 4L3PA 4QYEA 3D15A 1R3CA 3SHEA 1E1XA 2QOKA 3QL8A 3SW4A 2R3MA 3FY0A 4I23A 4XG4A 5C27A 3TCPA 4R7IA 3VS0A 3VW8A 5AIKA 3OOGA 4WSYA 4A07A 3AT2A 4N6YA 2OBJA 1OBGA 5EQYA 4RRVA 4BC6A 1YOMA 2V5QA 3SG8A 5IEVA 2XEYA 4G2FA 2BILB 4YZNA 4BR3A 3FLSA 4O96A 3VHEA 4IWPA 3ZBFA 1ZOEA 3W16A 2VTIA 4OT5A 4AW5A 3QQLA 4ZSLA 4DFZE 4JX7A 1B39A 3FSFA 2WMTA 2C6LA 2R3QA 2YHVA 3O8PA 4JI9A 3TNHA 3T9TA 3RAHA 2CGWA 2G2FA 2R3FA 4PY1A 1L8TA 2PSQA 1Q8UA 3LXNA 4YC6A 5EKOA 4D1XA 4TW9A 3DLSA 3H4JA 5LVOA 4LV5A 4G3FA 2E9VA 4GT5A 3TKUA 4LGGA 1WBPA 2G2HA 3MGYA 3VUHA 4DEGA 3JVRA 1WFCA 1YXXA 4PPBA 4QMPA 4S2ZA 2ERKA 4CQEA 3TACA 3BQRA 4AZVA 4XRJA 4C62A 4GFGA 4G5PA 4TWPA 3U87A 2XH5A 3ORKA 3AMBA 3MTLA 2BRMA 1VYWA 2PE1A 3HLLA 2JIUA 4DG3E 4AP7A 3REPA 4JAJA 4EHZA 5T6KA 4BDIA 4D28A 3GCUA 1Q8TA 4EQCA 4CZTA 2BAJA 4YJNA 3CSVA 4GU9A 2UZDA 3NSZA 1KUTA 1QMZA 2P0CA 3G51A 3NNXA 3D5UA 3PJCA 3DQXA 4IAZA 4WG5A 5H8EA 5DRBA 4XG7A 4W4XA 3C0IA 3GC7A 3UC4A 2UW4A 2QNJA 2NRYA 3SLSA 2BFXA 2PTKA 4D4YA 4EONA 4U0IA 4GFOA 3DKFA 3QD0A 2X4ZA 3QHWA 2CKOA 1K3AA 3UGCA 5JFSA 4YP8A 2VO7A 5A3XA 2JBPA 4C61A 4U9AA 3COIA 3A7FA 4EI4A 4RSSA 4ZEGA 2PMIA 3DGKA 4NM0A 5FLFA 4A7CA 4M84A 4EJNA 2E9UA 4EKKA 1YXTA 1H27A 2VNYA 4WNOA 3G9NA 3NRMA 5HLWA 3KREA 2W1IA 4KNBA 5DEWA 2YCQA 3IQ7A 3D4QA 2LGCA 3C1XA 3R1QA 4BVUA 4Q5HA 5KCVA 2IPXA 2CKPA 4FTLA 4IAIA 3E87A 4AT5A 4DEBA 2JC6A 3UPXA 4GIHA 4H3PA 2X7GA 5I9WA 2QHMA 4BHZA 4HYHA 3BKBA 4G17A 2ITOA 4GEOA 3OEZA 1P2AA 5AUUA 5IUGA 5KBQA 3ZC5A 4ASZA 4U81A 4EWHA 4H1MA 4FV5A 2OIQA 3Q5ZA 4YNOA 4YHFA 5HCZA 2WOUA 4F6UA 3E3BX 3TV7A 5HE1A 2R3IA 4MXYA 1IR3A 4EZ3A 4JR7A 3CTQA 5AM6A 2B4SB 2JKKA 3PXFA 4ZJIA 3QC9A 5FM2A 5EW3A 4XV1A 2IN6A 5A4LA 2XNBA 4JL9A 5HU9A 2QLQA 4FK6A 4EC9A 4E7WA 3C0GA 2JGZA 3LOKA 4HJOA 4QTCA 4ERWA 4IXPA 4W9WA 5CASA 3NNWA 4UMQA 3FXXA 2HZIA 1OPLA 2C6IA 2X2KA 3FMNA 3D2KA 4HCTA 4LRKA 4FSMA 1OL2A 4PQNA 4UV0A 4F09A 2UZBA 2VWZA 5L6OA 3FLQA 3PJ1A 3QLGA 1UWHA 3A8WA 5ETFA 5LJJA 2YCSA 4W4YA 4EK6A 4FKUA 1UU8A 3UZPA 4BCMA 4NTTA 4BKJA 4LI5A 4RVTA 3LFSA 4DITA 2WPAA 5J79A 1Q99A 1JNKA 2UZLA 3D0EA 1U5QA 1ZY5A 3IKAA 2R3KA 4IVBA 2VX0A 2X2MA 3F3ZA 2YM6A 3E8NA 1R39A 1OMWA 3E8EA 4XS2A 3VBTA 4OTIA 4AZTA 4QMYA 2OH0E 3LHJA 2IG7A 3R1YA 3I60A 1VZOA 3Q9ZA 2W06A 4AUAA 4ANBA 3EIDA 3W2CA 2P4IA 2V7OA 5IISA 2BHEA 2W1DA 2O0UA 5BVDA 4RIOA 4QQTA 3HP2A 3PXKA 5KHXA 4DCAA 3KULB 3ODYX 4L3JA 3VS6A 5HD4A 4YPDA 4KBCA 3GU6A 4L42A 4K9YA 4FZAB 2YZAA 4TPTA 5FWKK 3S3IA 4ZTQA 4EH9A 3B2WA 3MH0A 4BKYA 3ZONA 3A8XA 4FTMA 4KSPA 4OT6A 5CVHA 5M57A 1Q97A 3UTOA 5LCKA 4BRXA 2GNJA 2IW8A 5J1WA 4TWNA 3MVLA 5CTPA 4BCHA 2PE2A 2OWBA 2WD1A 2X9EA 3PA3A 4KRDA 4UXLA 4V0GB 4MXAA 2BPMA 4FC0A 5FDXA 5CZHA 2YM5A 3MB6A 3Q4TA 2QG5A 4JAIA 5E8UA 3R7UA 3UP7A 4AU8A 4ZTLA 3KL8A 3VRZA 4BCJA 3CTHA 5AUZA 3R01A 2XIKA 3QCXA 4BIBA 4RIYA 2X7OA 4FSYA 4QP1A 3SOCA 2W1CA 5GINE 3L9NA 3IS5A 4UZHA 4F9AA 4DG0E 1WCCA 2ZM1A 3OZ6A 2OZAA 3HAMA 2FGIA 1KOAA 4QPAA 2I7QA 3HV3A 5J7HA 2PU8A 1KSWA 2ZV8A 4PWNA 2VTQA 4XNEA 5C9CA 4TL0A 5CXZA 2W9ZB 4F99A 3UOJA 4L52A 1XJDA 2I1MA 4CT2A 2BRGA 4DCEA 3NUSA 2WB8A 2VTRA 2P2IA 2WKMA 4I93A 4IEBA 3TJDA 3V6SA 3ZLWA 4B9DA 1FQ1B 4BTKA 3AOXA 4F7NA 2VTAA 1SNXA 3ORLA 3T8OA 5A6NA 3P7BA 2JFLA 4R5SA 3ZSHA 1IAHA 3HV4A 1XH4A 4ARKA 3T3VA 3TXOA 3VWAA 4AN2A 4H58A 1OPKA 3EB0A 4QTEA 3HL7A 2HZNA 