1Y6KR

Crystal structure of human il-10 complexed with the soluble il-10r1 chain
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
205
structure length
205
Chain Sequence
GTELPSPPSVWFEAEFFHHILHWTPIPQQSESTCYEVALLRYGIESWNSISQCSQTLSYDLTAVTLDLYHSNGYRARVRAVDGSRHSQWTVTNTRFSVDEVTLTVGSVNLEIHNGFILGKIQLPRPKMAPAQDTYESIFSHFREYEIAIRKVPGQFTFTHKKVKHEQFSLLTSGEVGEFCVQVKPSVASRSNKGMWSKEECISLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Same structure, different function crystal structure of the Epstein-Barr virus IL-10 bound to the soluble IL-10R1 chain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Interleukin-10
total genus 37
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2004-12-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1y6kR02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1y6kR01
2V2TB 3WKNA 2FO1A 2R39A 4XX1G 3O9WB 4GBXD 2MKWA 3QB7C 5IGXL 4JRXB 3SO3B 4ZOAA 2EH8L 4PGDA 1BIHA 1ZMYA 2XKNA 1F3DJ 1UM5L 5I1IH 3PL6D 4D0DA 4DJMA 4R9HA 3BGMA 3NMEA 4YJZL 3BO8A 4MB4A 1IGCL 3MRLB 4ZOBA 3VXPA 4N1HB 1MCCA 3A67H 5C0BB 4W6YB 1LWRA 2FYYA 3SPVB 2NZIA 4XP1L 1N0XL 4GRMA 3REVB 4UNVA 3D2UD 3CLFH 1AD9A 5AAWA 1JGUH 1LP9F 2NY0C 3MXWL 4Y4HD 1VADB 4NUGH 5E2WL 2ITCB 2GSGA 3GMNB 3EFDH 1R3HB 4RCAA 4CMMB 2WBKA 4RQQB 2A9NH 2COQA 3QNXB 5D6CB 2WAHA 3VXOA 4ELME 4IHOB 4NC2B 1YEFH 1A0QH 4XPTH 1ZVSB 3UPRA 3QHTC 1H5BB 4BZ2L 1KCSL 3GO1L 4RX4A 2BSSA 4MQXD 1YNKH 3VGDA 1CLOH 1DQJB 3HE7B 4YGAB 1CFNA 3SDDB 4CJ0A 5I8OL 4QRRD 2C7UB 4YH6A 4OI9A 5GSVA 4QRRE 4GBXA 3TVMB 5TDOA 3DO7A 5DHVA 4B53A 4KJQC 3DGGA 1T3FB 2CXKA 4I9WD 4KK9C 1P1ZA 4L4VB 2D4DA 5FDWA 8FABB 3FO9B 3HRPA 5ETUA 1IKFL 5LAXA 1G0XA 2V7HB 4PGBA 4HT1L 4DCQB 2V5TA 1YPZE 5C0EA 3GIZL 3MRQB 1ZT7B 4POUB 1VFUA 1KLFA 1MHPL 4ODXB 5D2LE 3B9AA 5E8OA 4Z78A 3HI5H 4LEOB 1X4ZA 2ICWA 1FFQA 4GSDH 3OR7B 4JRXE 5KZCB 3S34H 1FFOB 1RURL 4TNWF 1ZHKA 3M07A 1EMTL 4PJBA 1E28B 2XZAH 3I75B 5D5MA 5IHZA 1F4YH 1BVKB 1VDGA 3HMXL 1CLYL 1I7TB 5AYQA 5H8DA 5HVFB 1C16A 4G9FA 5CWSB 4WEMB 3QCTL 3MRQA 2IF7A 4KTYA 4IRSB 4JCMA 4QT5A 4JFPB 4OCSH 1YN7B 3H7BB 3I2CH 4KRNA 3BIKA 2C5DC 3KPRE 3N1FC 2IFFL 5ETUB 5DJ8B 4HDIB 5L7XL 5FECB 3CIQA 2N7BA 1ES0B 4KQ4L 5FGSA 3L5XL 5KG9B 3C5SB 2X7LB 4P3CL 2Z8SA 5I19H 3EO1A 5IW1B 2I24N 1Z3GL 1N6UA 4JFDE 2YD5A 1AGEB 2I26N 3CFKB 2AXFA 5CZVH 4LVHC 4JY4B 1G7JB 5E1AB 3RPIA 4PJFF 2JJTC 1BZQK 4PG2C 1TENA 4O2EA 3R06B 2IANA 4NWUH 4OLYH 5D93C 2X70A 1ED3A 4Y19E 3ILQC 4F37K 2CRIA 1UKQA 5ADPH 3CU7A 4MD5B 2FO4B 1S7QB 1J12A 1RUKH 3K8LA 2OTUB 2NY6B 2OM5A 4U1LB 3L3JB 3VFUB 1MWAB 4M43L 4LF3B 3QAZC 4EDWL 3QIBA 1HHHA 2DBLL 3RTQB 2IGFH 1WBXB 2VQTA 3RNQB 3T4AB 3KLHC 1V7NL 1YNKL 4PB9H 4QHLA 2X44D 5B8CA 2BY0A 3HUJF 1KJ2L 3MC0A 1T83C 2AERT 3PWVB 2IG2H 3RBGA 2F5AL 3EYOA 5IT2H 4HMCA 2FLBT 1UVQB 2H1PL 4HZLA 2A2QT 4AENB 3LKSA 4ODVL 1CFSA 4AIZB 4ETQB 1MCKA 2P45B 3MLSL 2A9NL 1VFBB 3ZKSD 2AABL 4MQXC 1U93B 2DQTL 1AHWA 4PRNA 1CFVL 4PRHE 1J1OH 4EI6A 1MLBA 1IVLA 5SWZB 1UFUA 1H3UA 1A4KA 3QNXA 3OKEA 3KLAA 1EV2E 4NSKA 4ZAKA 3TEUA 1XF4A 4I48A 3ARVA 4EIZC 3KDMA 1FZOA 4RAUB 5EO0A 5TE4H 4FFYL 3BQUC 1HKLL 1ZT1A 3CFCH 3IJHA 5GGQL 3VMOA 4UOJA 3MNZA 1KC5H 1UM6L 4M6ML 4I3SH 5D7SH 4PBWD 1KCUL 5T1KB 3VD5A 4M9PA 3S5LA 2V6HA 3T04D 5FUCC 3AXLB 2RQ8A 1RK0B 2VLJB 1X9QA 2VLMD 5F7DA 3O0RH 3MRIB 1XZ0B 4M5YH 2F19L 2P24B 3RGVC 1KCLA 3DGCR 3LRGA 2FWOB 1JGLL 1U8HB 4M7LL 5I8EB 3HNVH 2VDNL 1QKZH 2OZ4H 3WN5C 3LS4L 4MA8L 1ORSA 1QOKA 2QL1A 1CD8A 4LGRB 3I50L 3RL1B 5JR1H 1UJTA 3DGGB 3JV5A 3BH8A 1UEMA 2AK1H 3EZJB 3ARDA 4UT6L 1FV1B 4X7DC 2BNRE 4GBXB 3BOVA 5T5FH 2DMKA 4P9HC 1P5UA 3QUKA 5GRVK 1ODAA 1YQVH 1PJ9A 3B9VA 5HD8D 1UENA 2DQUL 2AEQH 3OPZL 4OQTL 2GW5A 2ITDB 3TO4C 1A7BA 4WFGE 3KDMB 2CK0L 1TQCB 4FQ1L 1OPGL 1C7SA 3A6CH 3LN9A 3QWRA 1X5KA 5SX5K 4C4KT 4KK5C 1ZHLA 1F02I 4XMPL 1N5AA 4OZFH 1TTFA 1DBJH 1DJSA 3PHQA 4NBYB 4FQLH 4LLAA 3VJ6A 1PYWB 3VRIB 1GPOH 2HFEA 1V5JA 4XCYB 4PJGA 3L6FB 4FQPA 4MLSA 1WAAF 5T1DL 4LLWB 1OARL 1G6RA 2IJ0C 3GMQA 2ESVE 1K4DA 1PVHA 4GKSA 3MRNA 3DURB 4Z7UE 2ADIA 2PTTB 4QXUL 1BAFL 3IB4A 5HJ3A 4ELMB 5C0BA 5DJ0B 5J57B 3ZE1E 3VFGL 1WCBB 4PP2B 1JGVH 4YK4B 3RZCA 1L6ZA 4KRMB 2AV7B 4ODVH 2R23B 3HE7D 1NDMB 1KJMB 4NKOA 2DQDL 1NBVH 1AI1L 4N0YL 5T33H 2WBJC 4XXDA 5BV7L 1JRHI 4Q9BA 1A1NB 5D9SB 5JXEA 4LCWB 3HLAB 4YXLH 5E2VL 1A3QA 4R26L 3MLTB 2NPLX 1KJVA 1KT2B 4LFHG 3HA0A 1TQBB 4C83B 3UMTA 2B1HL 2Q20A 3CFJB 1PYWA 2C4XA 5I1JL 2VE6A 1MRDL 1MCIA 1I1AC 3MRCA 4TSBL 3SGJC 1R3JA 3DVGB 4YHMH 4J3TA 2R23A 1E27B 3T0EB 1I9EA 1EGJH 2AGJH 3GBLA 5T3XE 4LVEA 3PL6A 4O58H 4P2RE 7FABH 5IOPB 1GC1L 3JTSA 4WTZG 1ZT1B 1A1MB 2UZYB 1NLDH 4NQDA 1GAFH 2IBBA 3X12B 2I60L 4GOSA 3KYKH 2A74B 4RAVB 3VCLA 1FORH 3NH7H 4OZHF 5F7EL 4P2QA 4LCCB 3QFJB 1H15B 4ZUVA 5EDXA 4HGMA 3GMOB 3H9SE 4PJDF 3PDOA 3TBSA 2PYFB 2HH0H 2NY4C 5IK3B 4XNXH 5I0DA 1BBDL 4FG6D 3JWDH 2DLTA 3O2WH 4IDJH 2K1MA 3QUYC 4G8GA 2YXMA 2HP4A 2D03L 1CQYA 3ZDXF 2BY1A 4MAYC 3MV8E 5ISZE 4JPVL 4KK6D 4U1JB 3KPRB 1A7OL 5D1QA 4F57H 3X14A 1WFTA 3DO3A 4G5ZL 2XFXA 4OCMC 4E41A 1L9MA 2H26B 4EI5A 1RHFA 1IEAB 1NCDL 3GHEL 5FA4A 2BNQB 1CFTB 3V79C 2IALB 5IG7A 4NO0B 2EEAA 4JFDB 1T20B 4Z7VE 4YX2L 