1Y74A

Solution structure of mlin-2/mlin-7 l27 domain complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
57
structure length
57
Chain Sequence
LGLERDVSRAVELLERLQRSGELPPQKLQALQRVLQSRFCSAIREVYEQLYDTLDIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords lin 7 homolog b
publication title A unified assembly mode revealed by the structures of tetrameric L27 domain complexes formed by mLin-2/mLin-7 and Patj/Pals1 scaffold proteins.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 22
structure length 57
sequence length 57
chains with identical sequence C
ec nomenclature
pdb deposition date 2004-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.650 Mainly Alpha Orthogonal Bundle Helix Hairpins L27 domain 1y74A00
1ZL8A 1ZL8B 1Y76B 3B40A 1RSOB 1Y74A 1Y74B 1VF6C 1VF6A 1Y76A
chains in the Genus database with same CATH superfamily
4KHPO 4PJ0Z 1GKFA 1M90W 2BTQB 4X1YA 4TOIA 2OYQA 1ZWIC 3U11A 4D7TA 2DQ0A 1O9HA 4PA3A 4CS2A 4L87A 3ABKB 3T4DA 4B3TO 3UQ8A 3ABTA 2Q4PA 2IJIA 4DV1B 4DR6O 3UCSC 4UVAA 2EINC 1J5EB 2AHZA 1M93A 3SYPA 4WFEA 1WJZA 3E8BA 1AI4A 5FNVB 3VOUA 4DUYO 1AI6A 3SPJA 2R9AA 3BEHA 3LSSA 3QTCA 1JOYA 2EIJB 3B40A 2IH1C 1DLBA 3BVOA 3JASA 4JI4B 3DGEA 3ZRWB 2GUZA 2ZE7A 3NXSA 5CA1B 3JD4A 4B3MO 4IYHA 3RYIA 3CC7V 3CCRV 1HNWB 5E79Z 1H2LA 2Q69A 2WLLA 3LSUA 5A2QN 4YJ3A 3OEEG 2JEUA 4NTWA 4ZI7B 3GWOA 4LC1A 3K5NA 2DYSC 4WBNB 1SETA 2A79B 4UXNA 2V7QG 3RVYA 5KUMA 1JVMA 4J10A 1H2NA 3HPLC 1BCCH 3K58A 1RP3B 3S3XA 3JSNA 1WAZA 5IYDO 1KKDA 2DYRC 1MOFA 2NN4A 2GSMB 4DV5O 1QR8A 1OCOC 3A0RA 4DR5O 2Q9LA 3VQWA 1QVGU 4LFCB 2EIKC 2K1EA 1YCIA 2WLIA 3HKDB 1MG1A 3FD9A 4JI3O 1JFFA 4EB6B 1MSWD 3ABMB 4DR4O 1NJIW 3WG7C 2G38A 2V1DA 4FPPA 4JYAB 4XDJA 4NKGB 2HVJC 5D5QA 4UCVA 3ZN0A 3N2KB 3SPHA 2IJJA 1M56B 3WFVA 1OCZB 1WA8A 1OV9A 2Q73A 1Y6XA 3AG1C 1SZXA 2ZQMA 2JK5C 2ZNJA 2JJ2G 4GX2A 4X1IB 2DW4A 4RUFA 3T1YB 1R3KC 1YJWV 3ZHSA 5JJJB 4EEQA 5BY1A 4JAVA 5J9PC 3CJHA 4X62O 1UPGA 4FLYA 5LXTA 2X6BA 1B6QA 1U96A 4X8AA 3ZN1A 1QU7A 3THOA 2ZNIA 2JJ1G 2WLHA 2ZINA 1ORQC 5EIBD 3K08A 2PYJA 5H2FZ 1V54B 4IT5A 3BHPA 3ZMTA 5J2UB 2OTJV 5CBFA 4BAYA 1N0JA 5IYZB 3F7YC 4DRXB 1G6UA 4YHHB 2CGNA 4KXRA 1ZX3A 3ETQA 2Y0PA 2GBOA 1R3LC 4O4IA 2P90A 2VWKA 3ICXA 1M5IA 3QVNA 1MMMA 1AR5A 3ABLB 3L75H 1N4CA 2EJRA 4MTFA 4LFCO 3L74H 4LF7B 3FAVB 2CK3G 2ZXWB 3CRAA 3TXSA 2Y69C 1SQBH 1R6NA 3P30A 3CCMV 3MHHC 2AZ0A 2ZM6B 1FYJA 2HVKC 3CRMA 4BWAA 4DV4B 2ARHA 4I4TA 2X6AA 1AILA 1SESA 4JV5B 2GTSA 1E1RG 2KG7A 5GTHZ 4MTGA 3B8NA 5CN0A 2AHYA 1QCEA 4R6ZA 4CZZA 1L8DA 2YUAA 3RFRA 2HLDG 1JCHA 1KC8W 1J95A 3UM7A 2ZKOA 2A9HA 4IIJB 3FYEB 1TAEA 2RQ6A 1XEQA 2WSSG 2X0LA 3ASNB 1ZL8B 1YF2A 5ITZB 1M9NA 1FXKC 4R50A 3T1YO 3E22B 3CB2A 4F6RB 4DV2B 5HFMA 5H6QA 5KMGA 2WLNA 3RVZA 3RWRD 2ZR2A 5IE9A 4R7CA 3ZHRA 3OM3B 5LP6C 3IC9A 2P22C 2CDYA 2F1MA 4X20A 5B1AC 3TETA 2XHBA 3I5DA 3MAQA 5KA5A 3EFFK 5JVDA 2HR3A 1OCCB 3JD1A 3OGCC 2UXBB 2X6CA 3JAKA 