5ANOA 4RLLA 3SG9A 2PVYA 4G16A 4I94A 2CMWA 2HZ0A 3DFAA 5E7RA 5AR5A 4FKJA 4USEA 2VWIA 5C1QB 5D9HA 2LAVA 5FP6A 4ZLYA 4O7WA 1Y57A 3E62A 3RGFA 2OLCA 3NMUF 4FYNA 3ANQA 1NXKA 3VUMA 3AGLA 5HBHA 4DEEA 5FEQA 3LJ0A 3NYOA 4A9RA 3VS3A 4GIIA 2X8EA 2YWPA 3LXPA 5IUIA 4C2WA 1OL7A 3OBJA 3VQUA 4EOKA 3TDWA 4DTBA 1XR1A 3JUHA 5C03A 1GIIA 2AC3A 3FZTA 3G9LX 1XHAA 2PVHA 5IA3A 2PVJA 3P1AA 4IAAA 4IB5A 4NJDA 4UX9A 5IQBA 4RJ5A 5B2KA 4KINA 2HY0A 4FUXA 4X2KA 4MYGA 4TNBA 3OCGA 4YBKA 3GC0A 3D94A 3EQBA 4CV8A 3DNEA 5CEMA 5DFPA 1Q41A 4FIJA 1PMEA 3P5KA 4MD9E 3BLQA 4GJ3A 1YVJA 2HCKA 4EHEA 3WF9A 2UZEA 2YDKA 3DV3A 1VR2A 5KUPA 2QOIA 1B38A 4OAVB 5IA5A 1UNHA 4FK3A 4P5ZA 4IM0A 5DGZA 4U3ZA 4MH7A 3UNZA 3WARA 4J1RA 4X3JA 4GL9A 4BZOA 4ZMFA 5IKWA 5CX9A 3OUNB 3W2RA 4FNYA 4Y5HA 3RM7A 3BBTB 5E8ZA 4FV3A 3F3WA 5F95A 2Y6OA 2PVLA 4G3DA 4IAYA 4GFMA 4JBPA 1WBWA 4KKHA 4GSBA 5ANDA 1MP8A 1XBAA 4O83A 4PRJA 4GVJA 3OWLA 3FC1X 5F1ZA 2WZJA 5CXHA 3VS1A 3HMOA 5E8WA 3FMLA 1GY3A 3PIYA 1PXNA 4DGLC 1OIYA 4ALWA 4GJ2A 4H39A 5HESA 1IASA 4LUEA 4HGSA 4P7EA 4UWCA 4E26A 2KULA 2UW0A 3OC1A 4K1BA 4PMPA 3C4CA 4M97A 5E8VA 2HIWA 3NZ0A 3MSSA 4IX3A 4WSQA 3FQSA 2ETRA 2X2LA 3EH9A 4Y85A 4BIEA 2W1ZA 5H8BA 2CGVA 4O0UA 4S32A 3H0YA 2FSTX 4XUFA 5HTCA 4DT9A 3DBCA 3EQDA 4NSTA 4RX8A 2RF9A 5DEYA 3ZFYA 5ANJA 3S0OA 4ACGA 4F9YA 4YO4A 2I6LA 3BU5A 4CFXA 1OUYA 3POOA 3JVSA 5LVLA 2QO2A 2F2UA 4M12A 3RAKA 4R7HA 2JKQA 3VS2A 3I5ZA 4AGCA 3C4XA 4PNKA 4RG0A 5L6PA 4IHPA 3QZFA 4DC2A 3FZOA 3V04A 3PY1A 1E1VA 4C2VA 3LCSA 4BDKA 2VWWA 1JWHA 5CI7A 4RJ4A 4A4OA 3DCVA 2XF0A 2HWOA 3DZQA 5FM3A 3RVGA 2UZNA 2I0EA 4W8EA 5E9EA 5EYKA 4IW0A 3ZYAA 4G6NA 3MB7A 5A4CA 4FKRA 1Y6BA 3AXWA 3KXXA 1MRVA 3QFVA 2C3KA 2BALA 1FBNA 2W0JA 2GQRA 3DT1A 2Y7JA 5HOAA 5HG7A 3QTSA 5HE2A 5L2IA 4DFLA 4AFEA 3IONA 5LMBA 3QWJA 5GZAA 4D9UA 3FI2A 4H3BA 2CN8A 4LOPA 4HZSA 1Q8YA 3C4ZA 2OK1A 3L9PA 1R0PA 3NR9A 4RA4A 4AZFA 4AGWA 4JQ7A 4IZ5A 3P7CA 2NP8A 3QXOA 1JPAA 2BHHA 2B1PA 3LAUA 2CJMA 5DIAA 2ITWA 4OGRA 4UWYA 4MVFA 4WNKA 3CD3A 4G9CA 2ITYA 1KWPA 3NYXA 3UBDA 4XG6A 4N57A 2H34A 1R1WA 4RJ7A 4XHKB 2ITXA 2FSLX 4I0TA 4TWOA 3RPRA 3ZS5A 4C36A 4O7TA 2VGOA 4RC4A 4BWXA 4HPTE 3IGOA 2UV2A 2C5OA 4PF4A 2WU7A 3FLNC 3E88A 1FOTA 5DLSA 3GT8A 3UP2A 2C5VA 2PWLA 2WEIA 4L7SA 5K4JA 2ITPA 3FKLA 2JDRA 1OGUA 2PZIA 4BFMA 3LVPA 2J5EA 2XK6A 4MBIA 4X3FC 2VGPA 3EOCA 3LQ5A 4ONAA 3UPZA 2R3JA 3WILA 4I21A 4C0TA 4EH7A 4ORKA 5BQ0A 4I4EA 3S95A 2JAVA 4ZZMA 2ONLC 4RFYA 4DH5A 4K8AA 3LFQA 4W9XA 2V22A 5HICA 4FMQA 4LOOA 4HNFA 4OTRA 4QPSA 4N0SA 3KRWA 2C0OA 3I4BA 3LCTA 4A4XA 1G8SA 4MEDA 3OCBA 5IEYA 4H1JA 3BU3A 4JQEA 1P4OA 3NGAA 2BRBA 1IG1A 5IQCA 3UG1A 1NVSA 2IVVA 4KKGA 4JS8A 3L9MA 2YM7A 2RIOA 5CANA 4G3EA 1NVQA 3CJGA 3OXIA 3ZO1A 3GC8A 3MJ1A 2Z7QA 4JDJA 5AFVA 3CPBA 3AMYA 2ITUA 3QZIA 4O21A 5CSWA 5HCXA 4EUTA 4QMZA 4RLKA 4BKZA 3P4KA 3CP9A 1OKWA 3BRBA 2B53A 1ERKA 4KSQA 5BUEA 3CEKA 3C13A 2ITVA 4I6QA 1FMOE 2FUMA 4OUCA 4F6SA 5IDNA 4NT4A 3DB8A 4DE4A 3V5PA 4CYIA 3V5TA 3Q2MA 3TKHA 1NA7A 2J2IB 3SXFA 3VAPA 4B8LA 2VWVA 5JQ5A 4LMUA 2W96B 3Q4UA 3BE2A 3VUTA 4KIQA 5JSMA 4JG6A 3FQHA 1PY5A 2F7XE 4XP0A 1XBBA 5C8NA 3GFWA 2PVFA 4F1TA 2WXVA 4MTAA 4AWIA 3I0OA 3H3CA 3U4UA 3RP9A 2YDIA 2JIVA 3A7HA 4GYIA 2VX3A 2PY3A 4AZSA 2NRUA 4FVPA 3VBQA 1A9UA 3VBXA 3QALE 2RKUA 3TV4A 2XK3A 2VWXA 2DYLA 3OROA 5HE3A 5G1XA 