4F7CB 4FHBD 1GZPA 1MCPL 4LHUB 1NGYA 3GIZH 2H3NA 12E8H 4NCDA 4NRYA 3L5WA 3HI1B 5GPRA 1I1AB 3CVIL 1J0IA 4NQDD 2NY4B 5IFHH 1JMZA 2XG4A 3ZT7A 3BE1L 3CCHA 5F88B 1N6VA 5D7LB 2MCPH 2ZUQC 4GAJH 1ND0B 2MSPA 1EA9C 3KLDA 4TPRH 2J6EA 1EZVX 4K9EC 5ENWB 5C0NC 3FMGL 1BQUA 2CR6A 3QIUA 3C08L 1UXWA 1SJXA 5C0CB 1W8OA 3GBNL 1NEZB 2EKSA 1T5WB 1TDQA 5ANME 3VWJB 3S35L 4BZ2H 1FSKB 4Q2ZA 3QUZB 5EIQA 1INDH 1M4KA 3HMWL 4EDXA 2RIKA 1R3IL 5B3JE 3K3QA 5FYLE 3VFTA 2Z91A 1I1YB 1LEIB 4UNUA 1DLFH 2FIKA 4KI5D 4NO0A 3UTSE 3QHZH 2EZ0D 1K8DB 1EHNA 1Q0XL 4NFDA 2VDOH 1MJ7H 1WAAA 1ZHKB 5J6GA 5HPMB 2PTVA 1GGBL 3QJHB 3UYPA 3HMXA 4J4PD 3JSSA 3W11C 1MQKH 1O0VA 2BK8A 5DI8A 3ULUH 4XMPH 4U6YB 5DK2A 3C6LB 2HLAB 4Q74A 4XH2B 5EOTA 3RNKB 1YY8B 5L2KA 3SKMA 4R7DA 4U7KA 4ONHA 4PY7A 2IH3B 4OAWA 5E4EB 1T7WA 2YRPA 3WKMH 4M8QA 1VEPA 4LSRL 3OKLA 4R2GD 5DZLA 1C8PA 4MJIE 3ARUA 1L0QA 4CMHB 1WV7T 4NN6C 4RGMB 4P2QB 2ZOLA 5D72H 1PLGL 3LSOB 1OWWA 3T1FB 5C2BL 5HHVH 1CGWA 5C3LD 3MLVH 4XHJC 2Q8BL 4U1MA 4UU9A 5F7EH 2HVKB 3ARGD 3DRTA 1FORL 2NTSP 1MWAL 5J6GB 4K3EH 5DWUH 2I60H 5T3XH 1LP9E 1GAFL 2XNAB 3O8XD 3BGAA 4KXZH 4EZMA 1MIMH 4F15B 5C6PB 5JXED 3MGTB 5DD6B 2XRAL 1K5NB 5GHWH 1YUHB 1TQCC 2V5YA 4PG2A 4JB9L 4XBEL 3QDAA 1BPVA 2RFXA 2BNUB 1HHGB 1UJ3C 4H8WC 4M5YL 2M8XA 4ZQKA 3NIGF 2JB6A 4OIIH 5TDPB 3MOBH 3QDGE 3RVUD 1TIUA 4IJ3B 4WRLA 3SDAC 2FHFA 3NIFE 2J88H 1JPSL 4GRLB 4QCIB 3WKML 3CFEA 4YPJA 3DX9B 2CRMA 3X11A 2GSGB 1YY8A 1QRNB 2XICA 4F3FA 5KANG 4LSVL 5IQ9B 2GI7A 2X9WA 4Y2DB 3C6LA 4QRPE 1JZ7A 1QSFB 4OJFH 4S1RH 5FK9A 3AS1A 2VIRA 1M7DA 5E2UH 2VLRA 3G6JA 3ALXA 3ORJA 1EO8H 4OZIE 1HYSC 2H32A 1QLEL 3PGCB 1DQJA 3QHZL 3K8KA 4QHMB 5T1LA 3TH3T 4CVZA 2AABH 3C60A 3DURA 1FAIL 1VACB 3VFWA 1FH5H 1U8OB 1CL7I 2AJUL 4X8XA 5B4MC 1RD6A 3OL2A 3GNMH 3KPNA 4NM8H 3QP3A 1RV6X 1N64L 2BC4B 4Y4FD 2F5AH 1Q38A 1HIMH 3U0PA 4WTZA 4BELD 3LAFA 5F70A 1RZKH 1P4LA 3NCFB 4H8WH 2CRYA 4UB0L 1Q9LB 3GI8H 3S9DB 3C08H 3TO4B 4U7MA 4J23A 5KN5B 1DQTA 4OJFL 4WV1A 4O51A 4PJXB 4O9HL 1S7WB 1KBGL 4JY6A 1KN4L 1WWCA 4CADB 2QR0B 4LKCA 1IT9H 1J0ZA 1FLTX 3RY6A 2YBRA 1JPSH 2I9TA 1NCCH 3BT2H 2CJUH 3BKJH 1JHLL 1R5WB 5L2JB 1S7UB 5HYJD 4WO4B 4YHOH 1PY9A 4W4NA 4KKLC 5K93A 3ZDYE 2JJSA 1EUTA 4JPIA 3VFPA 2ATKA 1J8HB 2GT9B 4E5XA 4V2CB 1G7PA 3FFDA 4YZFF 5GHWL 2A74A 5LWYH 3MUY1 2EH7L 4MXVF 3QI9C 2YKLH 3KPTA 5C0RH 3SE8L 2D7TH 5C3TA 5EFIB 2Q8BH 3MRLA 4MNGA 1YMME 1AQKL 3Q48A 3TVMD 5HXMA 3T0EA 1PBYA 1I8IB 4XTRD 2B7DT 3ALWA 2J3SA 5F9OH 1T0MB 1S9XB 3M1BA 1WQVT 3MNWA 1JHKL 2Q6WA 4MXQD 1YMHA 1G9ML 3QDMD 4JQVC 4LSRH 4HUXB 1AC0A 3VXUA 5D7SL 3BP7B 3VXRE 4HFUL 3MBEB 5ID1B 5I16A 5HY9A 3KR3L 4M1CC 4RFEA 1FPTH 3QXDB 2P8MA 4XC3H 4NO0D 2ARJA 5DZOA 5I1CL 4X9IA 2JCCA 3U4EA 1RURH 3V0AC 5DJDA 3MRGA 2FJFA 2ATPB 5IJKC 3P4OB 2YN3A 4LLQA 5CEYB 1MNUL 1QFWM 2KZ1B 3D39B 4W70A 2BVOA 1G84A 3D25A 2ICES 5J7CC 1K85A 2VDOL 2Z31B 1Q0XH 1C1EL 1UCBH 2Y36H 5I74B 2VN4A 4K9EH 4JM2D 2LV4A 5EBLB 2W92A 5D7LD 5ALBL 1IKNC 5H94B 1FNAA 1A3RL 1S9KC 3FFDB 2E6JA 3QWOB 4CVXA 4PJ9B 2A73A 1F3DH 3SCMD 4ZUUB 3SE3C 3MV8A 1S8DB 1SEQH 2UZIL 1A22B 3MOQA 4LOUC 4OFIA 1CXFA 4YFLI 4TNVF 1EEQA 4LRNL 3GBNH 1N3NB 3J7HA 4U1NB 2AK4E 5TE6H 5DHXB 3IKCA 1A14L 1XF3B 1E6OH 1I8LA 2AK4D 2R0KH 5A16B 2Z9TA 4UIMB 4FQXD 1AGBA 5IOPA 1JZ3A 1SY6H 4XXDB 3OJVC 4UQ2B 3WMSA 3KLSA 3ZDZF 4LHUD 4OB5L 4KI5E 2K9UA 3OXSB 3WBDA 4FQHB 4Z77B 3QNZB 1HOCA 1A0QL 1E27A 1A7PL 1NMAL 4WHYH 5DRNA 4NRXA 4NWUL 1Z6JT 5C92A 1M7DB 4GG6B 2A6IB 3BN9C 5DO2D 2A9MH 4EN3D 3UZEA 2R1YA 4WDIA 1HQRA 1N8ZA 3WEXB 3HHRB 4HZAA 1CGSL 1KOAA 4OF0A 3MXWH 4PJFA 5FM5M 2BVEA 2DWDB 3QCUL 1K4CB 3P0YH 2G5BB 5D7IA 3C5ZB 3M8OL 4QOKE 5C0JB 1UQSB 1M6OA 4D94A 1XIWD 5AAMA 5B22A 4UOW0 4FTVD 2VZVA 1NCDH 3ZDYF 1XGTA 1IGCH 3W0WE 3B2VH 5E1AA 1RIVL 4NN6B 2VLRD 5BRZE 4KY1H 3C2AL 4R2GB 3LQZA 1TTUA 1WICA 4JPVH 5E9DA 4RRPG 3QUZD 4PJFE 3MFFA 3PNWB 3BGFB 2CK0H 3S5LG 3RGVD 4MJIB 3ABZA 4Q58C 3U46A 2Y07L 3GMPA 1F4YL 5FAAA 3SDCC 5DMGD 4Y7MA 2XN9A 2I07B 1IAKB 4P2QE 5CINL 1JYNA 4F7TB 5F9OL 3O3AA 1WTLA 3S4SB 3VDBA 3OJDB 2JIXB 1UXSB 3S34L 3PG2A 4GSDL 3GSVA 2ATKB 3WFCL 4JKMA 5K9KB 3QFJA 4G6KH 4CGTA 4LAQL 5HTSA 3HC3H 5JQHC 2ADJB 3GJFA 2AXJA 4KTDH 3G5XB 3FZUC 1BD2B 3SO3C 2XZCH 5CIPA 1HWHB 2W65B 4QRTA 3O9WC 1B88A 3EDDA 4DQOL 3KPMA 4LU5H 1BQLH 1CT8B 2OXHA 5LQBL 3KYMA 2R69H 3BPLC 4K07A 1A6PA 3O0RL 4MJ6B 2I27N 3UTQB 4F33A 5TDOB 1V8HA 1VGEH 1KYOJ 2D7PA 2EDRA 5A43C 4UU9B 5E6IC 4KI1A 3V0WL 5TF0A 3NABH 3QI9A 4UT7H 5CFHA 1RUAH 3OR6B 2CO6B 1HYRC 3WNLA 4JO3H 2AJ3B 3IJHB 3D18B 4S2SB 5I8OH 3MXVH 4PJHE 4WWKC 2YN5A 2IAND 1LEIA 4BZ1H 1P84K 2B39A 5TE7L 3GI8L 4HC1L 2ZP0T 3O2DA 4O5LL 3BIBX 4R2GC 3GJFK 1ZWIB 1XEDA 4F9LA 4I0CC 5GZOC 2AJZB 1OGAE 5DHYB 4CNIB 1B9ZA 3DTXA 4XPTL 4LASL 1WK0A 5IM7B 3OWEA 3FAXA 1R3LB 3RUGA 3SEPA 4CN4A 3F12A 3I02B 2AJUH 2HVJA 1JGVL 1J7VR 5M95B 3QIUB 3FL7A 4QTIL 2ESVA 2AK4A 5T1KA 2RB8A 2BVUA 3EFDL 4JLRA 1DTUA 3HNTH 3EYQD 4GRLD 4PJGE 4M7JL 3FAWA 5FB8B 3TH4T 8CGTA 3BW9B 4F7EB 1OARH 4WJ5B 1N3NA 1KJ2H 4C59B 4AH2B 3HC0A 4OFVA 4EUPB 5DK3A 4ZS7L 2L7UA 2ZUWA 4JRYD 3ZYOA 3FO1A 4LF3A 1YEIL 1EPFA 4KUCF 3QJFB 1YEKH 2YPLA 3LEYL 4J12A 1FL6A 3DVNA 1JYXA 2HTKC 2BNRB 5I76A 