3VQVA 2DYSB 1W0KG 4UCOA 4CH4A 4FLUA 3OGIB 4JYYA 2EZOA 4I9WA 3SYCA 4J11A 1B06A 3LNMB 1YDXA 4O2AB 5EZYB 1MZEA 3OEHG 1I08A 5L3DA 1Q7YW 4P9OA 3JALB 2VWJA 1CXZB 2P67A 1QNMA 1OCOB 3E8FA 1Q86W 4LWSB 4JI5O 2M6YA 5GONB 3A2FA 2LGWA 4MVMA 4YIPA 3U10A 5LOVB 1OZ0A 2AXTZ 2PGGA 3WG7B 4OX9B 4UV8A 1I7FA 3RYCA 4DUZB 4WCEV 4ICGA 4CH6A 2ZM6O 4LNUB 1BQ0A 1CP9A 2QE7G 1SQVH 1RSOA 4LF8B 2VRZA 1VQOV 3ABKC 1SZTA 3AG1B 1PNMA 5FL7G 3FYIB 2XT9A 3Q4HA 1GH6A 2YXLA 5BMVA 1F4NA 4DW1A 2E5LB 4JI0B 4RO2A 5EYPB 5A9GA 1WB8A 1URFA 1TVKA 1WB7A 1NH2B 3ZS8C 3WB1A 2H3OA 1ZLZA 1ENVA 3BABA 3K0GA 2VQFB 2ZCEA 4UCTA 3K59A 4DV2O 1FD9A 5LHIA 1PP9H 3ETGA 1NVPB 1Y76B 3K06A 3A8TA 3SJBC 2YIAA 1TUEB 1F7YA 1XMQB 1OHHG 1NR7A 2UXDO 2H8PC 1P7GA 3IFXA 2Z3YA 3WU2Z 3FB5C 4OPHA 1XOUA 5KHHA 2YS8A 4X89A 2XAGA 3I55V 5GTIZ 1N34O 2UUBB 4FJCC 3CE2A 3LSQA 1H38A 3CPWU 2UXBO 1CPYA 3EXAA 5IJ0A 4XBFA 1V9PA 4CS4A 4LFAB 2F66C 4X64B 4P2ZA 2Y48A 1E79G 5LGNA 3GWKC 3SJQC 4WFBV 4MSWC 2L6LA 2Q7HA 3P3NA 4TQFA 2BOCC 1BSMA 1TUBB 1MABG 1KECA 2JS5A 4ZBMA 5LL6Y 3CMEV 1K8AW 1QLEC 2CTWA 3BRCA 4I7ZB 2ODMA 4UCUA 4JI1O 5L3BA 5BR8O 4KHPB 1B04A 4FZ0A 1X59A 5JJNB 1K4CC 4DK1A 4J42A 2OIGA 2WA4A 5CA3A 1GN4A 2WA3A 4B3TB 2E74B 4CS3A 2YEVA 1OCZC 1I94O 3U0ZA 1XL4A 3G80A 4NXMO 1GRJA 4DR6B 4X9QA 4FFBA 1H2KA 1FFXA 4UVCA 3JARA 3G4SV 3ZMVA 3ZHVA 4DUYB 1IDSA 1MNGA 3LDDA 1YITV 5CB4B 1IXMA 3DXRA 2WLMA 1Z5VA 4J7KA 2VQFO 2Y4TA 1NKDA 1SA0A 2DWDC 3QO5A 4NYKA 5EC2C 2GTAA 1FXVA 4B3MB 1NTZH 4GX1A 4PA4A 2ZDIA 3HKEB 4IHJA 3BA8A 1OJHA 1FXKA 1XMQO 3RYHB 3B2EE 2F4VB 3H1JH 1BL8A 1GTOA 1VQNV 1DF5A 4I0XA 2UUBO 1GN2A 5LP6A 2JGUA 1LUWA 3UT5A 4Z1MG 1V54C 5LYJB 1ZUQA 4K0KB 4X64O 1XNRO 4MVOA 2CTPA 4I50A 3F7VC 2XAHA 4B08A 3SR2C 4PDMA 5K1XA 3T1HB 4PDLA 3P3PA 5J2TB 4DV5B 1PNLA 3S3WA 1BGYH 5JJEB 2JGDA 4DR5B 1US6A 2QTOA 4MVUA 2JDIG 4HZ3A 3PN1A 5KHKA 3H1LH 4BIUA 4DR4B 1N36O 2ETNA 4RWUA 2CH7B 4JTDB 3JATB 4DR7O 4LBEC 4X1YB 1GM9A 4GX0A 1XUQA 2ITDC 3L9DA 3OTOB 1S5JA 2LGQA 4W4KA 2ZE8A 2PI4A 1VMGA 5H9CA 1K73W 3KKYA 1NBMG 1TGOA 1Y74A 4PI2A 2GHYA 4UCSA 3A0BZ 2W6JG 2BTQA 4AILC 1KUQA 3ASNC 3L72H 3JYCA 3CRQA 1S5HC 2DMXA 1A32A 5BXZA 3FB6C 4X62B 2GUZB 1I5XA 4JTCB 3A0HZ 3RYIB 3IJ4A 1K5SA 4NTYA 5FNVA 3STZC 1P49A 1DK1A 4OXSA 2JEXA 4YY3O 2QA4V 2ILMA 1OCCC 2F4VO 3H9VA 2QWPB 2JS3A 3ZRWA 3AK3A 1IBLO 2X7RB 3RYFB 5JH7B 5CA1A 4LF9B 3DSQA 1XBLA 4UFZA 3FB7C 3OAAG 2C2AA 1NU1H 4PHZA 3J81N 1SS3A 4K0KO 5B5EZ 3CHXA 2A06H 3T4ZA 1FKAO 4WFAV 1X4TA 1VQLV 2BCCH 3T1HO 5DN6G 4QJFB 3M8AA 4X88A 1AI7A 3RGBA 2FKXA 4WBNA 1B3QA 4HBNA 3X2QC 5FLXN 4QPJA 1THZA 5L3EA 2LW7A 1QLEB 2Q6AA 4KL1A 1JFFB 3GB7C 2UXCO 3OW2U 2EZPA 1Z2GA 1GAXA 2YC0A 1HW7A 1BHBA 1Z5WA 3CC2V 4LF5O 2DOSA 1TA8A 2KQXA 4GZRB 4J41A 2OCCC 5IWAO 3OTOO 2M7WA 3HKDA 3E8HA 3L71H 4G27B 2GV9A 1HP8A 4QNHB 4NB5A 1AB3A 1BQZA 4IL6Z 1AP6A 2ZD9A 2QJ1A 3N2KA 4AHCA 2Q0AA 4CBCA 1KP2A 3DTUB 3ZHTA 5JCOC 1QQCA 4LH7A 1MSDA 4QIWF 2BTOA 4MVSA 1IURA 1R1BA 2EJ7A 3JSLA 1FXHA 