2BDFA 3FE3A 3CTJA 5C4KA 4IANA 3NIEA 5E1EA 4X3FA 3I6WA 3KEXA 3ATSA 2GSFA 4QMQA 2BR1A 4KIKB 4YZMA 4BICA 2R7IA 2QC6A 3HDNA 2ONLA 4QP8A 4K77A 1H1PA 3KRXA 1RJBA 3JY0A 3R9HA 3ZLXA 5EHOA 3QTXA 3EQGA 3RMFA 4FV4A 3VS7A 3SA0A 3UMWA 4IM2A 2HAKA 1J3HA 3I7BA 4RJ8A 2DQ7X 4RWKA 4QP9A 4AA5A 2WMBA 3SQQA 3A4PA 2XNMA 5DR2A 3V3VA 4P90A 4O6LA 4BCKA 5IMXA 4KRCA 4XG2A 2OXYA 2J7TA 2YITA 2QQ7A 3ZRKA 4FZDB 4NFMA 3BHYA 4FV6A 3COHA 4BBMA 4OTGA 5LARA 5HVJA 1CKPA 4FIGA 3RPYA 5BMSA 3EWHA 4JG7A 2YDJA 5FTQA 2X81A 3R02A 4IZYA 3MN3A 4Y5QA 1WBTA 3TZ7A 3UYTA 1F3MC 4IJ9A 5KO1A 1V0PA 3KXNA 3QLFA 4M69B 4AAAA 4DAWA 3E63A 4YZCA 5AAEA 5HQ0A 5EM6A 4DLIA 3UQGA 3QGWA 1JSTA 2UW3A 2EB3A 2RGPA 3UNJA 3UVPA 4XP3A 4OW8A 1ATPE 2P2HA 5J8IA 1FVRA 4M68A 4PP9A 2XB7A 5M55A 2ETMA 1JSVA 3BPRA 5JFVA 3UQFA 2XJ1A 3KK9A 4YU2A 4C02A 3PE1A 1BI7A 2PUUA 3F69A 5CU6A 5LWMA 3H30A 1X8BA 5I9ZA 2W7XA 5JGDA 3PVWA 4O0VA 3PY0A 2IW9A 2I0HA 3NNVA 3ORPA 4O0WA 1W82A 2C6KA 4FOBA 5B0XA 4CMOA 1XH5A 2GHLA 2X7FA 4CFFA 4F08A 5IQAA 2WTVA 3KGAA 3KXZA 3O0GA 1G8AA 3QA0A 2QHNA 5B2MA 3OS3A 4FL1A 2XBAA 3E5AA 1OKZA 5ACBC 5CAUA 3C50A 1U54B 3PXZA 2XKEA 3HNGA 3QXPA 2R0IA 2B0QA 2ZB0A 3CR0A 3WZUA 3HKOA 2PZYA 3RHXA 4YJSA 5A9UA 3FMKA 1XBCA 4IFCA 3IPHA 3UE4A 3DPKA 2JBOA 2OXXA 4J7BA 5CS6A 4I41A 3G6HA 3Q04A 5CQWA 5I9UA 3RAIA 4YLLA 4BBEA 4PMSA 4RC3A 3MH1A 4HGLA 3QD4A 4E4NA 3PVUA 4FIIA 2BZKB 4YJVA 3ZH8A 4B99A 4W4VA 2UZVA 3OCTA 3AC8A 1PXKA 4DGMA 3DJ5A 3IW8A 4AX8A 3JXWA 4RWIA 4KIKA 5LOHA 1UNLA 2RG5A 4R7BA 4X2JA 4XLVA 1XWSA 4GK2A 1STCE 4O91A 3DK3A 2W1GA 4GG7A 1FGIA 4OAUC 4M0YA 4MXZA 2YEXA 3HV7A 4C58A 2YN8A 1Q62A 5J7BA 4YNEA 5L8KA 3RCDA 4CYJA 4B7TA 2YISA 4RVKA 4AN3A 2XP2A 2E2BA 4PPCA 1PXLA 5AR7A 5AM7A 4P5QA 3VS5A 4EOMA 5L2SA 3Q96A 4F7JA 5AUXA 1ZYLA 2FH9A 4BDGA 2OW3A 3PP1A 4GUBA 4HGEA 4XV2A 5AP2A 3L8PA 3R8UA 3HVCA 5EK7A 4Q9ZA 1NW1A 2B9JA 4H3QA 4GKIA 4F9WA 3S00A 3OHTA 3MH2A 4FT3A 5ETAA 3D5XA 4KBAA 3OWPA 5M44A 3L1SA 3M2WA 4BGGA 4XOYA 2G2IA 4ZSJA 5JMSA 3RK5A 3K2LA 3BE9A 3I6UA 3P78A 3AT4A 3QF9A 4JXFA 4D2SA 1H4LA 2OO8X 3R8ZA 3IW7A 5CEOA 3A7IA 1H00A 1FPUA 4AFJA 3IOPA 5DT4A 5HORA 3LMHA 1QPJA 3HV6A 4ID7A 3QD2B 4YSMA 2C47A 3TG1A 2WQOA 4RQVA 4CV9A 3O50A 4J95A 2WQBA 2VO3A 3RZBA 4D55A 2QOHA 3MVHA 5DG5A 2GNGA 2R2PA 5LQFA 4K11A 4F0GA 4XMOA 4Z7GA 3FV8A 1SZMA 4YHJA 4HVGA 3CCNA 3L9LA 4RBLA 3ORMA 3W2SA 3NAYA 3BLRA 1CTPE 2FSMX 5HU3A 3A4OX 4YJPA 3HV5A 4YPSA 3DAEA 2XNGA 4HYUA 4Z7HA 3F82A 4KA3A 5CAQA 4BCFA 3Q9YA 4AN9A 4XV9A 5BYLA 5DHJA 3CQUA 3P23A 2C6TA 3D83A 3PIXA 4M66A 4BBFA 3NPCA 5DI1A 3LLAA 4IVAA 1BKXA 1L3RE 2F49A 2GU8A 3WIGA 1U54A 1ZARA 4HZRA 2OXDA 4RX7A 4RFZA 4HVSA 3BELA 3R1SA 1GZOA 4FKQA 4U7ZA 3E92A 5FXQA 4QTAA 1OB3A 4FTJA 3CPCA 4D2TA 3ROCA 3NDMA 2HXQA 1E9HA 3GUBA 5EOBA 4IFGA 4M13A 3ULZA 3VF8A 4NK9A 3ZXZA 5JK3A 4KD1A 5A6OA 4HVHA 4S33A 4P4CA 3EQFA 4R78A 4QQJA 5AIRA 3R83A 1YOLA 4MAOA 5M07A 3PRIA 5EFQA 3ZTXA 4ALVA 5LCJA 4I20A 4L44A 3OG7A 3EQHA 5HG9A 2CNUA 1FVTA 1OKYA 1W84A 3KCFA 4FNWA 3V01A 5DBXA 4XG8A 3PYYA 4K6ZA 2JKOA 4AOTA 3R8LA 2ITNA 3A61A 5ANEA 3QCYA 3TI1A 5I0BA 2QI8A 5H2UA 3ATTA 4HGTA 4O82A 3GU5A 3LM0A 1YHWA 3N4VA 4FYOA 3RK9A 3F61A 3LJ1A 4ZTMA 3RK7A 3EYGA 3FKOA 4FG8A 3ZFMA 5AX9A 1OKVA 4PDPA 4FTQA 3D9VA 4L68A 3O2MA 3ZUTA 2HK5A 5EHLA 5BUIA 2WTJA 4F1OA 3MJ2A 4E6CA 4PV0A 4YBJA 2B9IA 3F5XA 