2ITDA 5EBLA 1WC7A 1F4AA 2QR0A 5JNYB 2AS5M 1X5LA 4FMFA 2GCYB 1UVQA 1G9NC 3NCBB 1N2RB 2F53E 2AEWA 3C6LC 4XPAH 2DLEA 5C9KA 1UWEH 1U91B 4WU5A 4IOFD 4XBEH 3QQ4B 1D7FA 2VZ1A 3L5WB 5JR1L 2R8SH 1EJOL 2Y23A 4YE4H 1I1AA 3O4OC 1AXSB 4KQ4H 1E4WL 5H37G 1BQSA 1HHKA 1U8JA 3JTTB 4NQCD 1BREA 3BKCL 4LSTH 1A6WL 1MWAA 1K9TA 5C2BH 4P5KA 2CDEB 4I0PA 1Z9LA 2EYSA 1CBVL 3IDMB 1T20A 3HPLA 4YBLC 3EKCA 4HKZA 1KSRA 1I85C 1Q0YH 3GGWB 5GGRA 5J89A 5LKNA 3GSVB 1XF5B 4XVUD 1NGQH 4WW2A 5EZLB 2VYRE 1ZEAL 5D7IF 3SY0B 1YPZF 2LU7A 2CRZA 3G04A 3MNVA 4G43B 1GC1C 4Y19A 4KAQH 1ZA6B 5EIIA 4ERSL 1I1RA 1HKFA 3ARED 1V3LA 3QWQB 3VMNA 5C09E 4NCC2 3V6ZB 4MNHB 1J8HD 4LVOC 1RIVH 3U46B 2OR8A 2Q3ZA 1MCDA 2NY7H 3IVKB 3ARBD 3JZ7A 5FF6A 3L7FA 3L3OB 1KB9J 1ZLVK 3KLAB 2GEEA 3X11B 1JNNL 1JZ2A 3RX8A 3UBXB 1HNFA 3STLA 2VE6B 3P4MB 2XY1A 3QO1A 1IBGL 3P0YL 4O4YH 2CDGB 4OKVB 2Q7NA 3MTRA 3MQIA 4HIHA 1DLFL 4HT1H 1J8KA 4X9HA 5LGKA 3L5HA 2NY5L 2NY1C 1SVCP 2WUCH 3S4SA 1U92B 3HE7C 1HCFX 2XN9B 5IT2L 3ME0A 4U7SA 1DL7L 4R0LC 2EDFA 3U82B 2ZCLH 4IMLB 3TO4A 3QIBD 4HG4K 5F89B 3TYFB 2R0KL 3ELAT 3PE9A 2VB5A 1MCWM 1R0AH 3VI3E 5IROA 4J8RB 2J6EH 1OQOA 4KGJA 4EDWH 2EICA 5E4EC 1DCLA 5GQBA 3U7YL 4HUWA 2PO6C 1LILA 5D1XA 3OJMB 5HPOA 4PJIE 3F8UB 4GFTB 1K4DB 4GKSB 3BE1H 1FL5B 4NKMB 1FO0B 2ARJQ 3VXQB 1MAMH 4ZYKB 5T1MB 4U6YA 5DK2B 3W9EB 5D1QC 3CH1A 1X5GA 1MI5A 4XPBL 3O11A 4PJ9D 1BJ8A 4U0QB 4XP6H 5FA4B 4JPKH 4JM2C 5FYKE 1ZHLB 4E41B 2X4UB 3WSQH 5IEHA 1JGUL 1FYTA 1Z3GH 5DD0L 4JR9L 5EUOA 2BHUA 4KMQA 1EAPA 2FD6H 3IF1A 2CUMA 1NSNL 4XNQA 1FLRL 1UZ6E 1ZHNB 4LPUA 1KEGL 4KPHH 4Q6IC 3RGVB 3MRRB 3I2CL 5IB4B 1T80A 4FQXB 1X5IA 5TPWH 4HHAB 5DRXB 4QRQB 2ENSA 5D1QD 4HIIB 1NC2B 4FFZH 5ICYA 1FPTL 1TJIH 1U3HB 3KR3H 5GZND 4PJCF 1NGXB 1U8QB 5IHZB 2PKDA 4H88H 1GH7A 2GSIA 3MV7B 2H8PA 3SDYH 4K7FB 4KV5F 4PJEA 3KJ4C 5HDBF 1QNZH 4X6CF 2VUOA 4LP5A 1T1YB 3MRHA 1NAKL 2ZCHH 3BKYL 4HLZG 4M4PA 5BMFL 4NHUB 5BO1L 1JYVA 4JANB 1JGEA 4P46B 3RWIB 5CGMA 4LSSH 1I8IA 4TRPL 5C7XL 3DSFH 3BEWA 2CUIA 4PGEB 1TJGL 4KTEL 4D9QE 1MRCH 2IQ9H 2ORBH 3QNYA 1JGDA 4EQ2A 4C83A 1PY4A 1YC7A 4Z7NE 4XCNB 3TA3B 1HILA 5ACZB 5L8JB 3SE9L 3P4LA 3QXDA 5E6ID 2F53A 5EB9A 4Z7QE 3L5IA 3IYLW 4X7TB 4Z7NF 2X9YA 1KIQA 5E6ZA 3CC5A 3MRIA 1YY9D 5KTEL 5C0AB 1OAQH 1TCRA 3CJJA 3ARGB 1FFRA 4GRWF 1EUUA 5JW4M 1ZSDB 1CLOL 5I30H 4WHTB 3TJEL 2YEZA 4LLMA 1CDUA 4V1DD 2FRGP 2PCPB 4JHWH 1X5AA 4UNTA 4L3CB 3QCVH 3QUXA 4MSWB 4PV9A 4UTBH 5C0BD 4IS6A 1LQSR 4UBDC 3KJ6H 3IRPX 3FT2A 1YYLH 1B4JH 2F5BL 1X4XA 1HSAA 1ZTXL 1TLKA 5JXEC 2VXSH 1GGUA 1LHZA 1QRND 3HTLX 4XCYA 2WBJA 2ZUQB 5IFAH 3PHQB 3BW9A 3GB7B 5BS0B 3LN4B 5EU6D 1KG0A 2UVEA 5FB8A 4DN3H 4W81A 4NN5B 4QGTA 5HI3D 4HZLB 1FL3A 4B41A 2HJKB 3WUWG 1PKQE 4APQC 3DROA 3D39E 4EXPX 2J5LB 3C5ZC 5F1IB 4LNRB 4PJGF 4IOIA 1OD7A 4JO4L 4PLKC 4PLKD 5CJ5A 1FGNL 2DAVA 1A9BA 2V7NB 3CUPA 3VI3F 1OF2A 1KIQB 4ORZC 1CFQA 2P5WD 4Y8AA 4XBGB 1X6NA 3K4ZA 1XGRA 5I1LA 1IQWL 1BEYL 1KIUA 2SEBA 4WY7H 1PG7W 4JJ5A 4Y4FB 2EIZB 3MRFA 3O4LD 4TVPD 5L0QC 1QO3A 4M4RA 3C60B 1IC7H 4ZFGL 1IC5L 3U1SH 5MERB 3TO4D 3RPIB 5FYKH 4OI7A 2CLZB 4YDKH 2F74A 1MWAH 1QSEB 3ZDXE 5D8JH 1QKZL 5I1KH 3VA6A 2X7LA 2PO6B 5KVDL 3TF7C 4GW1A 3NAAH 3X13B 2ICEA 2ZSVB 1AGEA 2K7PA 4XP4L 5DQDL 5F3HB 4OZIB 2ZCKL 1W0VB 4X4YB 4ZPVB 1R5IB 5JIHA 1AKJD 3OMZA 4WI2A 5F1SA 4D3CL 2O5XL 5F9JB 4NYLA 1TVBB 1FNSH 4WO4D 1KCRH 2AXGB 3S4SG 4HDIA 5E8DL 4YXHH 3C6SB 2XG5A 4LRIC 4NQDE 4XP5H 1H3GA 4PV8A 3AREA 2RHEA 3KYAA 5C0BE 1LDSA 3ARBB 4WGVB 1D3CA 1C16B 1KC5L 3FQRB 4HH9B 3IXAA 3PIQA 1TITA 1NLBL 1INQB 3S88H 3VWKD 5GISH 1DANU 1S7XB 3G5ZA 5DJXA 4XMKH 4N8CL 3GSRB 5BRZA 2QHRH 2WZPD 4JVWA 4G6JL 1OOAA 2XNAA 4LPYA 5DHVB 4MS8C 2EIEA 3GSOB 4M8VA 2UYLA 5GSVB 3EYOB 2NZ9C 2DTSA 3D85B 4I4WB 5DURD 4CDGC 2FB4L 2VH5L 3IDIB 3MLSH 5MERA 3ZKXB 4E42B 4FABL 3HG1A 3MV9A 4HSQA 4F8TA 4OD3L 4F37F 3B9KD 1INDL 1CLZH 1NH6A 4B5EA 2BNRA 4LQFL 4HC1A 4H26B 5HGHA 2K3TA 3S35H 4I2XE 1MPAH 2F54B 1D5BB 2CGRL 1F4XH 4PB9L 5IHBA 3MJ9A 1OAYH 2QADB 2CKBA 5I0ZA 2M1KA 1YQ2A 2Q7YB 1GGCL 2QQLH 3IETA 4MDIB 1QSVA 1B2WL 3UTPE 2P8PA 4Y8DC 1CGXA 4EBQH 3BMVA 3QQ4A 4OTXL 4GRWE 2W9DL 1T22A 2MNUA 5DJ0A 1Y0LA 4HCRL 5CSZA 3SGDI 2NW3B 3MFGB 4JHAL 3KLHD 2ERJB 2H32H 4A2MA 2X5PA 2HJKA 4L4JA 2E7MA 4XP9L 3T0XA 3BGMB 4JDTL 4XVSH 3B9DA 5A3IC 5DVKA 1W0WA 2HG5B 2KDGA 2QSCL 4Z7UB 1UWXK 5DJCB 2DYPD 1NMBL 1IEHA 4QXTB 2KBGA 4JEGB 2FGZA 3UPAA 1AD9B 5B38G 1I7TA 2GYSA 4NWTL 2V2XA 4HWBH 1J18A 5TDNA 2PCPA 4GRMB 3REVA 1J9CT 4JFQA 4KHXH 4EN3C 3VRLF 4L3CA 3LRSB 1RHHA 3HPJB 2VXTH 1CXKA 4M62H 5EN2A 1WF5A 4ZAKD 1ZOXA 4P0DA 3OB0K 4QNPE 4GKZB 1XF5A 2FECL 4OQ1A 4U1JA 1F8TL 3RTQD 4EXKA 1IM9A 4Y1AD 2X40A 5I1DA 2KUTA 2P5WE 1HHIB 2VQ1B 4IEFB 5FIEA 5FA3B 1ORSB 4CNIA 5FV2A 1U8KB 3TIDA 4NQEE 4N0UB 3CFIC 4HFWA 4MJ4A 1S7QA 2HFTA 4WCYL 4F7CA 4Y88A 3PDOB 5FDWB 1BOGA 1BBJA 4D0BB 5IG7B 4I77L 5C07A 4NUJA 5C0IA 4O58L 2HTLC 1IEAA 5K9QI 3MRJA 1SYSA 3JVGA 2XFXB 1CD0A 4IM8A 3KGRA 3V6OA 4NNXB 3W9DA 1EHLH 2VO5A 4TQEH 4YHML 4CL7A 1BJMA 4PUBL 3VXNB 4XB7A 1KTLA 3MGOA 1ZXQA 1G7PB 4MA3B 3T2PA 3HR5B 1S9VA 3U30B 4M48H 4X9BA 2YA2A 3C8KA 1WITA 4R26H 3C60C 4JDVB 5HGBB 4HUNB 4V1DA 3AU1B 5HI4C 5C0DA 3PWLA 5EORL 