2AGAA 5KA6A 3QNEA 1Y67A 2NLJC 4O2BB 4PELA 1K97A 5KX5A 3BA9A 5AG2A 1UJWB 1VF6A 4DV6O 2WPDG 3CS5A 2UUAO 5LA6B 3AK1A 1PL0A 4LF9O 1QBZA 1VQ9V 4BW9A 4UUJC 5IT9N 1Y4MA 2QDOA 4TV9B 2XAFA 4X66B 3AEIA 3OMNB 4CH3A 3D36C 3E2EA 5EC1C 3KG2A 1G8MA 2FMLA 3ZHQA 4JI5B 2BE3A 2PYLA 4TUYB 4KP4A 3VQXA 5J2UA 4MT8A 2ZIOA 3F5TA 2FL4A 3SYQA 4EFEA 1AVMA 2DWEC 4J7ZA 4DRXA 2CAZC 4ZHQB 3VBBA 4O4HB 3HR0A 1GM7A 3KCYA 1GM8A 3K9SA 1G1XB 1XNQO 4UB6Z 1D2DA 3K03A 2QWRB 5IYCO 3JAWB 3AG2B 4JGSA 3FAVA 3CD6V 2HP8A 1P7BA 2KKWA 2QM4A 1FS0G 3FKSG 1S77D 5KAFZ 1EN4A 4ASUG 3CP1A 2EIMB 2LFRA 4B3SO 1N32B 2GDSA 5JQGB 5KMGB 1KU9A 3OR6C 3K5MA 3TCUA 1PL4A 4FZ1A 1EN5A 2YXHA 2LFSA 1Q81W 3NR7A 1VQ6V 4L8JA 3QG5A 4H37A 3C3SA 3M99B 4DXWA 2UXDB 1AJPA 4IIJA 3D8CA 1Q5OA 5C8YB 3B09A 4PI0A 1D5AA 3BY6A 5ITZA 1SQPH 4F6RA 4JI8B 1N34B 2L35A 2KSDA 2WLKA 1YXBA 4LCUC 1DGSA 3ZMZA 2Z0AA 2QKAA 4HAMA 4DV7O 2OT5A 1AP5A 3PJSK 2QGNA 1PD3A 2AW9A 4N23A 4RUEA 1JQ0A 3G71V 2P06A 2YI8A 4PA6A 4X66O 2Q7EA 3JD2A 3LDEA 5GW7A 2FTKA 3X2QB 3B8MA 3F5WC 1PKXA 1AR1B 5EBMC 5DEDA 2P7TC 4JI1B 2ADQB 4O2AA 3K57A 5EZYA 4CH5A 2F93B 3K3WA 5BR8B 1IBKO 2ZT9B 3O9OA 1YI2V 3HKBA 3ABUA 1KBHA 3JALA 1GO3F 2CGOA 3DC5A 4U7OA 1MA1A 1AJQA 3N2GB 4MVZA 4U3JA 2E75B 1I94B 2P6JA 4LWSA 4NVPA 5FPRA 4NXMB 2OCCB 1VQ7V 3ETEA 2OCHA 4O4JA 4UV9A 5LOVA 3OD4A 5BMVB 3QO8A 3APQA 3BFRA 4HNAB 3MDSA 1SQXH 4RQEA 1RPOA 1TVKB 4TV8A 4DV0B 1WLEA 4LNUA 1BZKA 3KZIZ 4FM2A 1N32O 2N04A 1QHTA 4YIOA 1NH2D 4GKJO 4LF4B 4JZGA 3CSXA 1IBMO 4E2LA 4J7JA 4O4LA 1S72V 1NS1A 5EYPA 4CC5A 2PI5A 1GN3A 2HJFC 1NVPD 4DV3O 3K04A 5KAIZ 2YSUB 4FK5C 3OUFA 4JI2O 4ZIBA 4JI8O 2UU9B 2ZE5A 3CWBH 4GCZA 4BIZA 1HNXO 3ASOB 5CA0A 4K3AA 4JAAA 1Y76A 4JAUA 5KLVH 1Q3EA 5H6RA 3LUTB 4J9YB 4X65O 1XNRB 1SKVA 3C90A 1QVFU 1YEWA 4C7UA 4DR2O 3R65A 4LH6A 4QE9A 5LGTA 1P4RA 2FYUH 3ZHUA 2LJ2A 1L0NH 3BCCH 2UUCO 1EM1A 4Z2WA 4H13B 4BIOA 1WPBA 3IGAC 2IBZH 3QO7A 1Y66A 1K9MW 4YJ2B 3VQYA 1AI5A 4Q6GA 1XDCA 2Q68A 3W7WA 3CCLV 4GLXA 4FFKA 1N36B 2JRIA 2LO1A 2Z5UA 2HHHO 3D36A 2E76B 2B1GA 4DR7B 4K8XA 1TUBA 1KB9F 1Q6UA 3D3QA 3ZRSA 1W0JG 3OUSA 3CCEV 4FLTA 4MVRA 4X1KA 4MTOA 4FM1A 1YTFD 2DE0X 1GN6A 3MD0A 3MHSC 5IDJA 4GYCB 1DF4A 4I55B 3OMIB 5L3CA 4JASA 4N21A 1M4UA 1YVWA 2OTLV 5FPOA 4FLVA 2ZR3A 4XDKA 4DW0A 4DR3O 3ZBHA 4DV0O 1M57C 1YZBA 1K3EA 4PDVA 1W59A 4JF3A 2B5UA 4ZOLB 1ROPA 2MW2B 4JYCA 4LF4O 3ZX6A 4EFBA 3JAMN 3HKCB 1R3IC 5IJ9B 4AQYB 4YY3B 1JA8A 5CB4A 3CRRA 2NNUA 1HR0O 3L73H 2ZIMA 1IBLB 2EULA 5B1NA 3OE7G 1S76D 2UU9O 2HKOA 3E8GA 2N05A 3D3IA 3HKEA 4PD4F 3IAYA 3K5OA 1FAFA 1LR1A 3RYHA 3TJTA 1JJ2U 2ADPA 1JX9A 2BSKB 1VQ5V 1T5EA 4TT3G 1PPJH 4Z1VA 4AI8A 1S5LZ 3K9AA 3W7TA 5LYJA 4R8CA 1LNQA 5LGUA 1HNZO 2P5OA 4JYBA 5EBLC 2UXCB 4K8ZA 1XI1A 2A3QA 1Q90D 1GMGA 1EZVH 5IY5B 2QWQB 3OT7A 3ZJZA 4LF5B 4LF6O 3CMAV 5J2TA 1PV0A 4CC6A 4FLWA 5CBGA 4JI7O 5LHGA 1WNSA 1H2SB 5IWAB 4JI6O 2Y4UA 4I9QA 3CCJV 1D5NA 4UCRA 3AG2C 2CH7A 3JATA 4U7NA 2KB1A 1GK9A 4P30A 2QWNB 