4KIOA 3CY3A 2Z7LA 4RJ6A 2ITQA 2W5AA 3ERKA 3E8DA 4FBXA 2PZPA 2YA9A 3KRJA 5F20A 2CSNA 3EQPA 4XX9A 1H08A 4ITHA 4ANLA 4E5WA 1PXOA 4HVDA 2C3LA 5AR4A 2GMXA 4AZWA 4DEDA 4CTCA 1F0QA 4DH3A 4K0YA 1RE8A 2R7BA 3TUDA 3LFCA 3QZHA 1BL6A 2B54A 2DUVA 3DK6A 3LFNA 4O6EA 4RIYB 4FSWA 1UU7A 3OEFX 4FEQA 4QYGA 1WBVA 1OL1A 3UIMA 5F94A 4U3YA 5EH0A 3MFTA 3B2TA 3WE4A 4DGGA 5M51A 2OZAB 3LFEA 3NUXA 2WMSA 2XBJA 3BYMA 5CSXA 3RZFA 3A62A 3NW7A 4MCVA 5A4TA 4USDA 1DS5A 3QTWA 4FKSA 3I0QA 1H1QA 5DR6A 5HX6A 4EOQA 5TOZA 1Q61A 3HMNA 3BU6A 3SAYA 3BI6A 5BNJA 3BHUA 4QTBA 3DQWA 5BPYA 2NNWB 4DH1A 3CE3A 3VUKA 4QMUA 1WBNA 4EOJA 3EFLA 1BX6A 5AP5A 5EG3A 3D7TA 4F0IA 3S4QA 3AC4A 2W1EA 3PPZA 4JVGA 4MKCA 4C4HA 3FL4A 1H1RA 4P2KA 4EBVA 4RA5A 3W8LA 3SGCA 3KKVA 4C8BA 4FEWA 1A06A 2E9NA 4Q2AA 3UIXA 4BCNA 4E3CA 4DTAA 3OCSA 2C30A 2EVAA 3EN6A 3V5JA 5J5TA 4ZLZA 5IQHA 3ZM9A 3KA0A 1PKGA 4NW6A 3W18A 3RPOA 5FRIA 2GHMA 4U6RA 5EYMA 3VW6A 2XYUA 1V0OA 3MTFA 2QOBA 3QYZA 1LPUA 2XS0A 3POZA 4IBMA 3MESA 5FEDA 4DFYA 4NM7A 2R3GA 3R6XA 4FUYA 5JGAA 2A19B 3TDVA 1MRYA 2P3GX 4G9RA 2Q0BA 4I0RA 2UW6A 2Y6MA 3R28A 2WMRA 4MWIA 4D0WA 2R4BA 4ZTHA 2V0DA 4B4LA 5HNGA 2W17A 4EOIA 4WG3A 3G5DA 4EH8A 3CC6A 2WQMA 5C8KA 3G15A 3PZEA 5EI2A 4NTSA 2XA4A 4G6OA 3GU8A 2RFNA 5GZ9A 3W8QA 4MXOA 3WF8A 3PVGA 5CNOA 1VJYA 5AUYA 2FA2A 3W2QA 1BYGA 3RM6A 3RALA 2F4JA 3EZRA 4ERKA 4YTCA 2O2UA 1PMVA 3ZEWA 3MPAA 3Q4ZA 3ZXTA 4GUEA 2J0LA 3FPQA 2ZMCA 4JRVA 4NWMA 3W2PA 2XK4A 4II5A 4NM5A 4D4RA 1W98A 3UG2A 2WMWA 4QYHA 4TYGA 5ETIA 3BEGA 4TYEA 2PZ5A 4IX6A 4ZY5A 3TV6A 4BDAA 4WNPA 5KKRB 3R8PA 4R1YA 1Z9XA 5JGBA 4ASDA 3HA6A 1REJA 3P08A 1YDTE 2R3OA 4YJTA 5KHWA 4F9CA 4NJ3A 1HOWA 4DH7A 4JDIA 4NW5A 2VTSA 4X2FA 1MUOA 4CGAA 3NS9A 2PK9A 4DEAA 2YABA 2CGXA 2QKWB 4FSRA 3F5PA 5E90A 1WZYA 3EZVA 3UC3A 2X6DA 3OMVA 2BKKA 3D5WA 3DBFA 3GCQA 3ORXA 1XH7A 2YCRA 4F9BA 4Y83A 2VTLA 5BX0A 3V5LA 4UN0C 3ACKA 3FZRA 3MS9A 1YOJA 1Z57A 2A0CX 1NVRA 5CVGA 3RNYA 5CY3A 3A7JA 5FXSA 3A7GA 5KKRC 3IK3A 4BHNA 5TKDA 3ZUVA 4IZAA 4ANNA 4FTNA 4PDSA 4XP2A 4DEHA 4FL3A 4OTDA 2WTKC 5HD7A 3NUAA 3ITZA 4C7TA 3FHRA 4APCA 4XYFA 3IECA 4LM5A 4TN6A 2W5HA 3KF7A 4O0XA 3WF7A 3QX4A 5TO8A 4AZEA 2YIXA 2C3JA 4CLJA 4QP4A 4XG3A 2QVSE 2ZV2A 4FSZA 2EUFB 3K54A 1NT2A 4R77A 3MFUA 2WAJA 4YTFA 2WMAA 3MYGA 4RFMA 2QCSA 2ZYBA 3QRUA 5E4HA 1YWRA 4M0ZA 5J9ZA 2ZJWA 4LV8A 3LM5A 4TYJA 1KE8A 3ALOA 5FBNC 4AW0A 5EKNA 3DS6A 1YHVA 1M7NA 2A2AA 2VTTA 5DPVA 2C0IA 5AJQA 3F2NA 4E6DA 3I81A 3KMUA 3BYSA 1ZYJA 3P7AA 4GT4A 4FT5A 1SM2A 1ZXEA 2B52A 4FIHA 4I5HA 3Q3BA 4A9YA 5K0KA 4FNXA 4EOLA 1NY3A 5LVNA 2NPQA 3TJCA 4OTQA 4BIDA 2XK9A 4U97A 5F9EA 3W2OA 4IADA 5IA4A 5AV1A 2HY81 2UW9A
chains in the Genus database with same CATH superfamily
1OPJA 3RPSA 2BMCA 5ANGA 4JDHA 3RJCA 2H9VA 1J1CA 1H26A 4FICA 2UVZA 3U55A 4BCPA 4O81A 4HPUE 1PMUA 2QR8A 2VWYA 3BYUA 2G01A 3MWUA 4K33A 5JEBA 5HTBA 5CLPA 3RHKA 4FE2A 4YTIA 1WBSA 4NIFA 3OTVA 4QD6A 3OY1A 4J8NA 3BYOA 3DDPA 4JMQA 3VVHA 4M3QA 1YXUA 3IG7A 1QCFA 2BTSA 5CEIA 3UDZA 4O0SA 1H0VA 1WVYA 3HGKA 1W8CA 3KCKA 4E8AA 3KXMA 2EU9A 4MBJA 3KMMA 1PRYA 3CKXA 3GQIA 4XJ0A 4ACMA 4EZ7A 4CNHA 4GMYA 3W32A 1MQBA 4ZS4A 4YJOA 2VV9A 3PJ3A 4FIEA 2VWUA 5J5SA 2XK7A 4FX3A 4KB8A 3UNKA 4CG9A 5AAGA 4MQ2A 4NKAA 2ITZA 5HBEA 3UO6A 5EQPA 5HO6A 1YDSE 4U44A 1KV1A 3AD4A 2YLFA 4JIAA 3DKOA 3OVVA 