4Z8FL 4KJWD 4F7EA 1BFSA 2DQIL 5F7HA 1QA9A 5KVGH 2VLJD 4H20H 4PV8B 2IAMB 1OM3H 1WZKA 2GJJA 2AXGA 1DVFD 3GSNL 1YEFL 3Q5TA 3JTSB 1CTOA 4JJHA 5EU6B 1MI5E 4ELKB 4PJAB 5ISZD 3FQUA 2LFGA 3BVNA 4HS6B 2XQBL 2NY6C 2E7BA 1FNEA 5EZIH 2NXZC 1OAXH 3LEXA 2X4UA 1R3JB 1P7QA 3GMRB 1DANT 1FG9C 1CI5A 3S7GA 1I8KB 1MQ8A 3DV6B 3W9EA 4K3JL 3ROLB 4PTTA 5DT1L 4QXGL 4K8RL 5ELIA 5GS1C 1HINH 5JLZA 1DBMH 5F6HI 1E4XH 5C08D 3QXWA 3ULVC 4E42A 2EH8H 4O2EB 1XR8B 5F71A 2APTA 3E2HB 2DI8A 4LSPL 4Q7DA 3V8OA 3QQ9D 3J8F7 2V2WB 2QQKL 1MVUB 3MO1A 1X5HA 3ZO0A 4RBPH 3U9UB 3I6LE 4GLRI 4KJPC 1KIRA 3BPCB 3WFBL 4I8DA 4MDIA 3BVNB 1HSBB 5L88L 1AGDB 4TSAL 2Z4QB 3G6DL 1WISA 4K94H 1DEDA 1XF3A 3TWCH 5I17A 1A9EA 3JWOL 1UGNA 2BZDA 1MJ8L 3V7MA 3W39A 1XGQA 4HKBB 4DZ8B 5F7MC 2VDNH 3PP3H 4DGIH 43CAB 4AG4H 1JGLH 2VN7A 3MA9L 1OGAB 3EDEA 4RA0C 2OL3B 4Y4KC 3QO0B 5JDSB 1YUHA 1IL1B 2CKNA 1FC2D 1IAII 3C8DA 4N0CC 2OJEA 4OZ4B 3MBXL 3DBXA 5DQ9A 4LLDB 5F3HA 3SCMA 1GVIA 3ULUC 1KTDA 5E8EA 1LEGB 5A2IH 5FKPB 2QKIB 4MJ2A 2O26U 5I1HH 3UTZA 2J4WH 2FZ3A 3L7EB 4HJ0C 3S5LB 4GW5B 5F9WB 4OV6F 4FFYH 1XAUA 4PJAE 1EK3A 3RKPA 3F7YA 1CWVA 4RGOH 2O5ZH 3JBG7 3RL2B 1Q9KB 1QLRA 3NIFF 3S36H 4PRIB 2OBGA 4KJPD 4XVJH 1XH3B 3Q3GB 1NBYB 1J0JA 2Z31C 2X4PA 1FZMB 1J1OL 1CFVH 4U6XB 2AEPH 1XF4B 2Z92A 1JF1B 4KKBD 3VFVB 3VFSA 2AV1A 3G08B 4F58H 4UILL 3K4AA 2FATL 1FDLH 4ZDHA 4GW4A 5IB3A 3D6GA 1CYGA 2VLJA 2L4OA 3PJSB 4CN6A 5IB2A 1FFPA 1CVSC 5I1DB 4KK8C 5F1IA 4JQVA 2NY4D 1OAKH 3IDXL 4N1EA 4X80H 5FDYA 1CL7L 4JVPA 3MJ6A 1YN6B 3LKPA 1SM3H 5IKCB 2OMBA 3F7VA 4OGXH 1TPXB 5KSAA 3FB5B 1FCCA 1BFOB 1A4JA 2DTML 2IGFL 2KKQA 4BFBD 5I8CA 1IC4L 5FCUH 5IQ7H 2W9EL 1MUJA 3K2UL 4IRJC 3BP4B 4HGWB 1OSPH 3VXOB 4I9WE 2EDKA 5E08L 4XRCB 3CFBA 2WW8A 1ADQA 2LAGB 4HS8H 1MCHA 3F6IA 5DA4A 5C0CD 5IW3A 4UINL 4WWID 4JRYA 1EEUA 1QR1B 2HT3C 5C0CE 2RR3A 4JM4H 2JCCF 5F9DC 2XN9D 3TNNB 5B38B 4UIKL 3MUGA 2YBRB 2P43B 2A77L 1RZJL 5CZVL 3B9KB 1YN6A 3DXAE 2EDEA 1RIUL 3L1OL 1NUDA 2DLIA 2DKMA 1S5IL 4AT6A 4WV1B 4D9LL 4R4ND 2NMSA 2ESVB 1D5MB 4NQCE 4J1UB 1HDMA 3DTXB 2VDPL 4MB3A 5JORA 4JFFA 1JUFB 4QHLB 1PG7H 2P5EB 5LGHL 4YDIL 3GIVA 1L7TH 1NGYB 3BP4A 3D87B 5HHPA 2YHGA 5CD5D 1H0DB 3DMMD 3EYSH 5TGBA 3P9LA 2VOTA 3QHFH 1XCQA 1VPOL 4DTGL 5ISZA 4LCCC 4UAOB 4NC1C 4NQVB 1EJ6A 4HV8B 3ZE2F 1RU9H 2H2SD 1JZ5A 4EOWL 4U1HB 5DJYA 4ODHH 2V5SA 5LCVH 2W91A 3PWPD 4I2XA 2DTMH 3WXVL 2DYPB 4AZ8A 1U6AH 3C09B 4HUUB 4H0GA 5I74C 2CLRB 3IAPA 4QWWC 4OCWH 5C0AA 3I75A 1PKQB 1KENH 1RSFA 3CVHA 3CAFA 1JP5A 2FDBP 2G2RB 1I85A 1JV5A 1ZHBA 5FHAH 4DKFH 1XF2B 4PG9B 3FFCB 3V2AR 1DBKL 2Y1VA 4F3FB 3LV3B 5INDB 3UXFA 3NIDE 3BIKB 4FQJH 4PLJC 2GTZB 2I5YH 3O6ML 4IRSA 4RMQA 2VL4A 5EU4A 4Q6IA 3OBAA 1GGIL 5DEFB 4Y1AB 4F7TA 4LQ1A 4BQ9A 3MRRA 1FG2B 5CJQL 3OKKA 2DICA 3OJDA 4DN4L 5HHQA 2PR4L 1QZ1A 3KHOA 4ZFOL 35C8L 4KV5E 4MXQC 3RVXC 3QFJE 2I9LB 1I75A 3UJTL 1LNUB 4QHNA 1CR9H 3MA7B 4K7FA 5FM5O 5J4MA 4LLUB 1QSFD 3VFMA 3C87A 3QJHA 5IJVB 3RWFA 4XC1L 1OB1B 2NXYD 4OF7A 3EO0B 3ILPB 3DUUB 3ARFC 5BQ7B 3O2VL 4S10A 3UYRH 3OGCB 5DHVH 4M6AA 1EFQA 3TGXA 4HPOL 3IDJA 1U8IB 4HK3N 4PJIF 1RUMH 4J3SA 2ILLA 1UWGL 5GGSB 2P8LA 4JO1H 1VFAB 1C5DB 3ZE2E 1X3DA 3Q6GH 4YHZH 3HZKA 1UQSA 2V17L 3BH9B 4O2CB 1GZQA 3TH2T 2XTJC 4XH2A 5J11B 1A7RH 3WHXA 2JELH 1QBBA 3LEXB 2AKRB 4WFHD 4H1LG 1P6FA 2RCSL 1FNEB 4LCWE 3SKOA 2XWBA 2YD1A 3OHXA 1MCEA 2A6IA 3EDJA 4X6FB 1OT1A 2O61B 4HIJB 4X5WB 1U3YA 3RQ3A 4PRPA 5GS3A 4JREB 2R29H 5DZNA 3MRMB 1U8PB 4HUVA 1E4KC 5E2TL 2FR4A 3T0DA 1B0WA 4LEXL 2DQJH 3OKKB 2HJLA 2XOTA 4DK6A 5JHDE 3BEVB 2OR9H 4Y2DD 4QCIA 4OKDA 2VJXA 1C5BH 5D1XB 1I7ZA 1DQDH 4ZTPH 4NZRH 2YPLB 2Z8VC 4ZNEA 2R29L 4J2XA 4QKXB 5DEZA 5DVLA 4OD1L 2GJZB 3LZFL 2EDQA 1SBSL 2F58H 3Q2CA 4Q97A 3P30L 1JIBA 1KPVB 5B39B 2J2ZA 2EIDA 1A2YB 3RY5A 1NDGA 2VXVH 3Q1SH 5H94A 3TNMB 2BOBB 4GAYB 4Y1AE 3FQTB 5JA9A 4N0RA 1QPPA 2Z93B 4YR6A 3QDHA 2DJUA 3QXTA 1KACB 5IUSA 3ULVL 4A6YB 4CU6A 3ES6B 4AL8L 3KPLA 5DJDB 1EGJA 4F8QA 3TO2A 1KCVH 4Y19D 5CEYA 1F6AA 1XCQB 2EYSB 2X41A 5ACLA 4NKDA 4XC1H 3GKWL 1K6QH 1Z0MA 5L2KB 1C08A 5HYSG 1EH9A 4HFWB 5I75C 5AZ2L 3WD5H 4YQXL 4DUVA 1S7VA 2GITB 2P5EA 1INEH 4L4TD 1EEYB 1GOHA 2VLLB 1Y6NR 1L6XA 35C8H 2RAMA 3SDCD 3E6HB 4R8WL 3EFFA 2DQHH 3U6RB 1N5YL 4HX1B 3RA7L 1JTOA 5HYJB 4PJ8C 2YD6A 1JGEB 1AGFA 4K23L 4KFZC 3V4VH 2HKFH 4X6CE 2ICWJ 2FIKB 3RWJB 1FVDB 4Z76B 2D31B 1YEJL 1N59A 1J0KA 5FGCE 4PJEB 3HAEG 5DLMH 2BJMH 1VA9A 2WUBH 1MH5A 1LO5A 1LO2H 4KKCD 3RWCB 1KCKA 2PYFA 5EULV 1FIEA 4ZTOL 1GSMA 5BVPH 3DX7A 3NCEB 4Q9QH 4NQSB 5DJ6B 5HI3C 4MXWH 4YIQA 3X3FL 4O2FB 5C9JA 4WJ5A 2W38A 1SEBA 2B4CH 4HBQA 2PXYD 5L2JA 2VQUA 1RJZB 3RIFF 4KZDH 5F93C 1HH6A 1RHHB 4PRID 4RMTA 3OKNA 2DJSA 3D85D 3QDGB 4PJ8A 2IPKA 4X83A 2NTFA 4DAGH 2AK4B 2F15A 2UWEF 5EPMA 4YBHA 1KB5L 3L3IB 5D7JD 4N5ED 1MI5D 1RZ8A 3NGBC 3LQAH 4WFFE 4YDIH 3QEQD 3QG7L 5DC9B 5IVOA 3VDAA 4JFYB 3HI1A 2NY5C 5IEKB 1AE6H 3GUTA 3HZKB 3H9HA 1QR4A 4AH2A 4HLJA 2QADD 2ZOKB 3RKDC 3NACH 3SE3A 5FM8A 3FTGB 2OR7A 4OCLC 3DV4A 2ZKHH 5EOCL 1P9MA 5IVXF 1S7TB 3D0LB 1KXVC 4KHTL 4GUPB 2HA1A 5CKGA 1MLCB 1AP2A 5EBMA 2VLME 5EWIL 1BOYA 1IAOB 4UV4L 3U2SA 5DUMH 1A6AA 4OLWL 1LE5A 2VLRB 3G6JB 4MJ6A 1LEGA 5FO8A 