1JJOA 2DJVA 2EIMC 3P32A 3CCVV 3DC6A 3SYOA 5BZBA 4B3RB 2ITCC 3JASB 4TWKA 3ZIAG 2BOBC 3AG7A 1F4MA 2YI9A 4PA9A 2P4VA 2W6IG 1XHZA 2WLLB 4AQYO 1VQKV 4IGGA 2LP7A 1BS3A 2EX3A 4P9PA 4YJ3B 4DV6B 3J80N 3CYOA 2UUAB 1M1KW 1E1QG 3AK2A 4F4LA 1YHQV 4A5UB 2EILC 4GT1A 1NT2B 3JD3A 3J7AU 5DECA 2IJHA 2RNBA 5H5NA 1EN6A 3B77A 4DYLA 4ZI7A 2YICA 4GX5A 2XTAA 4QPKA 1FPOA 3E83A 1WN7A 1OCRB 3RYFA 5JH7A 2NR5A 1H8HG 1RPRA 3T2MA 5LMNO 2WLIB 3SPCA 4DR1B 4WFFA 3RBZA 1F51A 3TK1A 4E4EA 4GKKB 2HEPA 4F6EA 1XNQB 1WA8B 2XASA 2UXNA 1VEWA 4NTXA 1KQSU 1H2GA 4NXNB 4ZKIA 4FM0A 5LBQA 1V55C 3ZMSA 4FIPC 1Q8IA 4RAIA 1VQPV 4EB6A 5IYBO 5LMUB 1QR9A 4B3SB 4G28B 1M57B 3AG3B 5KHGA 2JVDA 5D5PA 1RM1C 2YIBD 4B3RO 1XL6A 1CEZA 1AR4A 3CJHB 3TGUH 2R70A 1H2MA 4DV1O 5E1AC 1VF7A 2RJZA 5LXTB 1J5EO 1XHXA 3GVMA 1I5YA 4X1IA 1MZFA 4ABMA 4BR6A 1VQMV 2YIBA 5KX5B 1N33B 2QR4A 2XNDG 3UKMA 1N0NA 1RFYA 2JIZG 2N74A 4DV7B 2YXYA 4I5SA 1N8RW 2LQTA 3ZRXA 3B4SA 1VP7A 2AZ2A 2QM7A 1YIJV 4JI4O 1YJ9V 4MW3A 3ASOC 2RN9A 2WAMA 2W0XA 2RCVA 1G4YB 4DK0A 5EBWC 4FMTA 3L70H 1HNWO 1NQTA 2A7WA 4O2BA 2PZSA 1Q6IA 3EHBB 3OR7C 3WB2A 1P84F 2D3OW 1JMKC 5B3SC 2D2CB 4JTAB 3CX5F 2XAQA 5DM6V 4IYIA 4XDLA 5LA6A 4O4IB 2XAJA 2WWWA 4QE7A 2DQ3A 2RDCA 1K5QA 4TSFG 1IBKB 4TV9A 4DR1O 5IYZA 4GUNA 3AG4B 1UFIA 2HFEC 1JR9A 3CC4V 1KYOF 4GKKO 2EBOA 4K35A 1BT8A 4J9ZB 1K4DC 4I4TB 1QLNA 4TUYA 2QKSA 2KG7B 4U3FH 1U97A 1BE3H 3SYAA 4B7KA 4NXNO 3ZEDA 1SF9A 4ZHQA 1S0VA 3TXQA 2MK3A 1Q43A 3BAAA 4O4HA 3I56V 5LMUO 3FFQA 4JYAO 5L3FA 4GKJB 2F23A 2YDEA 3G6EV 3JAWA 1IBMB 3SDLA 2EINB 2B1IA 3OFNG 3SPGA 1R6TA 2IJKA 1SC5B 4BW5A 2LW1A 2ZDIC 4X20B 4DV3B 2PUSA 1ZL8A 5JVDB 4JI2B 3E22A 4MVQA 3CXHF 5B66Z 5JQGA 1Q82W 1N33O 4HYOA 3JAKB 1HNXB 5F2VO 3O65A 3R66A 1AROP 4X65B 2XUMA 1K7DA 3EVKA 4DR2B 5C8YA 4LR3A 2EILB 3RW0A 3FB8C 2UUCB 4FVMA 2PF4E 1YSCA 4YXWG 2IM9A 4WFGA 5LHHA 3RN4A 4UB8Z 4TQDA 2CE4A 2CUGA 3CCUV 3HB3B 3ETDA 1H8EG 1NTKH 1COWG 3E35A 4FLZA 1FJGB 2R9RB 2WLJA 2HJDA 4H0LB 2ATKC 3UO3A 2QM8A 2HHHB 5HFLA 1YJNV 3HKBB 2CTRA 4EKWA 1NR1A 2DN9A 2DYRB 3K79A 1VF5B 3RYCB 4B7EA 5IY5C 2VS0A 1K33A 1IXBA 2QKCA 4YHHO 4U3JB 4PV1B 2A0LA 3CEIA 4OGQB 1VIBA 3W7SA 2EIKB 4DO2A 2OWOA 5GONA 4FLXA 1RSOB 5B1BC 3CRCA 3K5LA 3JCUZ 1IX9A 1NZ6A 1BHAA 4O4JB 1ZSPA 1V55B 4LF7O 4JZ2A 3Q4HB 5EK0A 2UXXA 4WF9V 2XOKG 3FX7A 4QGPA 4TV8B 4DR3B 1XMOB 1AJNA 1SRYA 3N2GA 3H1KH 1S3JA 1R73A 4DV4O 1RM1B 4LFBB 4G2KA 1VQ8V 4JV5O 1EFRG 3LDCA 3N27A 3JCZA 1R3JC 1DTOA 2K9PA 2H94A 3BPZA 4O4LB 4HNAA 2ZE6A 2YIDA 1I0HA 4LP8A 4MTXA 3SJCC 5L3GA 3RT3C 3E86A 1HR0B 1K34A 1HDJA 1W2BU 2EIJC 5JCOA 3SGIA 1SQGA 2OIEA 1LUVA 5CA0B 1ZAUA 2Q67A 5IJ0B 4RQFA 2QSAA 2R72A 1KMIZ 3G6BA 1SQFA 2Q5ZA 1VQ4V 3SJAC 1VARA 5B3SB 2O57A 5K1PA 2QWOB 2IH3C 1K92A 3CCQV 2IW5A 1EBOA 2RMKB 1FFTB 3WB0A 4JPRA 1XILA 3ZMUA 1HNZB 4OPAA 1WP8A 1OCRC 3STLC 2VQEB 2QEXV 1FJGO 3UO2A 3QF7A 3H1HH 1XQ8A 2IU0A 1SQQH 4LF6B 1IVSA 3K0DA 1O9GA 4JI7B 1PM9A 3G67A 4MS2A 4NR1A 4WFHA 4YJ2A 