4RC2A 2UZUE 4JBQA 4IIRA 4ZTRA 1PYXA 4S34A 2BUJA 4OBQA 5AUTA 3DOGA 2UVXA 2XIXA 1YXVA 3NYVA 3GB2A 3O96A 4TZRA 3ZSIA 5IA2A 1OBDA 3CXWA 3NUUA 4C38A 4ZY4A 3QTQA 4LRMA 4CKJA 5JZNA 2HWPA 2HYYA 4YHTA 1LEWA 4YC3A 2X6EA 3DFCB 3EYHA 4NEUA 4UMPA 2CLQA 2QU6A 4Y73A 3R71A 4PTGA 1GIJA 4UB7A 4C33A 3EKNA 1KOBA 2XZSA 2VX1A 2QOLA 3BLAA 4JJRA 2WIPA 3FSKA 2YIRA 4TKSA 3QRJA 3SXSA 2G9XA 3BX5A 3V6RA 4DFXE 4QMSA 5K4IA 1O6LA 4X2GA 1OIRA 5K5XA 3WZDA 4LGHA 4KABA 3F66A 3GCSA 3ACJA 2HW6A 3DTCA 3NFFB 4YJRA 1ZWSA 2BIYA 3F2RA 1S9JA 5D7AA 4BDHA 1V1KA 1Z5MA 4IVCA 4RWJA 5EW9A 3VRYA 1KE5A 4QRCA 1ZAOA 3UOLA 4WUAA 3TIYA 4NYEA 4J53A 3BCEA 3FI4A 3AMAA 4X3FB 5FG8A 3Q2JA 1DM2A 3EN4A 3K3JA 2H8HA 2W1HA 2AUHA 3VO3A 1P14A 5A46A 3TEIA 3D5VA 5E8YA 4MNEA 2UZOA 4APPA 2IEWA 3AD6A 5AUWA 2JDOA 5LVPA 2R9SA 3BBWA 5CT0A 5KMKA 4DLJA 1AGWA 2X9FA 1U4DA 4QYYA 3BYVA 1GZKA 4N70A 2CGUA 4J97A 1XH9A 5EYDA 4RIWA 4OBOA 4CKRA 4M8TA 2FYSA 3FLWA 2I40A 4D4VA 1ZY4A 4NKSA 5JRSA 4WRSA 2E9OA 2BCJA 4QMLA 3BGQA 3WZJA 3DA6A 3TZMA 1ZYSA 3HAVA 2J6MA 2XNOA 3OWJA 3D2IA 4LGDA 2ZDTA 3OFMA 5BYYA 4BTJA 3TNIA 4F4PA 3R9OA 1OITA 4BCGA 5BVKA 4RQKA 3NX8A 4RT7A 4WO5A 3ZRMA 3LPBA 2OZOA 2YJRA 3VIDA 4YMJA 3MIYA 4X7QA 3DZOA 4IACA 4U45A 3QUPA 4A4LA 3CGOA 4I6FA 1XO2B 2BRNA 4O7VA 3IGGA 3O17A 4FSTA 3U51A 5CT7A 1XKKA 4KBKA 4KWPA 3S2PA 4FT9A 3RWPA 5HG5A 1KE6A 3GCVA 2PULA 3NUNA 4CSVA 4QQCA 2WELA 2IZUA 4CFWA 1RW8A 2ZM4A 3LFBA 4EH5A 4UMTA 4BGHA 2BAQA 4IX4A 1GOLA 3KRRA 3ENHA 1UKHA 3C7QA 3LLTA 4BCQA 2WTDA 3GU4A 4XEYA 4IWDA 4QDVA 3PRFA 2PVNA 2RFEA 4M67A 2QLUA 3WYYA 5IDPA 4DBXA 4D58A 1WAKA 3NUPA 4C4JA 3PZHA 4U40A 4V05A 4O27B 2BTRA 3OOMA 3RKBA 2BZIB 1K9AA 4R8QA 4FV0A 4PDYA 3Q52A 5AV4A 2GTMA 4J8MA 3R7GA 3G2FA 5AP7A 2HENA 1PXMA 4L53A 4B6LA 3NW6A 5IU2A 2OFVA 4QMWA 3G90X 2A4LA 4EBWA 4F6WA 3O5AA 3QYWA 3QUEA 3L8VA 5CSVA 4PX6A 2O5KA 4MD7E 4D2RA 5ICPA 2O63A 5DMZA 2XRWA 5ANKA 3KXGA 5IF1A 4I6HA 2YM8A 3RINA 4EK4A 3QCQA 4WIHA 2ETKA 1H07A 5HVKA 1JSUA 2WTWA 5M4IA 3OTUA 4YURA 1JAMA 4ZK5A 1YQJA 2F7EE 3E7VA 4L9IA 3NVMB 4PTEA 4QP7A 2WMVA 4Q5EA 3NAXA 4E93A 1B6CB 2RFSA 2GCDA 4GCJA 3HRCA 4FV7A 2JFMA 4FV9A 2B55A 1FVVA 1Q8ZA 5CU3A 2IWIA 1YRPA 3UOKA 2XKDA 3OXTA 4WKQA 3ZZEA 4AQKA 4LMNA 1H01A 2C68A 4RX5A 4YSJA 4EQMA 3NVKI 3DNDA 3G33A 4GV1A 2V7AA 3KN5A 5CAPA 4AGUA 3UDBA 4MXXA 4R5YA 4F7SA 1KV2A 5HBJA 1XQZA 3QU0A 3HUCA 3SVVA 3E64A 1UVRA 1Y6AA 2R3RA 4LL5A 1VYZA 3O51A 2BAKA 4A06A 3N4UA 4FGRA 5C01A 4FTUA 3QQKA 4EH2A 2VD5A 4NFNA 3VJOA 5JKGA 2BROA 2HW7A 4E4LA 5EM7A 2OG8A 2AYPA 5DT0A 5GJDA 2X8IA 3BGZA 3COMA 2R3LA 2VU3A 5IEXA 1PW2A 4CRLA 1J91A 2SRCA 3A2CA 4EORA 3R9DA 2C1AA 3NYNA 4FZ6A 5CAOA 5IQDA 3CBLA 1GJOA 3I79A 1YI6A 5EHYA 3EQCA 3T9IA 4JOAA 5FTOA 3IDCA 1M2RA 4FKIA 3VONA 3DU8A 3KU2A 4O1PA 3MBLA 3PSDA 3ZO2A 2X39A 4O7LA 3TWJA 4EH3A 2CKQA 2QOCA 5CSHA 4AGDA 3F7ZA 5BVOA 4C35A 3DJ6A 4J52A 3QD3A 2UW8A 1SVHA 4FG9A 3HMIA 4RZWA 5DNRA 5B2LA 1P5EA 4ZP5A 5CU4A 2QOOA 2ESMA 3MY0A 4FEXA 3HECA 3C5IA 4EC8A 4O7NA 2IVUA 5FUTA 1TVOA 2REIA 2W99B 4YR8A 4XV3A 3HYHA 4O0RA 5I9YA 2XNPA 3DBDA 1ZMWA 1VLRA 5EDQA 4KAOA 3CGFA 4RJ3A 3UMXA 3VF9A 3PPKA 3K5VA 4S31A 2VNWA 3QC4A 5JT2A 4FZ7A 2OIBA 4ZXTA 4G6LA 4QMOA 4CVAA 3NIZA 3KK8A 4IQ6A 2DWBA 3V5WA 3Q60A 4DYMA 3QQFA 1ZOHA 2UW5A 2YJSA 4NCTC 4ZTNA 3IDBA 4L01A 3T3UA 4D1ZA 2O8YA 4MF0A 1SVEA 2CPKE 