4I5BB 5EPMB 3VH8B 1IILE 2A0LC 3MLYH 2CKBB 3PWJB 3NCMA 3DBXB 3DIFB 3QDGA 4PJ8B 3QXAB 3S6CA 5DJ8A 2DQEL 3WCYA 4PJHF 2A6KB 1BIIB 5CMAA 4JFZL 5CBAA 3TBSB 1P2CB 4LLVA 1RK1B 2F54E 5I2IB 4ZUTB 3TN0C 5JIPA 5FGCB 2HFEB 1JWUA 2G60L 3OZ9H 3T2NL 4P2OB 3WUWB 1QD0A 5DJAB 3UC0L 5F9AC 1TZIB 4Y5VC 1FE8L 1BFVH 5FF6B 4WFGD 5F9WC 1PSKH 1AJ7L 5GGUA 1XGYL 4JHBA 1RQ5A 1MJUL 2F53D 4H1LH 5KOVC 4WUKH 4NC0B 1MF2H 1QSEA 2HFGH 3QUKB 1DSFH 2HJFA 3MJ7A 2QHRL 4G3YL 1QUNA 1UWXH 3CVHH 5ITFA 4U2YA 2WV3A 1R6VA 3JVGC 1MIEH 1OT2A 1INEL 3E2HC 4JKLA 5DMIL 3LHPH 8FABA 3Q3GA 1GCFA 5D9SA 2G5BA 5CCKL 1TNMA 4Z7VF 1CDGA 1R3KB 2OX5A 5I18H 5I16B 4HS3B 4Q0XH 4H25B 1F58L 4HUXA 4MJIA 3T8XA 4JZOA 1GOGA 3MBXH 1DEEA 4D8PB 3FJTA 4GRLC 5DFTA 3QPXL 1IZKA 2Q6WB 2O5XH 2ZJSH 3TM6A 3I3BA 4RFOL 4KXZI 3LQZB 2W0FA 2J8HA 4JRXD 3OB0H 1KUMA 2AQ1A 4NN7B 5GGSY 1ORQB 3O4LA 4K7PX 5H2BA 4DGIL 4CVWA 5I1KL 4P9ML 5GS2H 5K59F 4V1DE 5A2KH 4YDKL 5FYKL 2KH2B 5JDSA 4C57C 1JPFB 4MQ7A 3TPUA 3VG9C 4PJ5A 4PPTA 5L88H 1HSAB 1FYHB 3AS3A 4OCNC 4MA7L 1T5WA 3WFBH 5D1XD 1G7HB 1MCJA 4LPTA 2FL5B 5ICZB 4L5FH 2OTWB 4XT1C 1CD1A 4LSDA 1C5BL 1AGDA 1PZUB 1II4E 2AJSH 2CD0A 4LSPH 2ED8A 1JZ6A 1B90A 3CLEL 2IANB 2E6QA 1HH6B 3UP1A 3K80A 4DWHA 3K4DA 2NW3A 4KROC 2DS4A 1EO7A 3EHBC 1MCOH 5E8NA 3ARDB 1G9EA 1SEBB 3ZKMD 3O9WD 4OZGB 5IBLD 1A6ZA 3U36B 4RWHA 4YEFA 1MFDL 1KN2H 4NQSA 3O3BB 4U1GC 3JV4A 5DHYA 5E03A 1YMMB 2PYEA 1WFUA 2ZPKL 5AWNH 2WUBL 4E41E 2QJDA 2BFVL 3RWDA 4NOBA 3VG9B 3FT3A 4L4VD 2ID5A 3UTTB 3P3YA 1UWGH 3VFRA 4PGEA 5L2KD 4IIQC 5F7FA 1QBLH 5IKCA 2ED9A 3GSNH 4BQ6A 4WNQB 1VCAA 2YD8A 3UO1L 4BFGA 3N85H 2MKLC 3DI2B 4XPFH 2YSSB 4Z7VA 3FQWA 1NBZB 3QUZC 4JHWL 4U1SB 4LLUA 1QVOA 4NZJA 3DXAB 1AIFB 4G8GB 4J6RH 1JPST 1TVHB 3Q6FA 3QDJD 3GJEB 4J6RL 3H6JA 3MV11 3QR2A 3TA3A 4PYGA 1BWMA 5KTEH 3R1GL 1VEMA 4G3YH 1XIWC 5CJQH 4YEEA 3OKEB 2EE9A 5KVMC 3CFEB 2GTWA 2GHWB 2R1XB 1GGIH 1JK8A 4IOSD 3IXAB 1OTTD 4TNWK 3ARBA 4FQJL 2EKJA 5KW9H 3NTCL 1QHOA 4PJ7E 1JI2A 1T7ZA 5FOBB 1OSZB 2BMKA 3U79A 1BIIA 5CMAB 3LKSB 4L3EE 1TMCB 3DSFL 4XNUL 4XCEB 5C7XH 3BAEL 3MJ8A 3T08A 1EHAA 5C08A 4BFEA 4TRPH 5GGUB 3PGDA 3OZ9L 2DM7A 1F3JB 4C55A 1KENL 5KVFL 4KJYB 4OIAA 1U8NA 4U33A 2XWTB 3O4OB 2ZCHL 3BKYH 4P2OA 3SKNB 1UH4A 4F7PB 1M71B 4LEOA 4IRJA 3ZYIA 3OAZH 4FXKA 4JFZH 3FOLA 5T1MA 3RWHA 2HKHH 4YFDB 4BQBA 4NDMA 3ARDC 1D5BA 1ZKAA 3QEQB 1DQDL 1U8OA 1AGCA 3BP6A 2P8LB 3OG6B 1T21A 2IPTH 3SKMB 3MV9B 4OLWH 5J06A 3QIUC 4GT7A 5D6DC 1YEDB 1AXIB 4H1LA 4X9FA 4XBGA 5I1LB 3TBVA 5DI8B 4O51B 1LEKB 2ERJC 4NO3A 1JUFA 2FX9L 3MLRH 2WINB 1WUNT 1U8NB 1RZ8B 3EZ8A 1P4LB 3PGDB 2DB8A 3ZKNC 2NNAB 4LNRA 3P77A 3ZYZA 4LAJH 1JTPA 1K8DA 4G8IB 1NMBH 1VGKB 4UQ2A 2Q3AA 5ESQB 1U8MA 3MR9B 4JE4B 4P5TA 2QSCH 5AZEL 3BJLA 5A16A 4HJJH 5FUOH 4XP6L 1YEGH 2BRQA 3KS0H 1FVCB 5C0DB 4UIKH 3IKCB 4N90D 2OJZL 1SMOA 3TJHC 1G6RB 4HPOH 1ITBB 3UJJL 3P4MA 3AM8C 3BZEB 1P9MC 1ZS8A 2GK0A 4PJGB 3V9FA 2KPNA 4WGWB 2PW2B 2IQAB 1NC2D 1M71A 4ZO8A 3THMH 4HGWA 5I18L 4Z7OF 4KDTA 1U3ZA 4NQXB 3U0TB 4JFXB 5SWSB 1A8JH 3UDWC 1MELA 4UQ3B 1URLA 4Y5VB 5FHBH 3PQYE 4OUOA 4MZ2A 1A4JB 2WK2A 4MJ5B 3MV7D 4WEUD 3FQNA 5D1ZD 4I0PC 2PR4H 3F7VB 4LSUL 4MXWL 3I84A 4X4XB 5B21A 3UX9B 3T1FA 1ND0A 1HWGB 1H3XA 2NX5A 2X4OA 3O3DA 2BSTA 3FRUA 5E8OB 3VG0L 4AIXA 2N4IA 3LB6D 4HX1A 1MF2L 5CEZE 1DVFC 3D9AH 3HI6H 4HKXB 3GM8A 4UILH 1EX0A 3EJZD 2Q86A 5AUMA 2DQGH 3GSWA 4ONFH 4R4FH 3O2DL 1F2QA 1U8IA 3D9AL 1N59B 1BGXL 3BPLB 1IBGH 3MGTA 1MCLA 5INCB 4GG6F 1YYML 2HN7B 2NYYC 1HHIA 3OXRA 5GRJL 3F65A 5EUKB 5E8NB 4RFNC 5K9JL 1A5FL 1OD9A 2BSTB 3FRUB 2FZ3B 3L7EA 4WENB 1SQ2N 1KLGA 3FKUS 3QH3B 3BDYL 5KVEL 4Z5RA 1VENA 5DO2C 3FQNB 1MEXL 5HGDB 5FYJD 4DUWA 5CJBA 3LN4A 3OG4B 2VZ3A 4HG4J 1EVUA 1I7RA 3BHBB 3VXSA 5HHPB 4AL8H 1A2YA 3MV7A 4ZMAT 4IHOA 3HZMB 1LVEA 2QSVA 5DJZB 2LU4A 4YPGA 2GTWB 4YHLH 4KHTH 1T89A 2ZKHL 2PXYC 1AH1A 1ZHBB 3W0WD 4YDLB 1RY7B 1I7ZB 5E70A 1J1PL 3UTOA 3MUHL 3PP4L 4X4YA 1ACZA 5F3BA 3QEGL 4PJ5D 3O3EB 1M1SA 3DNKA 4JG1H 4WW2F 4HGKC 3MLRL 1DLHB 5FUCE 2FLRT 3TA3D 4MYWB 5BS0E 5DD5H 5KSAC 4PJCB 4PJXA 1FFPB 2ZWLT 1CD1B 2BDNL 4ORGB 3PWVA 1HZHL 4FQCL 4ODSH 4PS4H 1ZVYA 1X7QA 2Q87A 3GRWA 2WINA 3MZTA 3LVEA 5C0AD 2HT2D 4TVPH 2V5MA 4XWOD 5BJTB 3HUJB 2WWMD 3LD8C 2HG5A 1HILB 5ACZA 3WO4B 4HEME 1T0NA 4HXAL 4P23A 3VGHA 4FQIL 4M7KL 1YMMD 2JJSC 3JV6A 5I6XC 1MFNA 1RJCA 1W72A 2X1OA 5I73C 4QXGH 4GXUM 2CIKA 4ZSOE 3U7WL 3X3FH 1JWSA 1SM3L 3MACL 4NJAL 1TNNA 2RBLA 4AEFA 5JW4Q 5BQ7A 1AY1H 3IDXH 1CDJA 1NBQA 4PJIB 4OIBA 5EZIL 1JWMA 3MYJA 1QLFB 4OM1L 2E7LA 5FKAB 1D5XB 2X1XR 3O3EA 1EVTC 1KJ2B 1RZ7H 1P4BL 5AYUH 3G5VB 5FM4A 2F54A 1NMCB 4P49A 5FECA 3WIHA 3SCMC 2VSDA 5GGSA 1PX3A 1WBYA 4ODTH 3CH8A 4RRPA 2IH1A 4ELMF 5D7KD 5CP3H 3NA4A 4K94C 4HWEH 4GLRH 1GIGH 1IGYB 4OLVL 3W39B 5AG9A 4X6EA 3UJTH 3X12A 3QFJD 1U3HC 4Y0GA 4H5SB 1AXTL 1DBAL 4PRHD 4OLVH 3JXAA 4M61B 1OAQL 5FO9B 2P5WB 5H2BB 2X1PA 5D2LA 2P47B 2DRUA 1F90H 3GKZA 3N85L 4XNQB 4NQEB 2VR9A 2EDXA 3OKOB 3GI9L 4NNXA 3C5JA 3MRCB 3LDBB 4D8PA 2Y5TA 4G43A 4Y19B 5IBUB 3E6FB 1RZ7L 1NFDA 3SE4C 5IMOB 2BVQA 4U1HA 5ITBH 4I77H 5IMMA 3BRFA 2EIZA 3IDMA 3WFZA 2QQNH 1A6UL 4PY7B 4IRJD 5A3ID 4G6KL 4JFDD 2WIMA 4OCWL 1IARB 2F58L 