4JI6B 1JPXA 4X1KB 3ML0A 2YEVB 3H01A 5KHIA 4FFBB 1FFXB 2Y69B 4H44B 3JARB 5TISZ 4KFMA 3ABMC 2Q0OC 4OX9O 3LNNA 1YTFB 4DUZO 1XMOO 1BMFG 4UVBA 3C3TA 3OTFA 1M56C 2W0FC 3AG3C 3DXRB 1L0LH 1KD1W 5KUKA 4LF8O 4LFBO 1SA0B 3M7MX 4I55A 3JD0A 1L1FA 1Q6HA 3H1IH 4MW8A 4IHJB 2E5LO 4JI0O 2P4KA 5CMUA 3IC7A 3OMAB 4J80A 3T1CA 1FXKB 3W7UA 4ZOLA 4PA7A 5CBHA 1KP3A 2E3CA 4I0XB 3ZRVA 5LP6B 3CCSV 1VF6C 1ZTEA 1NTMH 3UT5B 3E89A 1SERA 2F43G 4W4LA 5B1AB 3HKCA 5IJ9A 2HG5C 2IU3A 5EIBC 4I50B 2V4DA 1EZJA 4H33A 5KHJA 2PTMA 2FB5A 5B1OA 4D6TH 3APOA 3SPIA 2JGDB 2R9IA 5LMNB 4LFAO 3W7XA 1PNKA 1R6KA 3ZCCA 5C93A 2VQEO 1IZ3A 2BSKA 5JWPA 2Q7GA 3AG4C 2PY5A 1F23A 1NI8A 1HWYA 1XREA 4Q20A 1WP7A 3KCXA 2QTSA 3CXCU 2F95B 5B1BB 2B9ZA 1KKCA 4PDRA 4D7SA 4JI3B 3ABLC 1WPXA 2Y0IA 1Y74B 4KUMA 2CTQA 2Q8VA 2ZXWC
chains in the Genus database with same CATH topology
1ZL8A 1ZL8B 1Y76B 3B40A 1RSOB 1Y74A 1Y74B 1VF6C 1VF6A 1Y76A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZL8 A;  1ZL8 B;  1Y76 B;  3B40 A;  1RSO B;  1Y74 A;  1Y74 B;  1VF6 C;  1VF6 A;  1Y76 A; 
#chains in the Genus database with same CATH topology
 4KHP O;  4PJ0 Z;  1GKF A;  1M90 W;  2BTQ B;  4X1Y A;  4TOI A;  2OYQ A;  1ZWI C;  3U11 A;  4D7T A;  2DQ0 A;  1O9H A;  4PA3 A;  4CS2 A;  4L87 A;  3ABK B;  3T4D A;  4B3T O;  3UQ8 A;  3ABT A;  2Q4P A;  2IJI A;  4DV1 B;  4DR6 O;  3UCS C;  4UVA A;  2EIN C;  1J5E B;  2AHZ A;  1M93 A;  3SYP A;  4WFE A;  1WJZ A;  3E8B A;  1AI4 A;  5FNV B;  3VOU A;  4DUY O;  1AI6 A;  3SPJ A;  2R9A A;  3BEH A;  3LSS A;  3QTC A;  1JOY A;  2EIJ B;  3B40 A;  2IH1 C;  1DLB A;  3BVO A;  3JAS A;  4JI4 B;  3DGE A;  3ZRW B;  2GUZ A;  2ZE7 A;  3NXS A;  5CA1 B;  3JD4 A;  4B3M O;  4IYH A;  3RYI A;  3CC7 V;  3CCR V;  1HNW B;  5E79 Z;  1H2L A;  2Q69 A;  2WLL A;  3LSU A;  5A2Q N;  4YJ3 A;  3OEE G;  2JEU A;  4NTW A;  4ZI7 B;  3GWO A;  4LC1 A;  3K5N A;  2DYS C;  4WBN B;  1SET A;  2A79 B;  4UXN A;  2V7Q G;  3RVY A;  5KUM A;  1JVM A;  4J10 A;  1H2N A;  3HPL C;  1BCC H;  3K58 A;  1RP3 B;  3S3X A;  3JSN A;  1WAZ A;  5IYD O;  1KKD A;  2DYR C;  1MOF A;  2NN4 A;  2GSM B;  4DV5 O;  1QR8 A;  1OCO C;  3A0R A;  4DR5 O;  2Q9L A;  3VQW A;  1QVG U;  4LFC B;  2EIK C;  2K1E A;  1YCI A;  2WLI A;  3HKD B;  1MG1 A;  3FD9 A;  4JI3 O;  1JFF A;  4EB6 B;  1MSW D;  3ABM B;  4DR4 O;  1NJI W;  3WG7 C;  2G38 A;  2V1D A;  4FPP A;  4JYA B;  4XDJ A;  4NKG B;  2HVJ C;  5D5Q A;  4UCV A;  3ZN0 A;  3N2K B;  3SPH A;  2IJJ A;  1M56 B;  3WFV A;  1OCZ B;  1WA8 A;  1OV9 A;  2Q73 A;  1Y6X A;  3AG1 C;  1SZX A;  2ZQM A;  2JK5 C;  2ZNJ A;  2JJ2 G;  4GX2 A;  4X1I B;  2DW4 A;  4RUF A;  3T1Y B;  1R3K C;  1YJW V;  3ZHS A;  5JJJ B;  4EEQ A;  5BY1 A;  4JAV A;  5J9P C;  3CJH A;  4X62 O;  1UPG A;  4FLY A;  5LXT A;  2X6B A;  1B6Q A;  1U96 A;  4X8A A;  3ZN1 A;  1QU7 A;  3THO A;  2ZNI A;  2JJ1 G;  2WLH A;  2ZIN A;  1ORQ C;  5EIB D;  3K08 A;  2PYJ A;  5H2F Z;  1V54 B;  4IT5 