2VTHA 1UU9A 4W4WA 1YWVA 2JKMA 2JLDA 2PUPA 1P4FA 1QPEA 3VHKA 5D7VA 4FT7A 3FZSA 4FTCA 2CKEA 4QOXA 3KQ7A 3V8WA 5EQEA 2W5BA 4AW2A 3SX9A 1GZ8A 3C4EA 5AR2A 1JBPE 3BHTA 4A9UA 4O0TA 4GVAA 4DH8A 4WUNA 5FBOA 2CN5A 4N4SA 5J9YA 4ASXA 5M4FA 2CNQA 3FLZA 3LQ8A 1GNGA 1BMKA 5H3QA 1F5QA 4RPVA 3OF0A 2XNEA 1PXIA 4IWOA 4D5HA 2E9PA 3P0MA 4FKGA 1Q8WA 2YIQA 3B8RA 3R9RA 4ANMA 2R0UA 1J7IA 5E1SA 4U8ZA 3GC9A 5K3YA 4NUSA 2OJ9A 3MFRA 4QTDA 3VUGA 3C4FA 4I5MA 3VQHA 3U8WA 3QBNA 3ZUUA 4QMNA 1M52A 2V62A 4D9TA 2OJJA 2YIYA 4J71A 3WF5A 3TKIA 4UMRA 1I44A 2QD9A 4N6ZA 5GIOE 2J4ZA 5CWZA 3OXZA 3U9NA 4UMUA 4BDEA 4W8DA 4G5JA 2Z8CA 2PVKA 3RCJA 4DEIA 3V51A 1T46A 5JZJA 3P5JC 3RAWA 4UWBA 3FMJA 3PE2A 2PHKA 3LMGA 4C3PA 3E3PA 1DAYA 3DJ7A 2IO6A 3HEGA 5CZIA 3R8VA 4C57A 4MWHA 5IA0A 2O65A 2ZV7A 3F3UA 2XYNA 3GOKA 4JLCA 4LQMA 1OUKA 2W4KA 3PG3A 5IQGA 4L8MA 4PL4A 4JG8A 4D0XA 2QODA 4QMTA 4BDBA 3W0RA 1A48A 4AT4A 4DHFA 5KE0A 2C6OA 2PPQA 4JDKA 3BQCA 1ZRZA 2G1TA 2ERZE 4H05A 3ROYA 3VULA 5LVMA 1APME 4QT1A 4F0FA 3LKMA 2GS7A 4OLIA 2C6MA 4I3ZA 2J0KA 4NCTA 3ET7A 3C5UA 3K5UA 4KKEA 4EKLA 2BVAA 5E92A 5IH5A 4FOCA 3PA4A 4I4FA 3PXYA 5J95A 2Z60A 4IC7A 2R64A 4F1MA 2JIIA 2YM4A 5CU0A 4RVLA 3ZDIA 4YZDA 1S9IA 5LXMA 1Y8GA 3F7WA 3HDMA 4FZFB 5AR3A 4EL9A 2C5XA 5T68A 3FBVA 4YUQA 5HKMA 4UXQA 3OY3A 3DB6A 4CCUA 3QQUA 4TYHA 3JY9A 3GU7A 2Z7RA 3PVBA 3U4WA 1UV5A 2W4OA 3D7TB 5AP4A 4I6BA 5I3OA 4QO9A 2YERA 3TT0A 4AACA 5IPJA 1ZMVA 3VUDA 3JS2A 4GYGA 2JEDA 2GNFA 5JFXA 4EH6A 2GNHA 3EN5A 3VBVA 3M11A 1R78A 3MH3A 3PY3A 2ACXA 2VWBA 4OTPA 4X0MA 5FGKA 3D14A 5HIEA 2XM9A 2FB8A 2PVRA 3Q6UA 2YM3A 1JVPP 3E7OA 2XKFA 4ITIA 3QKKA 3LE6A 5EDPA 1SMHA 3CKWA 3MVMA 3M1SA 3DAKA 5CENA 3DKGA 5CNNA 3TUCA 2VRXA 2W9FB 4Y72A 3FKNA 4L43A 2C5NA 2JITA 5AP1A 5AX3A 4HW7A 5DRDA 2JDVA 5EOLA 3MY5A 4IZ7A 1BUHA 2BFYA 5GNKA 3V8SA 3K3IA 3NW5A 1URWA 2QR7A 3ZOSA 3FMMA 4FL2A 1H28A 2R3PA 5AMNA 3LZBA 4A9TA 4BYIA 2A1AB 1IEPA 3R1NA 3LXLA 4WG4A 4E5AX 3TIZA 2WTCA 2XCKA 3Q6WA 4DA5A 3UIBA 1ND4A 2OFUA 5KZIA 5TE0A 2XVDA 5EYCA 1M14A 1BL7A 2C0TA 4JRNA 4WT6A 2OU7A 3F9NA 2JD5A 3AC2A 3SC1A 4CCBA 2Z7SA 5B7VA 3DBEA 3FHIA 4HYSA 3WBLA 4DT8A 4PP7A 5I9XA 4AA4A 4AOIA 3PSBA 2GS6A 4C59A 5IUHA 4E4MA 1WVWA 3AC1A 4FT0A 5D41A 2QO7A 4CEGA 4YZBA 4C3FA 3WF6A 1TQIA 4FV8A 2J90A 3QQJA 4LRJA 3R73A 3LMIA 2A27A 3SXRA 3L8XA 3SOAA 2PMNX 3QA8A 4K18A 4MK0A 3QHRA 4BJJA 4TY1A 3ZSGA 3TNWA 5KBRA 3PIZA 4ZOGA 1QPCA 4U42A 3PFYA 2XANA 4IJPA 1IRKA 2YLEA 3MDYA 1CMKE 5BMMA 4GT3A 5FXRA 3RPVA 5FP5A 5LMKC 5CF6A 4EEVA 4CFVA 3QTIA 4F78A 1H24A 3A99A 4FEVA 4ZZNA 4BZNA 2YZLA 5HNBA 3AC5A 4BTMA 4D2WA 5DE2A 1Y91A 2PL0A 3FAAA 4BCIA 2CDZA 4ZSEA 4EHVA 4CRSA 5FTGA 4CZYB 4O7ZA 1ZZ2A 3ORNA 3RTPA 3VUIA 1W0XC 3ULIA 4EJ7A 5HO8A 4O86A 2F9GA 3HA8A 4FI1A 3ZO4A 4ACHA 1SVGA 1CM8A 4ZY6A 3OUKA 3HRFA 2J51A 5DH3A 3ZZWA 2VN9A 3LFFA 2XCHA 3QX2A 2EXEA 1TQMA 4GKHA 4ANSA 4LUDA 4XRLA 2NO3A 4GK4A 5HE0A 1ZMUA 2R3HA 1ZYDA 5K9IA 1CKIA 4RIXB 4F64A 5C4LA 2J0IA 2XKCA 3Q9XA 2CCHA 3OW3A 3H0ZA 4JX3A 5J1VA 4ANQA 4GH2A 3ZFXA 3KY2A 3RI1A 1KE7A 2JDSA 4RGJA 3R7OA 2C4GA 4ZAUA 2EB2A 3FXWA 4BWPA 3DXNA 2XM8A 5H8GA 4ZJJA 3OT3A 3BLHA 1YXSA 2OI4X 3BGPA 2RG6A 4NH1A 5M08A 1M2PA 5HHWA 5CALA 5EI6A 2ZOQA 1W7HA 2WQEA 2X4FA 3HMMA 2JAMA 1LR4A 2XIRA 4CFUA 5CF5A 3KVXA 2ZM3A 3QQHA 1OIUA 1RQQA 4IX5A 4DFUA 2X8DA 4O0YA 