2SEBB 2HLAA 3LZFH 3WNKA 4M7KH 3MV9D 1LK2B 3QPQD 4HW6A 1JN6B 4P57B 3WJLA 4HXAH 2X4OB 3SDYL 2EDOA 4UZGA 3OKOA 1RU9L 3MJ9L 3HZVA 3KXFB 1AP2B 2B1AH 4Y4KD 4PD4K 5MEPA 4R97B 4M9OA 1TJIL 4R90L 5E24E 5IB5B 3BISA 2BDNH 1UZ8B 4MWFA 4JFQB 1HQ4A 4QEGA 4Y5XC 1ZGLP 1YECL 4R96B 4LBEB 1UYWH 2V2XB 5LGJA 4NWTH 5DT1H 4KPHL 3ROLA 2QLVB 4RMRA 1AR1D 2ADGB 2YC1B 2NY3C 2FD6L 1FBIL 1MSPA 3BHBA 4NGHH 1OAXL 5I9QB 2AJYH 3BRDA 1T5XA 1ZLSH 4EUPH 4NJ9L 2WQRA 2BNQD 2YK1L 1U95B 3S8WA 2A9ML 5FOJA 3ALPA 3P77B 4M5ZL 5IESH 4U0RB 1RUML 1ZGLA 3RVUC 3U9PL 4ZODA 5CP7B 3UYRL 3ZYJA 4ZUSB 2AW2A 1OM3L 5GRZA 2ZSWA 1MEXH 3D25B 3H3PL 2H2PD 3CCHB 5F88A 2GY7B 3CH1B 1KGCE 1WIPA 3P4OA 4LLQB 4JQXC 1NFKA 1WZ1H 1YEEL 2XKNB 1BBJB 5EO1B 2VDLH 5HHNA 3HZYA 3RPKA 1JTTA 1GGCH 2R1WB 4WHDA 4NKMA 3ECBA 2IEPA 5J9PA 4ZUUA 4S1DC 1PZ5B 4M00A 4MD4A 1NCTA 4XZUB 2AP2A 4MA3A 4KGLA 4WO4C 2XKUA 4F9PA 4HBCH 4JKKA 5F7DB 3MCLL 4OZGF 5BZWA 4PUBH 3TBTB 3MV01 4FABH 3R06A 3W9DB 5J6HB 3UROR 4DFIA 2VDRL 2NY5H 2Z93A 5EU5A 5DD3L 2DQGL 4NT6A 1DR9A 1F3JA 1LO4L 4JQIL 5EU7E 1Z9MA 5FHAL 4DKFL 2FSEA 1DQLL 5FYKU 5IW1A 4ENED 1S7RB 3QQ9C 2WWKT 5D2LB 3QUYA 1JYWA 1J8HA 1MNUH 4R7NA 4OCRL 4YBLB 4XVUC 3KPQB 3SJVE 5CZXC 1NGXA 2F9BT 4KVCL 4FTVE 2R1WA 2B20A 2V5RA 4KJQD 4NNYA 3U4BL 2C3WA 5JTWA 2DQEH 2CXGA 1Z5LA 2A6JB 3VWKA 5JW4N 4F9PC 3LS5L 3QHFL 1TFHA 3B5GA 3UTTE 5KSBF 4M62L 4NHUA 1VGKA 3HPJA 1JHKH 2FSEB 3I6LD 1G6RL 3QFDA 4PJBB 4PRIE 4HQQL 2EECA 5JXAL 4GXVL 4YUEH 4G6ML 4G8FB 4FMKA 5KVDH 5DQJA 3T2OA 4LSTL 2ADFH 4C54A 2VR5A 1I9IH 5IM7A 3B83A 3JWOH 5TJWK 4GMTL 2EH7H 3V7AG 4EI6B 3IFOB 1QACA 3OAYK 3RJDA 4ZYKA 5JMRA 2FEEL 3M45A 1AGCB 4N0UA 3VXQA 4XNYH 3QG7H 1GYAA 1KXQE 32C2B 3DUUA 2VAAA 4OI8A 1VKXA 1DQQA 1IGFL 2EYRB 2IPTL 4JM2F 5C08E 3BPCA 4I1NB 3HUJE 4HJGA 1FYTB 1A64A 1EXUB 3SKOB 1SBBA 4QLRA 1AFVH 3DARA 2AKRA 4F33B 1UB5B 3PL6C 1IC4H 4IRSC 1WC7B 4PJCA 3UDWA 3AVEA 4UQ3A 3GSRA 2NTFB 2P4AB 1CLCA 3FQXB 1ZANH 4BUGA 4Z7QF 3LIZH 4X99B 4PJ9C 3UJIH 5GRXG 4MNQE 3FB6A 3H42L 3RZWA 2XV6B 4QT5B 3SQBA 2GJZA 4LCYA 2IAMA 4MMZC 4PP1D 3VD4A 4K3DH 4QXTA 4XNUH 5E1HB 5DLML 1NL0H 4ISVA 3PGCA 1W0WB 4Z7UA 4OM0H 1QQDA 4KRPB 1T1WA 4F58L 4NFBA 4UDUA 3WJJC 5LXGL 2HJLB 4GG8B 3MV8B 3IVKA 3KJ6L 1A3LL 1IAIL 4ZO6A 2GUOB 3NCYP 1K2DB 1Y0LB 3RA7H 4LIQH 1N5YH 1EO8L 4I0PD 4GMSL 2XZZA 3UAJD 4XMKL 4JAMA 3FONB 1XR9A 3IS1X 4L8SC 5MHSE 4P59H 4S1RL 5I1GH 3H9ZA 4Y1AA 1G7LA 1BP3B 3WO4C 4MHHG 5IBTL 1ITCA 1CICC 4G9DA 4PGCB 2JB6B 4OBSA 1EERB 4XCCH 4UT7L 3V0WH 4DOHE 3KPSB 3NZ8A 2DD8L 1G9NL 4B7IA 5TQ0L 2DOCA 4U3CA 3TN0D 2BVQB 5DGRA 4GQPH 2IQ9L 2ORBL 1MRCL 2EXWC 4XP4H 3EO9L 4IRJB 3MMEA 1F3RB 3TO2B 1FC1A 5EOQL 1Q9WB 3OQ3B 4DZBB 3C5JB 3FT4A 3BGFC 5T3XL 2R2EB 3D39D 4NHCL 2IPUG 4K94L 4OZGE 1IC5H 5C07B 3B3IA 3U1SL 3FB7A 3WFCH 3KPMB 1T1ZA 3B2UD 2Z91B 3FT3B 1OQXA 4JM2B 1CD9B 5JHLH 1CDCA 3BP5A 3QJFA 1U2CA 3BD5A 1ONQB 2D0FA 5MI0B 5HHMB 4Q9RL 1IAIM 3EBAA 2OR9L 2PW2A 3VXME 1XF1A 5MP6H 1UH2A 3RP1A 5JORB 3SDXF 4LEXH 1BECA 3ZSSA 4JN2B 4OF6A 1IGJA 1TZGH 3GJEA 2OI9B 1N2RA 4NBZB 3IDYC 4P23C 4NNPL 3VXPB 3OF6D 1MQKL 1ZT4A 1WBZB 2RCSH 2CLRA 2X6MA 4XX1E 4JR9H 4P5MA 3JWOC 4ESKA 3KWWA 3CMOL 4FN0A 2V17H 3FOMB 1J5OH 4YHPB 2XA8L 1R3KA 4JZJC 2VDML 3FTGA 4AEHH 1N7ML 5M7QA 2HWZH 4RFOH 3TIEA 2OL3L 4JJ5B 1JNLH 3KXFD 4ZS6C 2ZJSL 3QPXH 3T09A 1D5ZA 1HXYB 1XGRB 3QRGH 4H20L 4LOUD 4WW2C 4S2SA 3QH3A 4WFHE 2MTPA 1F97A 1XIWB 3FN3A 5ACMA 4Y2DC 1AHWC 4JZNB 5JOEA 1N6QL 1IM3B 1XFPA 4WI5A 4N0UE 3FMGH 5DMIH 4IDLA 2AAVA 5IB2B 4LPVA 1ADQL 1TXKA 5EG6C 1WBZA 3V5HA 1T4KB 5IB3B 3ZKQD 2ZCLL 3DUSA 3IFPB 3RWEB 3QT2A 5D71H 3TBWB 1SEQL 2X4TB 4U31A 3BWAB 5E0QA 2WIIA 4MJID 3QEQE 4E5XB 3QAZB 5LBSH 4UBDD 1QR1A 5LVEA 5B8CC 4HEPG 1RZJC 4JKPL 4LHUG 4C58B 2H9GB 1CFTA 5ALBH 1AJ7H 1DBKH 12E8L 2JIXD 5IFJB 1CZ8H 1MCPH 4BZYA 1P2CA 1I3RB 1YDPB 3ZTJH 3FQRA 5TDPA 3KPPB 4PJ7A 1RIHL 1QFUL 3EJYC 4WW1B 3C09C 3CXDL 2HRPH 1KF9B 1RUQL 2P5ED 3C2SA 4MD0A 2C3HA 5FGBA 3E3QE 1PEZA 4S1SH 1P7KB 4CMHC 3GMLA 5GIRB 2CR3A 3D3VD 3C5ZD 4NQTA 5T3ZD 1NLBH 2OJEB 5EOCJ 4X98B 1UJ3B 5TF1L 4ODWA 3D39A 1NBZA 4U1SA 5M94B 3MODH 2LVEA 2R0LH 4RZCB 4HFUH 1VPOH 1Z9OA 4YDVA 2IQAA 1DZBA 3MRGB 5E8DH 4JG0H 2XA3A 1F00I 3O2WL 3PWPB 3ZZ1A 4BFIA 1JVKA 2FX8L 3PGFL 4HPYH 2EO1A 3VH8G 3N1QC 4HHAA 4JRYE 5DRXA 5TPWL 5IJKA 2FHBA 3FHAA 5JO5A 1NPUA 4MA1C 2VDPH 3W5MA 1WWBX 2PNDA 3CSBA 2E8ZA 3WFDL 3GIVB 1D5XA 5IVXA 2D7TL 3RVWC 3IF1B 4OLZL 3B43A 5KSBA 3EYQC 5BOZG 3B6SA 5J0BA 1GC1H 3L1OH 2XWJB 4ZFGH 3QQ3B 2EDJA 4X4XA 2F74B 3OXSA 1RZJH 2VKWA 2BVPA 4XVSL 1OGTA 3EJJX 1Q94A 1RJLB 3KYNB 5EU6A 1VKXB 3REWA 1BD2D 3RWGB 4XMLL 4PJDA 5DDHA 1W72B 4UINH 5AD0A 4KU1A 4XGZB 1BD2E 4PIRF 4BUHA 4HS8L 3HE6B 1U8QA 1U42A 4JFEE 1ZVSA 4LLWA 5D7IB 4KMLB 3IFOA 1C12A 1OHQA 1TPXC 4KZDL 2E7CA 3UTSA 1KPUA 3VMPA 1WTGT 2F8XC 2XPGA 4PJ5B 2E7HA 4ZS7H 4X99A 3V6OE 4F7PA 1F4XL 2NR6C 1WT5A 2ZUTA 4I3GA 4G8EA 4KJYA 4J3XA 3QUML 1AI1H 4UTAH 2GAZA 2J8UB 3IDUA 2HVKA 5IFAL 5CZXD 5GGTA 1OP5K 2XZQL 4I3RL 1B4RA 4D9RE 1NFIB 1FAIH 3LKNB 3O45B 3V6FA 2YMXL 3IGAA 1L0YA 2VZTA 4D9RD 5IVXB 2NX5D 1XR8A 1GZQB 3TYGH 1CICB 1R24A 1U8LB 4G6JH 1LO5B 1MH5B 2R2BA 4U3HA 1NANH 2OI9C 3WJJA 3HNSL 3INUL 1GPOL 