A;  3BHP A;  3ZMT A;  5J2U B;  2OTJ V;  5CBF A;  4BAY A;  1N0J A;  5IYZ B;  3F7Y C;  4DRX B;  1G6U A;  4YHH B;  2CGN A;  4KXR A;  1ZX3 A;  3ETQ A;  2Y0P A;  2GBO A;  1R3L C;  4O4I A;  2P90 A;  2VWK A;  3ICX A;  1M5I A;  3QVN A;  1MMM A;  1AR5 A;  3ABL B;  3L75 H;  1N4C A;  2EJR A;  4MTF A;  4LFC O;  3L74 H;  4LF7 B;  3FAV B;  2CK3 G;  2ZXW B;  3CRA A;  3TXS A;  2Y69 C;  1SQB H;  1R6N A;  3P30 A;  3CCM V;  3MHH C;  2AZ0 A;  2ZM6 B;  1FYJ A;  2HVK C;  3CRM A;  4BWA A;  4DV4 B;  2ARH A;  4I4T A;  2X6A A;  1AIL A;  1SES A;  4JV5 B;  2GTS A;  1E1R G;  2KG7 A;  5GTH Z;  4MTG A;  3B8N A;  5CN0 A;  2AHY A;  1QCE A;  4R6Z A;  4CZZ A;  1L8D A;  2YUA A;  3RFR A;  2HLD G;  1JCH A;  1KC8 W;  1J95 A;  3UM7 A;  2ZKO A;  2A9H A;  4IIJ B;  3FYE B;  1TAE A;  2RQ6 A;  1XEQ A;  2WSS G;  2X0L A;  3ASN B;  1ZL8 B;  1YF2 A;  5ITZ B;  1M9N A;  1FXK C;  4R50 A;  3T1Y O;  3E22 B;  3CB2 A;  4F6R B;  4DV2 B;  5HFM A;  5H6Q A;  5KMG A;  2WLN A;  3RVZ A;  3RWR D;  2ZR2 A;  5IE9 A;  4R7C A;  3ZHR A;  3OM3 B;  5LP6 C;  3IC9 A;  2P22 C;  2CDY A;  2F1M A;  4X20 A;  5B1A C;  3TET A;  2XHB A;  3I5D A;  3MAQ A;  5KA5 A;  3EFF K;  5JVD A;  2HR3 A;  1OCC B;  3JD1 A;  3OGC C;  2UXB B;  2X6C A;  3JAK A;  3VQV A;  2DYS B;  1W0K G;  4UCO A;  4CH4 A;  4FLU A;  3OGI B;  4JYY A;  2EZO A;  4I9W A;  3SYC A;  4J11 A;  1B06 A;  3LNM B;  1YDX A;  4O2A B;  5EZY B;  1MZE A;  3OEH G;  1I08 A;  5L3D A;  1Q7Y W;  4P9O A;  3JAL B;  2VWJ A;  1CXZ B;  2P67 A;  1QNM A;  1OCO B;  3E8F A;  1Q86 W;  4LWS B;  4JI5 O;  2M6Y A;  5GON B;  3A2F A;  2LGW A;  4MVM A;  4YIP A;  3U10 A;  5LOV B;  1OZ0 A;  2AXT Z;  2PGG A;  3WG7 B;  4OX9 B;  4UV8 A;  1I7F A;  3RYC A;  4DUZ B;  4WCE V;  4ICG A;  4CH6 A;  2ZM6 O;  4LNU B;  1BQ0 A;  1CP9 A;  2QE7 G;  1SQV H;  1RSO A;  4LF8 B;  2VRZ A;  1VQO V;  3ABK C;  1SZT A;  3AG1 B;  1PNM A;  5FL7 G;  3FYI B;  2XT9 A;  3Q4H A;  1GH6 A;  2YXL A;  5BMV A;  1F4N A;  4DW1 A;  2E5L B;  4JI0 B;  4RO2 A;  5EYP B;  5A9G A;  1WB8 A;  1URF A;  1TVK A;  1WB7 A;  1NH2 B;  3ZS8 C;  3WB1 A;  2H3O A;  1ZLZ A;  1ENV A;  3BAB A;  3K0G A;  2VQF B;  2ZCE A;  4UCT A;  3K59 A;  4DV2 O;  1FD9 A;  5LHI A;  1PP9 H;  3ETG A;  1NVP B;  1Y76 B;  3K06 A;  3A8T A;  3SJB C;  2YIA A;  1TUE B;  1F7Y A;  1XMQ B;  1OHH G;  1NR7 A;  2UXD O;  2H8P C;  1P7G A;  3IFX A;  2Z3Y A;  3WU2 Z;  3FB5 C;  4OPH A;  1XOU A;  5KHH A;  2YS8 A;  4X89 A;  2XAG A;  3I55 V;  5GTI Z;  1N34 O;  2UUB B;  4FJC C;  3CE2 A;  3LSQ A;  1H38 A;  3CPW U;  2UXB O;  1CPY A;  3EXA A;  5IJ0 A;  4XBF A;  1V9P A;  4CS4 A;  4LFA B;  2F66 C;  4X64 B;  4P2Z A;  2Y48 A;  1E79 G;  5LGN A;  3GWK C;  3SJQ C;  4WFB V;  4MSW C;  2L6L A;  2Q7H A;  3P3N A;  4TQF A;  2BOC C;  1BSM A;  1TUB B;  1MAB G;  1KEC A;  2JS5 A;  4ZBM A;  5LL6 Y;  3CME V;  1K8A W;  1QLE C;  2CTW A;  3BRC A;  4I7Z B;  2ODM A;  4UCU A;  4JI1 O;  5L3B A;  5BR8 O;  4KHP B;  1B04 