4FG7A 3WZEA 4BI0A 3C51A 3PFQA 4TNDA 3DBQA 4I92A 5CYIA 3F2AA 4QQ5A 3ZLYA 2BZJA 2YFXA 3F5GA 3E8CA 1IA9A 3GOPA 2RSVA 1PMNA 4IVDA 4QP3A 1BLXA 3FI8A 1ZZLA 4BZDA 5DYJA 2EXCX 3GGFA 4XH6A 1AD5A 4CXAA 5LMKA 4YZ9A 3KMWA 3OBGA 5LMAA 4EQUA 4AS0A 1WBOA 3EMGA 5AA9A 4XBUA 5EI8A 2CNVA 3FLYA 4FGBA 3HRBA 3CJFA 4IWQA 2R3NA 1YHSA 3FI3A 4FTRA 4O2PA 2X0GA 3W33A 4BWKA 5M56A 4CFNA 2J50A 3FWQA 3COKA 4NIFB 1ZYCA 4O22A 4UBAA 4C4GA 5L8LA 1OM1A 4L45A 4S30A 4WOVA 1PXPA 1T45A 2QONA 2Y4PA 3KC3A 3MFSA 4IB0A 5LWNA 2HOGA 4O7YA 3PWDA 3C0HA 4XOZA 3QRTA 4DN5A 2BRHA 2J0MB 2VAGA 3O8TA 5M06A 4LFIA 1YI4A 4R6VA 4O4BB 5I5ZA 3UO4A 4Z55A 3UJGA 2PUNA 3R0TA 4EHGA 1G8KA 1JKSA 1QPDA 2WTKB 1CKJA 4PDOA 2OF2A 4X2NA 1W83A 1IAJA 5BV3A 1LEZA 4J98A 2VO0A 3AD5A 4G34A 4EH4A 4WRGA 3AT3A 4TRLA 4R3CA 2XNNA 4JQ8A 3ZM4A 5CVFA 2VTMA 5KNJA 3QTZA 4EWQA 4M14A 2OJFE 3GI3A 2F7ZE 1RDQE 4C3RA 3PA5A 3F6XA 1Q4LA 2UVYA 3EQRA 3F88A 2PYWA 4FSUA 5L4QA 5TF9A 1EH4A 2PMOX 3VN9A 3TZ8A 1Q5KA 2YACA 4OBPA 2GQGA 1YW2A 3ODZX 3UODA 4R3RA 4LOQA 3LQ3A 5CEPA 3I7CA 4XBRA 2QO9A 2FO0A 4IAFA 3ORIA 5AV3A 4QYFA 2OJIA 2WGJA 3CQWA 2XIYA 5EDRA 2ZDUA 1FGKA 1W2CA 3PG1A 4RIXA 3O8UA 3QUDA 4HVIA 3SRVB 2B7AA 4RMZA 2GFCA 1PKDA 1YKRA 1JKLA 3JYAA 4U41A 4JBOA 1ZLTA 4FR4A 5TT7A 1VEBA 2CCIA 5JFWA 3U54A 2CLXA 4LL0A 2ZVAA 4DGNA 3V8TA 3SDJA 5IA1A 4BF2A 3BWFA 3EKKA 3QWKA 4DFBA 1H1SA 2HELA 2IW6A 4FODA 3MPMA 3F3TA 2XEZA 3VBWA 4FTOA 5AR8A 3EQIA 4FVQA 5E8XA 3SW7A 3FY2A 4Y8DA 1U59A 4JIKA 4C34A 5IQIA 2PVMA 3IOKA 4MD8E 4J99A 3PP0A 3M42A 3IO7A 3QQGA 4NM3A 2GPHA 3UYSA 2BZHB 3R63A 4EOOA 3O71A 3TTJA 1JOWB 5TR6A 5GJFA 4UALA 3ORTA 2XAOA 4AE6A 3CIKA 4BDDA 1J1BA 4MNEB 1UA2A 1TKIA 3UZRA 4FKVA 2Y4IB 1OI9A 2F57A 3EFWA 3HUBA 3R22A 4JR3A 4MHAA 4PL3A 4PTCA 4GG5A 4RIWB 3P79A 4GU6A 4FKTA 4USFA 5AAFA 3UZTA 3UVQA 1URCA 5E91A 3KN6A 3DTWA 2VTPA 3N9XA 4HCVA 3TNPC 5CEKA 3AQVA 3TL8A 4XG9A 4D2PA 1YDRE 2XUUA 4FTTA 4Y95A 5E8SA 2Q83A 3JR1A 3ZU7A 5IQFA 2GNLA 3H9FA 3KULA 3ZMMA 4CFMA 2WMUA 4EUUA 4QMMA 4TWCA 1FINA 5FDPA 2IZTA 4ENXA 4DGOA 1O6YA 4E4XA 4FNZA 4E5BA 2XALA 4J96A 4C4FA 3FZ1A 2GTNA 2W1FA 5A54A 1PJKA 2OICA 4M7IA 2Y4IC 3MY1A 4U43A 5K0XA 3FPMA 4BDJA 5GZ8A 4IH8A 4MF1A 3R21A 4YC8A 4EK3A 2P33A 1IA8A 5A4EA 2XARA 2IZRA 5L2TA 4QNAA 3ZC6A 2EWAA 1H8FA 1REKA 3EFKA 4XCUA 1XMLA 1DI8A 1H1WA 3P9JA 3W1FA 4GW8A 3NWWA 2YIWA 4U5JA 3GCPA 4V0GA 3QTUA 5BYZA 4HYIA 4BDFA 1Q3DA 4RVMA 3VS4A 4QNYA 2IJMA 3C9WA 3L8SA 2YAKA 4O2ZA 4WBOA 4DDGA 5FEEA 3KB7A 3EL7A 3TZ9A 5FQDC 3W0MA 4LG4A 1O6KA 2FVDA 5KMNA 3PDTA 3BV3A 5EM8A 3KFAA 4DBNA 5I4NA 3EHAA 3WI6A 5AV2A 3DKCA 5EW8A 3U6IA 1K2PA 1Q24A 2IVTA 3G0FA 4UZDA 5GHVA 4EK8A 3UQCA 5IQEA 4ZS0A 1M17A 3CLYA 3QZGA 4H36A 3ENMA 3LFAA 4WD5A 2C69A 3TUBA 3R7EA 3A60A 3NLBA 1V0BA 3SRVA 5J9LA 2J5FA 1WMKA 3PUPA 1SNUA 4OTFA 3TNQB 5EM5A 3TMOA 3EFJA 3SD0A 5BUJA 2GNIA 4I1ZA 4O4DA 2WNTA 3NEWA 4YTHA 3PTGA 1PF8A 5HNIX 4TTHB 3ZO3A 3LCKA 5GJGA 4ZJVA 3AKKA 3H10A 4L6QA 4BN1A 4C4EA 5M09A 4DTKA 2VTNA 2YAAA 4ITJA 1HCKA 2GHGA 3ZCLA 4BB4A 3IW6A 5DA3A 3ZLSA 4DINA 4EYJA 3FQEA 2PUIA 3U9CA 2H6DA 3R30A 3KF4A 2WIHA 4E6QA 5HZNA 1O9UA 2XJ0A 5HIBA 3PLSA 4AA0A 4ZZOA 3BIZA 4TXCA 4PNIA 2OKRA 4E73A 3H9RA 3MV5A 3ELJA 1BI8A 4FKLA 1YI3A 1H0WA 2PMLX 3QCSA 4RX9A 3R8MA 3DXQA 4NL0A 4I24A 3GP0A 1XH8A 4IB1A 4L00A 4D1SA 4BYJA 4TT7A 3EN7A 2J9MA 4ASEA 