5GISL 1MRFL 2EEDA 2DDQL 4IOFC 4KKCC 3S88L 5I1EL 3RU8L 4N9GA 3LH2H 1M05B 3AXLA 1AGFB 4UT9H 5F89A 3GK8L 5MI0C 3QZWG 5GRYA 4JY5H 4MQTB 3TT1H 1LD9B 4YXHL 3N50A 3SDCB 2BSRB 2BVOB 1T89C 2IPKB 3AS0A 4WNQA 3QFDB 5FO7A 4D3CH 1VGEL 1PFCA 3MOBL 3UTQA 1QHPA 2YPVL 5D4QA 2AVGA 5ICXB 3NFSL 2ICWI 2M2DA 2VZSA 2JCCB 3AUVA 5L9DL 4JRWA 4AYFA 4MAYA 5H35A 1XT5A 2PW1A 3NA9H 3UBXI 2I25N 4YIQB 3VFNA 1I3RA 1YDPA 1CG9A 1L4IA 5IK3A 4LHJB 2IMNA 2VXVL 1KB5A 1MFEH 3HNVL 1DDHA 3PDGA 1IC7L 3MRBA 5BO1H 3L3OA 2NQCA 3UBXG 2MFNA 3IGAB 2HFFA 1BFTA 1UWEL 1FSKC 4HIIA 4J3VA 4XPAL 4OD1H 1T03H 3BSZL 3IFPA 4LKXA 3CZFB 3CXHJ 5JMOC 5FO7B 2PXYB 3PV6A 4GG6E 1LGVA 1FZJA 2XT1B 1LMKA 3IS0X 1U95A 2Y07H 4U1GB 3QEHB 1PKOA 2H8PB 3F12B 3MLWH 1K3ZA 3V6BR 2DQJL 4WW2B 5EZLA 3SY0A 1GOFA 4PREA 5ICZA 4P2RB 3BN3B 4CJ1A 1IC1A 5IV2B 3QIBB 5JW3H 1GGYA 1MLBB 2D0HA 1TTGA 3TZVC 2ZG2A 2NR6D 3MGAA 1JPFA 4MQ7B 1Z2KA 1C5DA 1KLUA 1PW3A 2DL2A 3O6FD 1GGBH 2Y7QB 5C07D 2JELL 3HAEB 1PGRB 1T04A 3F7PC 3JV4B 5HHNB 2R4SL 4AENA 4EI5B 4HUWB 3HNTL 2CLVB 4XVTH 4IMKA 4JO1L 1MAJA 1SJVA 3CK0L 5DEGB 2Q8AL 1FP5A 2IFGA 3E8UL 1A7PH 4DGVL 4IRSD 1J05B 4LASH 5ABDE 2DIAA 4XWGH 1TCMA 1AR1C 5BRZB 5FK9B 2NY0B 3BH9A 4N8PA 1UB6B 3DVNB 1V7NH 1D5IL 5FUZL 1ETZB 4Y4HC 2J6EL 3T0VA 4TYUA 1CK0H 3TCLA 3EIFA 4L8CA 3OAUL 5DF0A 4JREC 4HCRA 3HRZB 2C1OB 2YUVA 2XN9E 4O2FA 4XBPB 2CMRL 5CJOH 3EO0A 3ILPA 3DX7B 1OP9A 4OZHB 1UXWB 1MCWW 3HE6A 2UZIH 3BEVA 1UA6L 5D2NA 1ZA3B 5KS9F 2HMID 3VRLE 1HQ4B 5IBLC 4OD2B 4DKEH 3KHQA 4TULL 3AY4C 4XTRC 3VXMA 2W9LA 3K1KC 3KXFE 3CVIH 1WSST 4NRZA 1T7XA 3UPCA 1TJGH 4KTEH 2NY6D 5EO9A 4HD9A 5HHOB 4P3DB 4RWYL 5IMKB 2JTDA 1F2XK 2Y36L 2AJVL 5IIEB 5CIPB 2P8PB 4DGYL 1Q9WA 1DEEB 4JFPA 4X6DA 3V4PH 3ARFB 3OX8A 3LSOA 4BQCA 1JNNH 3DX8B 2AEIT 3X3GH 4NQVA 2EDWA 5MEOB 2EC9T 4M8QB 3MPCA 3F58L 1YZZA 4E0RA 4L8CB 4MNQB 3TZVD 3WXVH 1IGIL 4ODHL 3RNKA 3G6JF 4CU8A 1G6VK 4LFHD 3QCTH 4ONHB 1T1XA 3QUXC 4L4TA 4KAQL 2XI9A 2FEEI 3DO7B 2E9WA 2AI0H 1F6AB 4M7ZB 4PJHB 4KMTH 2EIBA 5JHDA 4JFHE 3T4YB 1TZHB 4LVOB 2R4RL 5D1QB 2XZAL 1BM3H 1WZMA 4EUPG 1I4FA 4KHXL 3PWNB 4PFEA 1CBVH 4YR6B 1RULL 4P23D 5DUBA 1DFBH 1E0OB 1QFPA 1KFAH 5FYJE 3JWNC 5C0EB 1SVZA 1XGTB 3QDJE 1BF8A 3X3GL 4C56A 1QFWI 3BYYA 4JDZB 4FQQB 4OLXL 3TNNA 3SGJA 3V4PL 5B38A 1TQBC 4LDOB 3FO9A 2Z0BA 5DD0H 3QCUH 5LWYL 1I1FA 6FABH 3WSQL 4P4RB 5DVMA 4XAWH 3N06B 3PDDA 2A77H 5KOMC 2AGJL 1IE5A 5D70H 5C1MB 5CILL 5J13B 1A6ZB 4BSJA 1SJHA 5F8QC 5CBAB 2JB5H 3B4NA 4ZS6D 1D5MA 1AHWB 4HWUA 1KTRL 1JHLH 1NMAH 1CN4A 1QP1A 2JLLA 4X0KA 3BKJL 1AC6A 1DQML 1GHFL 2VWEE 3RWEA 3GMPB 2XXCB 1HSBA 3NCCB 4LLMB 1KNOB 3TZVA 5CJOL 3V5HB 4LDEB 1YEKL 2XYCA 3RVXD 3VFTB 1R0AL 1KB9K 3ARQA 4JFEA 3ARGA 3HB3D 2R15A 1VEOA 3SOBH 2H45A 2CGRH 5C9JB 4PJDE 5EZOL 2CIIA 3SN6N 1KJ3L 5HHOE 1HK6A 4YO0A 1FNGA 3ARTA 5ERWA 5FYJU 3U4EB 3RWCA 1A7QH 3IDGB 3WLWC 4HIXH 4AMKH 4YHKH 1KPRA 3DJ9A 1VHPA 1N64H 4LCWA 2BXYA 3E8UH 2DI9A 3QWOA 4RGNE 1NBYA 3LDBC 1CICD 1RZGB 1OW0A 2Q8AH 1UB6A 5EUOF 3VU2A 4IJ3C 5MEQA 3O41B 4B7LA 2FYYB 2P24A 4CVZB 3O4LB 3UTPD 4YC2B 3HE6D 3UTTD 3CXHK 5IMLA 3CD4A 2UUDH 4X4MA 2D7QA 1YEHH 3LMJL 4GW5A 5E00B 5DS8B 4QTHB 3OR6A 3TPKA 2R0WH 2QKIA 4FFVC 2UUDK 4DVRL 3LOWA 4UIMA 5TE7H 4TTDC 1FN4B 4FQLL 3G08A 4NC1E 1NFDE 5DMYA 3RZCC 2H2SC 1UM5H 5I1IL 2ZUVA 4JN2A 2V9RA 3BPOC 3V7AE 3PWLB 1NMCC 4PRIA 4OFYA 4WO4A 3HZMA 2E8YA 3FO0L 3MOAH 3GMOA 3BEWB 1U93A 4G80B 1RZIB 4PRNB 4A6YA 2NY2B 2OQJB 4TOYL 3RWIA 3X14B 3W11D 4J3OC 4PTUA 4UT6H 1ZE3C 2PETA 4WWKA 5HI5C 2AK1L 5BW7C 5F9JA 1A1OA 5CP3A 2AJXL 5EFIA 4LCWD 4EQ3A 4YE4L 2IADB 3WL9A 2R8SL 3SDCA 4KTDL 3U9UA 3ZE0F 3DRTB 4U6TA 2Y25A 2AJXH 4OT1L 1T7YA 5L6YL 3BX7C 5DJAA 2VZUA 3O8XA 1K3IA 4UDUB 3VXRD 4ZDHB 3NFNA 5HVWA 5D1ZC 3TBTA 2BX5A 1BOGB 5C2UB 3QZWA 4BH7B 5C0AE 2B0SL 1C12B 4OLEA 3A6BL 3MLTA 4XZUA 3V0VB 5HY9B 5GSRA 2ZUSA 5DK0A 1FQ9C 4YFEA 4BK4A 5I71C 3TV3H 1H0DA 5LAXB 2I07A 5DMKA 1YEIH 1YPZA 4O9HH 1EEZB 5TQ2H 4FS0A 1HINL 3ZTNL 3ZT5A 5TE4L 2VNCA 4K8RH 4X6FA 3B2VL 3AAZA 3FONA 4K7PY 4KI5F 3QQ3A 3G6AA 2H41A 3TP4A 3U0PB 4I18B 1MJ7L 3LMJH 5E94A 3GJFH 1A6VL 1JFQH 3KPNB 2DQTH 1CGSH 5HHMD 3WDHA 1XMWA 2VABB 1YN7A 2VXSL 3H7BA 3WJLC 1G7MA 2O5YL 3RHWK 1JNHA 3SDDC 4IRZH 1U8LA 3RVVC 4L8SA 4YHYB 4JPWL 1JPGB 1D9KA 5J11C 4QRQA 1S7SA 2X4NA 3ARXA 3QUMH 2CSPA 1NCUA 4RQQA 5A2FA 2I9TB 4QF1B 1B6DA 4KC3B 4FQHA 3SO5A 2HT4C 2X4QA 1OAZL 1S3KL 3GSNB 5TE6L 4ELKA 1AGBB 5SWSD 5KBNC 1L9NA 5I9QC 4OZFA 1T22B 4TPRL 1BQHA 3MV7E 5FOBA 4CW1A 4U1NA 3M17A 1QFHA 1PEWA 3EYVB 1GHFH 2P46B 2P7TB 1Y6MR 1DQQB 2YD4A 3KVQA 3HC4L 4OZIF 1ONQA 4NFCA 4XMLH 1CU4H 1ZLUH 1MCSA 3TT3H 3VJ6B 3RX7A 3MCKB 4OIIL 2UV3A 4U6HB 1J87A 4KKLD 2R69L 3QA3B 5D70L 3VFNB 3AMLA 1C7TA 2XTJE 2Y4SA 2WM0A 4XAWL 2VABA 5BOPA 4N0FB 5T3ZE 5E8PB 1JV5B 1UCBL 1F13A 4DVBB 4YX2H 5JQ6H 3RWJA 3EYUH 4KDVA 4QRUB 5ILTL 5DUPH 3AM8A 2E3VA 4YHIB 4N8VA 4LRIA 5HI5D 5L7XH 1CGVA 1QBAA 3VFMB 3AS2A 5EU5B 3GSOA 4JFHD 3BUYB 5E00A 3DRQA 5KSBB 4NQEA 2ATPA 3ARWA 4RMVA 4Y2DA 4RNRA 4KRLB 5JHDD 1CLYH 4RAUA 4E0RB 4G9FD 3QDME 4WI3A 4PGCA 4GQ9L 4M02A 3HN3A 1IL1A 1BBDH 1RZIA 3MBEA 1IFHH 1IEBA 3LEVL 3V6OC 4G8GE 5JUEH 3VWJA 4MDJB 1AQKH 3LKQA 1MREL 4UAOC 1VADA 4LCCA 