A;  4FZ0 A;  1X59 A;  5JJN B;  1K4C C;  4DK1 A;  4J42 A;  2OIG A;  2WA4 A;  5CA3 A;  1GN4 A;  2WA3 A;  4B3T B;  2E74 B;  4CS3 A;  2YEV A;  1OCZ C;  1I94 O;  3U0Z A;  1XL4 A;  3G80 A;  4NXM O;  1GRJ A;  4DR6 B;  4X9Q A;  4FFB A;  1H2K A;  1FFX A;  4UVC A;  3JAR A;  3G4S V;  3ZMV A;  3ZHV A;  4DUY B;  1IDS A;  1MNG A;  3LDD A;  1YIT V;  5CB4 B;  1IXM A;  3DXR A;  2WLM A;  1Z5V A;  4J7K A;  2VQF O;  2Y4T A;  1NKD A;  1SA0 A;  2DWD C;  3QO5 A;  4NYK A;  5EC2 C;  2GTA A;  1FXV A;  4B3M B;  1NTZ H;  4GX1 A;  4PA4 A;  2ZDI A;  3HKE B;  4IHJ A;  3BA8 A;  1OJH A;  1FXK A;  1XMQ O;  3RYH B;  3B2E E;  2F4V B;  3H1J H;  1BL8 A;  1GTO A;  1VQN V;  1DF5 A;  4I0X A;  2UUB O;  1GN2 A;  5LP6 A;  2JGU A;  1LUW A;  3UT5 A;  4Z1M G;  1V54 C;  5LYJ B;  1ZUQ A;  4K0K B;  4X64 O;  1XNR O;  4MVO A;  2CTP A;  4I50 A;  3F7V C;  2XAH A;  4B08 A;  3SR2 C;  4PDM A;  5K1X A;  3T1H B;  4PDL A;  3P3P A;  5J2T B;  4DV5 B;  1PNL A;  3S3W A;  1BGY H;  5JJE B;  2JGD A;  4DR5 B;  1US6 A;  2QTO A;  4MVU A;  2JDI G;  4HZ3 A;  3PN1 A;  5KHK A;  3H1L H;  4BIU A;  4DR4 B;  1N36 O;  2ETN A;  4RWU A;  2CH7 B;  4JTD B;  3JAT B;  4DR7 O;  4LBE C;  4X1Y B;  1GM9 A;  4GX0 A;  1XUQ A;  2ITD C;  3L9D A;  3OTO B;  1S5J A;  2LGQ A;  4W4K A;  2ZE8 A;  2PI4 A;  1VMG A;  5H9C A;  1K73 W;  3KKY A;  1NBM G;  1TGO A;  1Y74 A;  4PI2 A;  2GHY A;  4UCS A;  3A0B Z;  2W6J G;  2BTQ A;  4AIL C;  1KUQ A;  3ASN C;  3L72 H;  3JYC A;  3CRQ A;  1S5H C;  2DMX A;  1A32 A;  5BXZ A;  3FB6 C;  4X62 B;  2GUZ B;  1I5X A;  4JTC B;  3A0H Z;  3RYI B;  3IJ4 A;  1K5S A;  4NTY A;  5FNV A;  3STZ C;  1P49 A;  1DK1 A;  4OXS A;  2JEX A;  4YY3 O;  2QA4 V;  2ILM A;  1OCC C;  2F4V O;  3H9V A;  2QWP B;  2JS3 A;  3ZRW A;  3AK3 A;  1IBL O;  2X7R B;  3RYF B;  5JH7 B;  5CA1 A;  4LF9 B;  3DSQ A;  1XBL A;  4UFZ A;  3FB7 C;  3OAA G;  2C2A A;  1NU1 H;  4PHZ A;  3J81 N;  1SS3 A;  4K0K O;  5B5E Z;  3CHX A;  2A06 H;  3T4Z A;  1FKA O;  4WFA V;  1X4T A;  1VQL V;  2BCC H;  3T1H O;  5DN6 G;  4QJF B;  3M8A A;  4X88 A;  1AI7 A;  3RGB A;  2FKX A;  4WBN A;  1B3Q A;  4HBN A;  3X2Q C;  5FLX N;  4QPJ A;  1THZ A;  5L3E A;  2LW7 A;  1QLE B;  2Q6A A;  4KL1 A;  1JFF B;  3GB7 C;  2UXC O;  3OW2 U;  2EZP A;  1Z2G A;  1GAX A;  2YC0 A;  1HW7 A;  1BHB A;  1Z5W A;  3CC2 V;  4LF5 O;  2DOS A;  1TA8 A;  2KQX A;  4GZR B;  4J41 A;  2OCC C;  5IWA O;  3OTO O;  2M7W A;  3HKD A;  3E8H A;  3L71 H;  4G27 B;  2GV9 A;  1HP8 A;  4QNH B;  4NB5 A;  1AB3 A;  1BQZ A;  4IL6 Z;  1AP6 A;  2ZD9 A;  2QJ1 A;  3N2K A;  4AHC A;  2Q0A A;  4CBC A;  1KP2 A;  3DTU B;  3ZHT A;  5JCO C;  1QQC A;  4LH7 A;  1MSD A;  4QIW F;  2BTO A;  4MVS A;  1IUR A;  1R1B A;  2EJ7 A;  3JSL A;  1FXH A;  2AGA A;  5KA6 A;  3QNE A;  1Y67 A;  2NLJ C;  4O2B B;  4PEL A;  1K97 A;  5KX5 A;  3BA9 A;  5AG2 A;  1UJW B;  1VF6 A;  4DV6 O;  2WPD G;  3CS5 A;  2UUA O;  5LA6 B;  3AK1 A;  1PL0 A;  4LF9 O;  1QBZ A;  1VQ9 