3U6HA 3LJ2A 2C6EA 5A4QA 5ITAA 4I5CA 1G8JA 4KS7A 3NNUA 2FSOX 5HLPA 5JN2A 1GZNA 3Q4CA 4PMTA 1OL6A 1UNGA 5KMJA 4FEUA 2PZRA 5AWMA 5HIDA 4HNIA 3LCOA 3KRLA 3FMHA 4CLIA 2C1BA 3PJ8A 1MQ4A 3AG9A 3THBA 2XMYA 4U79A 2WMXA 4F7LA 5AADA 5BVNA 4BY9E 3FL5A 4JT3A 3HZTA 2VO6A 4MNFA 2C5YA 3KVWA 4U80A 3WYXA 1I09A 4Q9SA 3NCZA 2WOTA 4ZTSA 4CZUA 2BKZA 4CT1A 4FSNA 4I5PA 4TYIA 4IDTA 4E20A 4BDCA 5T3QA 3IW4A 2VTOA 5H9BA 3ID6C 4DG2E 4AXEA 4G31A 2GFSA 2QOQA 4NU1A 4UY9A 4QPMA 4L46A 3PPJA 3FXZA 3FYKX 3TM0A 2WU6A 2Z2WA 3FMDA 2O3PA 4OTWA 3HX4A 2UZTA 4WHZA 1DI9A 3PXRA 4IE9A 4IM3A 3R7IA 3SV0A 1JQHA 5AA8A 5C8MA 2OH4A 4CTBA 3QTRA 4IDVA 4BTFA 5HO7A 3BV2A 1XH6A 3CS9A 5IH6A 5BVFA 1XMMA 5DN3A 3SKCA 4CG8A 4MXCA 4D2VA 3GENA 4I22A 4O1OA 2XJ2A 5F4NA 1HCLA 5KMLA 1GIHA 4IB3A 3MI9A 5D10A 4C4IA 2Y9QA 3ZHPC 3CY2A 3OP5A 4L67A 4ACCA 4O7SA 3OWKA 4FKWA 3IW5A 4PUZA 4ACDA 5KMIA 5E8TA 3QRIA 4V04A 3DK7A 4X6QC 4R3PA 5CF8A 2RFDA 4MBLA 1MRUA 4IC8A 3HMPA 4FV1A 2C3IB 3KXHA 3WIKA 4FF8A 4ZLOA 5JQ8A 3BHVA 3BZ3A 3DLZA 5L3AA 1J7UA 4KUJA 4OTHA 2I0VA 4RWLA 5HGIA 4CMTA 4QP6A 2QURA 3EN9A 1G3NA 2B9FA 3R04A 4NZWB 4AOJA 3FZPA 3NCGA 3CQEA 5HEZA 4ANOA 2B9HA 1OVEA 1JKKA 3UO5A 2GDOA 2XIZA 2Y8OA 3PJ2A 4YGAA 4BGQA 4F70A 4B8MA 4BI1A 5C26A 5CAVA 5HTIA 1CSNA 4IMYA 1OZ1A 3GEQA 2HXLA 5AP3A 2BDJA 4ZSGA 3MPTA 5BVWA 3VBYA 5M53A 1OL5A 3FYJX 2WFYA 4JBVA 4BI2A 3WZKA 2BDWA 4CD0A 4O7RA 5ACKA 4EOSA 1SYKA 2PE0A 3MA6A 5D1JA 5ANIA 5G6VA 4WBBB 4LYNA 4YJQA 2VUWA 4AXAA 1FMKA 2WQNA 3DY7A 2IVSA 2P55A 4PL5A 2BIKB 5CEQA 4GRBA 5IG1A 5IH4A 3ETAA 3VJNA 1JLUE 3GQLA 4V01A 3QAME 5L6WL 3DXPA 2WO6A 1PHKA 3Q5IA 4I0SA 2WMQA 4PMMA 3LW0A 4ENYA 4XLIA 3LIJA 2G15A 4AXFA 3R7VA 4MX9A 5DWRA 4A9SA 2W4JA 5DT3A 1Q3WA 3FDNA 4QMVA 4AG8A 4EYMA 3B8QA 4AE9A 4M15A 4X21A 3ORZA 1OGYA 3TN8A 4HOKA 3NUYA 1OECA 3HP5A 2ZB1A 3N51A 1OIQA 1UU3A 2VTJA 3II5A 3IDPA 3ALNA 3Q9WA 2VZ6A 4FVRA 2WHBA 4L7FA 5CQUA 5HLNA 4EK5A 5FD2A 2Q0NA 3E93A 1J7LA 3PLAE 4FIFA 3AGMA 5KX8A 5CU2A 5BVEA 4ALUA 5D12A 3RWQA 2R5TA 5L8JA 3I1AA 2F2CB 5KZ0A 3ANRA 3WE8A 4YO6A 5DVRA 3ZEPA 5AP6A 3MA3A 3VNTA 3FMEA 4MQ1A 4PPAA 1U46A 1PYEA 4DDIA 5DR9A 5ETCA 3Q53A 4AQCA 1LUFA 1PXJA 5AEPA 1TQPA 5J87A 3WOWA 4F63A 3ZBXA 3R9NA 2AEGA 4UYNA 2GQSA 4UEUA 2KTYA 5M4UA 4G3CA 4DF3A 5IMEA 5D11A 5A14A 3EJ1A 3R7YA 4FSQA 3CD8A 4YLKA 4GS6A 1WVXA 4X6RA 5I9VA 4ZSAA 2UW7A 3O7LB 3BWJA 1GAGA 2OF4A 3W10A 2EXMA 2XAMA 1H25A 5L2QA 3O23A 2YCFA 2DS1A 4TYHB 5KMMA 3DAJA 1ZOGA 2ZV9A 1CDKA 3O7LD 4FTAA 1M2QA 3UOHA 5I3RA 3GBZA 2RL5A 3R00A 1UWJA 3QKLA 1QL6A 2X1NA 3P86A 2Y0AA 2ZMDA 3PSCA 5HX8A 5K5NA 1KE9A 4FKOA 4QP2A 5GIPE 3UVRA 4BCOA 4FV2A 5DOSA 3LXKA 3OT8A 5IZFA 4ZMEA 1M7QA 4G1WA 3R2BA 5CI6A 3H9OA 2AC5A 2J0JA 3N4TA 2HZ4A 4EZ5A 4AW1A 5KMOA 1YWNA 3W55A 3PWYA 4IAKA 3OD6X 4CQGA 2UZWE 4R1VA 3QRKA 4QMXA 5M4CA 2CHLA 2XK8A 3PXQA 5L2WA 3D7ZA 2AQXA 3BHHA 5HG8A 3V5QA 3UIUA 3ZDUA 1UKIA 2UUEA 2C6DA 3QGYA 4HCUA 3GVUA 4RZVA 2WTIA 3DDQA 5HCYA 3FUPA 4YJUA 2JDTA 1Y8YA 2H96A 3RNIA 2OGVA 3LFDA 5CSPA 4BL1A 5JH6A 4FA2A 4I6LA 3C4WA 4Z9LA 2ZAZA 2Z02A 5CF4A 4FTKA 2YWVA 3GXLA 4JNWA 4Z3VA 3AC3A 3FC2A 3MW1A 3U6JA 2QOFA 3EL8A 5AP0A 2QKRA 4CKIA 3G0EA 4KS8A 4Y46A 3S1HA 3I5NA 4GK3A 2ITTA 2XRUA 4AF3A 4F65A 5HI2A 3VC4A 4C37A 3LCDA 5HVYA 2QU5A 4BJJB 4EOPA 2IZSA 2OJGA 3FJQE 3MVJA 4K2RA 4Z16A 2O64A 4DHJA 4O84A 4ZIMA