4J1UA 3ARFD 4NBXB 2IBGA 5D5MB 5BV7B 1MJJA 2A83A 5C70A 4YNYB 4AT6B 3K0WA 5D1XC 5E6IA 5EZJA 4PLOB 4ONOA 4AQ1B 1FN4A 1A1MA 3HE6C 3QULA 2AJVH 4KKNA 1CZ8L 2IAMD 1T4KA 4GAYA 5CSZB 1ZA6A 5K59E 1DVFB 3EYFA 1BF2A 4L3ED 3FN9A 3KPPA 4PJ7B 5SV3A 3GGWA 4TULH 4JHAH 1EAJA 4PJXF 3WLWD 2CJUL 4P2QD 1NCCL 2JJWA 3TCLB 4B50A 4OB5H 3NGBB 3JV6B 3EW3B 4C4KO 1SY6L 3BESR 3MRFB 4R7DB 1Q1JL 2CMRH 5EC1B 4EBQL 4OQTA 4P23B 1OY3B 4NO5A 3L3JA 3VFUA 4QHKJ 2X70B 3O6LL 2QEJA 2VLKA 4M93B 5CEXB 2DN7A 5C6TL 3HZYB 3C9NA 4JY6B 3TVMA 4EIGB 2NZ9D 5GJTL 1Q1JH 1KCSH 3R0NA 1MHHB 4LQFH 1DL7H 4OCXH 4M6OL 2UVFA 4X7SH 1H3PH 4XWGL 5EA0L 1Q9LA 3QRGL 1KJMA 1BZ9B 1F11A 4JPWH 3KYOB 4HIEB 4ZSOB 3RDTD 1CE6A 5TFSH 5KSUA 4HS6A 5E6YA 2FB4H 2VH5H 1J11A 3IU3B 3MBEC 4XI5D 4K9EL 1U92A 3CPLA 1D5ZB 4O4YL 3STZB 1QLEH 3BPOB 4MNQA 1HHJB 1MCQA 3IDJB 3A67L 3CFBB 4YHPA 1S9WB 3OV6A 1QBML 1NFDB 3VRIA 3OKYA 1J10A 2JKXA 3RWFB 1DBJL 3BKML 3GHBH 4I13B 2HJFB 3MJ7B 2HMIC 5TQ2L 3W81A 3WNPA 5I1CH 1A7OH 5IIEA 2NLJA 3LEVH 1IAKA 4IMKC 1IZJA 3CZFA 1ZGLM 5ID0B 1GRWA 2NY2D 4MVBC 3MLWL 1CVRA 1E28A 2CQVA 5MP6L 15C8H 4FZ8L 5DUBB 1H8NA 1ZEAH 2ICWB 2AEQL 3HZVB 2WP3T 3JWDL 3VXNA 5BVJB 1B3JA 2ZUUA 2EE6A 4G42A 1S7XA 4PGDB 1N0LA 3BSZH 2HH0L 5JHLL 5E7FA 3IETB 2D0GA 3T8XB 2FX7H 3PQYB 5K9OB 1RUPL 5C0IB 2DLGA 2K7QA 4R7NB 4P4RA 2MHAB 4LVHB 4BK5A 3LKOB 1HXMB 5L6YH 4KK9D 1KJVB 3FB8A 3BPNC 5J3HC 5DUPL 3F62A 3EYUL 4KZEH 4EKXA 3STZA 3PP3K 5AUMB 2Q86B 2UWEA 4LNVA 4YK4C 1RUPH 2XKSA 1HHKB 1UCTA 4X6BB 1VB9A 3CVHB 5D72L 1EGJL 5FKAA 2XTJD 4ODBD 2R56H 4ALAH 4GG6A 2YPVH 4WY7L 1A9BB 2V7NA 3CUPB 3M17B 5E7BA 4FA8A 1CTNA 3WV0A 1CXHA 2IAMC 4IOIB 3DWTA 4OFDA 4Y16B 2VR4A 3BT2L 4QRUA 4TTDD 1NAMB 3IXTB 2A0LD 5KAQF 1T1YA 5CJ8A 4PJAF 4PRHB 3VGFA 3K7UA 4UT9L 1FGNH 1HN1A 1UACL 1C5CL 5F7UA 2MHAA 4PJBF 4WFEE 4BM7A 1PDKA 4L4TE 2IH1B 3PQYA 4LIQL 4ZXBD 2R1YB 4WDIB 5SWZA 5EU3B 3EOAB 5HBBA 3CSYA 3ZT6A 3AFLA 2C7UA 2GFBB 2FJGA 2LE9A 4NRXB 1WJ3A 1X5FA 3GNML 3HC0B 3FQXA 2VLKD 3L9RA 2CDFA 5BXFA 3DETD 3RIFK 1ZTXH 4P9HL 5DD1H 3VH8A 4HJ0D 4QTIH 5I73B 3IFLL 5HDQH 5CLTA 1YYLL 5ENWA 5HHXL 2EDTA 4RMSA 5TFSL 5GRUL 2FEDC 5KANI 2V2WA 4FRWA 4OD2A 4HIXL 4YNYA 4UTAL 3QCVL 5DJ2B 1O7VA 2NYYD 1D9KB 1YNLL 2D9CA 5GJTH 1X5XA 1DDHB 4O5LH 5B8CB 1J1XL 4NP4L 5JIKA 3RFZC 4BZ1L 5IB1B 1UACH 3ZTNH 3RIAF 4W68A 3O6LH 4LCYB 4QO1A 3EJZC 3C5ZA 4PV9B 5EC1A 1UEYA 3I85A 2EYTA 2DI7A 1PG7X 3RY6C 3TFKC 4GAJL 3Q5OA 1KEML 1FVDA 4W6WB 4NN5C 5ADPL 2R9HD 5DTFA 2J88L 4BH8B 5E4IA 2DQUH 3IJYA 5KS9E 3A6BH 2B0SH 1YQVL 5B3NA 4ZOEA 4NT6B 1DN2A 1UADC 5LQBH 4DZBA 2EDLA 5K9QG 4HAFA 4TTGA 3PXHA 4OT1H 3I50H 3WO3B 4LSSL 4F2MA 1L0XA 4L8BA 5C8JB 1HI6A 3MLVL 1QSEE 1XH3A 2IFFH 2UY7A 5EC2A 2FWOA 1JK8B 3NZHH 3FFCD 1QNZL 4TOYH 3O8XC 4WV1C 1IFHL 1R5WA 4MA1B 5CINH 5EU6E 4MCZB 4CVXB 3HS0B 3ZDZE 4GQ9H 1M7IA 3HR5A 3SBWA 1KCUH 3GM0A 3NPSB 3O6FA 4I3SL 4Z7OE 3MODL 3LS5H 2J1KA 4MNHA 1U0QA 5CP7A 1TJHL 3EUUA 1ROWA 3L3DB 3MRHB 4LSQL 3QXUA 4M61A 4D2NA 1R5IA 4EI5C 4DKAA 3ULUL 1PX4A 1QSZA 3BKMH 3GHBL 1XCTB 2HAZA 3X13A 2A83B 4ONGH 2IC2A 2GT9A 5CUSH 1RUQH 5T5NG 1FGVL 4G6FB 4PJBE 3RTQA 5ILTH 5INCA 1WBYB 3PWUB 5IW6B 2W59A 1HI6B 1MCFA 4QHUB 4RWYH 2NXYB 4YDLC 2A1WL 1G7MB 1C08B 5H35B 1PZ5A 5HYQB 3WLBB 5DD3H 3VXUB 2ARWA 1NANI 4ZXBA 1YMHB 1R3IH 2H1PH 2NY3B 1W72H 3SJVA 4Z6AT 2W0PA 3EOTH 4K7PH 2IG2L 5CD3A 3WEXA 3IFNH 2B1HH 4NKOB 5T1LD 1EXUA 3DVGA 4GRWH 5CJXC 5HHME 1JN6A 3LRSA 2AV7A 1RZKC 2XTLA 3WHXB 3MLUL 2DBLH 4LPCA 1N6QH 2Q1EA 3MJGX 1JPTL 3U0TA 3DI3B 4LRNH 2ADIB 1FL6B 1YNTB 1SJEB 3BMWA 4GRLA 2JF1A 2MCPL 4KK6C 4GXUN 3QA3A 3DPBA 1A1NA 5BS0A 4S0SD 3VA2C 3BZEA 3G9VA 4GKNB 4F9LC 4FNLL 4L8SB 1JNLL 3U9PH 1WFNA 4ORGA 1FAKT 4LVNB 3VFGH 1BVKA 3IDIA 5IB4A 4R96A 4XI5C 3MBED 3DYPA 1BAFH 4XGZA 3GMNA 4DFHA 3WS3B 4CAGA 4CW1B 4JDZA 4QXUH 4G8FA 5E2WH 6FABL 2UYLB 3CMOH 1AR2A 4KRPD 4NZDA 1DUYB 5KSVA 3CLFL 1C1EH 3MUZ1 4Y5YC 3ZLQC 4XCEA 3WNOA 2YD2A 4PBVC 2GFBA 5EIIB 2W0FB 4PBXA 2W60A 3L9RB 5J12C 1SJHB 3EOAA 3MYZA 4A6YL 2BY3A 4OCSL 4LSQH 1I1FB 4HKZB 3ISWA 4GKNA 3I3EA 2D03H 5C09A 2B5IC 4U1LA 4KMTL 4YGVA 5DK0B 4OZFG 4Q9RH 1FNLA 5HVGB 2VLJE 3WHE1 1S78C 1P1ZB 1Q0YL 4NYLB 4XNXL 3QEUB 5K9OA 3DVIA 3O3UN 3T77A 1IGIH 1KJ2A 2DQFA 3F58H 2XACC 2ICEB 1SY6A 2J12B 4LARH 2VC2H 1A6WH 5CGYD 3O6FC 4AK1A 2QQNL 1CFBA 4KKAD 1P7HL 1T0MA 3MA7A 3CX5J 3KYKL 5I66A 3VWKC 2YPLE 5JQ6L 3HE7A 2ZUYA 4TNVK 2MQCA 3LS4H 4MA8H 1MHPH 1YPZB 2JJUA 1NFDF 4MNGB 3NA9L 1FYTE 3V95A 5GJSH 5ECJE 1OSZA 5EOQH 2UWEB 2F19H 2BVYA 4H5SA 4PYHA 2NX5E 4PP1C 3BQUA 3NIGE 1CU4L 3TT3L 1HXMA 4DKEL 3DX8A 2WLYA 1I3GL 2YA1A 1MFCL 1HEZB 3BXNA 1KEMH 4KQ3L 1UXSA 3TLRA 1IT9L 1T2QL 2OTPA 5A1AA 2GY5A 3FO2B 1TVBA 3H2WA 5GGQH 1QTYT 3RAJH 3UZVB 4JFOA 1W0VA 5I1GL 3L3HB 4Y5VA 3RGVA 4FTVB 4NQCB 5HI4D 3OR7A 1NC4B 4NP4H 3RRQA 2B4CC 4DVRH 4UB0H 3VXRB 5BV7H 1YNLH 4NCC1 3D2UA 3PV7A 2P5EE 3CZJA 4N0YH 5T33L 4HUKB 5EUOB 4Z78B 4HKJB 4DGVH 5E5RB 3RI5K 4JZNA 2WBJB 1JWSB 5HHXH 1A7NL 5D7JA 4N5UA 2O5YH 4X6DF 1FH5L 5FYLD 4Z0XA 3IKKA 1MI5B 1FNHA 3CPLB 4XVTL 5TGBB 1A7NH 2BC4A 3SHSA 4NUGL 4NPYB 4AM0A 1KLUB 4HWNA 4X6DE 4K3DL 2D3VA 4G8IA 1QG3A 1FO0A 1FZKB 1G1CA 4YHKL 2WIIB 5B39G 1A7QL 3IDNB 1VACA