V;  4BW9 A;  4UUJ C;  5IT9 N;  1Y4M A;  2QDO A;  4TV9 B;  2XAF A;  4X66 B;  3AEI A;  3OMN B;  4CH3 A;  3D36 C;  3E2E A;  5EC1 C;  3KG2 A;  1G8M A;  2FML A;  3ZHQ A;  4JI5 B;  2BE3 A;  2PYL A;  4TUY B;  4KP4 A;  3VQX A;  5J2U A;  4MT8 A;  2ZIO A;  3F5T A;  2FL4 A;  3SYQ A;  4EFE A;  1AVM A;  2DWE C;  4J7Z A;  4DRX A;  2CAZ C;  4ZHQ B;  3VBB A;  4O4H B;  3HR0 A;  1GM7 A;  3KCY A;  1GM8 A;  3K9S A;  1G1X B;  1XNQ O;  4UB6 Z;  1D2D A;  3K03 A;  2QWR B;  5IYC O;  3JAW B;  3AG2 B;  4JGS A;  3FAV A;  3CD6 V;  2HP8 A;  1P7B A;  2KKW A;  2QM4 A;  1FS0 G;  3FKS G;  1S77 D;  5KAF Z;  1EN4 A;  4ASU G;  3CP1 A;  2EIM B;  2LFR A;  4B3S O;  1N32 B;  2GDS A;  5JQG B;  5KMG B;  1KU9 A;  3OR6 C;  3K5M A;  3TCU A;  1PL4 A;  4FZ1 A;  1EN5 A;  2YXH A;  2LFS A;  1Q81 W;  3NR7 A;  1VQ6 V;  4L8J A;  3QG5 A;  4H37 A;  3C3S A;  3M99 B;  4DXW A;  2UXD B;  1AJP A;  4IIJ A;  3D8C A;  1Q5O A;  5C8Y B;  3B09 A;  4PI0 A;  1D5A A;  3BY6 A;  5ITZ A;  1SQP H;  4F6R A;  4JI8 B;  1N34 B;  2L35 A;  2KSD A;  2WLK A;  1YXB A;  4LCU C;  1DGS A;  3ZMZ A;  2Z0A A;  2QKA A;  4HAM A;  4DV7 O;  2OT5 A;  1AP5 A;  3PJS K;  2QGN A;  1PD3 A;  2AW9 A;  4N23 A;  4RUE A;  1JQ0 A;  3G71 V;  2P06 A;  2YI8 A;  4PA6 A;  4X66 O;  2Q7E A;  3JD2 A;  3LDE A;  5GW7 A;  2FTK A;  3X2Q B;  3B8M A;  3F5W C;  1PKX A;  1AR1 B;  5EBM C;  5DED A;  2P7T C;  4JI1 B;  2ADQ B;  4O2A A;  3K57 A;  5EZY A;  4CH5 A;  2F93 B;  3K3W A;  5BR8 B;  1IBK O;  2ZT9 B;  3O9O A;  1YI2 V;  3HKB A;  3ABU A;  1KBH A;  3JAL A;  1GO3 F;  2CGO A;  3DC5 A;  4U7O A;  1MA1 A;  1AJQ A;  3N2G B;  4MVZ A;  4U3J A;  2E75 B;  1I94 B;  2P6J A;  4LWS A;  4NVP A;  5FPR A;  4NXM B;  2OCC B;  1VQ7 V;  3ETE A;  2OCH A;  4O4J A;  4UV9 A;  5LOV A;  3OD4 A;  5BMV B;  3QO8 A;  3APQ A;  3BFR A;  4HNA B;  3MDS A;  1SQX H;  4RQE A;  1RPO A;  1TVK B;  4TV8 A;  4DV0 B;  1WLE A;  4LNU A;  1BZK A;  3KZI Z;  4FM2 A;  1N32 O;  2N04 A;  1QHT A;  4YIO A;  1NH2 D;  4GKJ O;  4LF4 B;  4JZG A;  3CSX A;  1IBM O;  4E2L A;  4J7J A;  4O4L A;  1S72 V;  1NS1 A;  5EYP A;  4CC5 A;  2PI5 A;  1GN3 A;  2HJF C;  1NVP D;  4DV3 O;  3K04 A;  5KAI Z;  2YSU B;  4FK5 C;  3OUF A;  4JI2 O;  4ZIB A;  4JI8 O;  2UU9 B;  2ZE5 A;  3CWB H;  4GCZ A;  4BIZ A;  1HNX O;  3ASO B;  5CA0 A;  4K3A A;  4JAA A;  1Y76 A;  4JAU A;  5KLV H;  1Q3E A;  5H6R A;  3LUT B;  4J9Y B;  4X65 O;  1XNR B;  1SKV A;  3C90 A;  1QVF U;  1YEW A;  4C7U A;  4DR2 O;  3R65 A;  4LH6 A;  4QE9 A;  5LGT A;  1P4R A;  2FYU H;  3ZHU A;  2LJ2 A;  1L0N H;  3BCC H;  2UUC O;  1EM1 A;  4Z2W A;  4H13 B;  4BIO A;  1WPB A;  3IGA C;  2IBZ H;  3QO7 A;  1Y66 A;  1K9M W;  4YJ2 B;  3VQY A;  1AI5 A;  4Q6G A;  1XDC A;  2Q68 A;  3W7W A;  3CCL V;  4GLX A;  4FFK A;  1N36 B;  2JRI A;  2LO1 A;  2Z5U A;  2HHH O;  3D36 A;  2E76 B;  2B1G A;  4DR7 B;  4K8X A;  1TUB A;  1KB9 F;  1Q6U A;  3D3Q A;  3ZRS A;  1W0J G;  3OUS A;  3CCE V;  4FLT A;  4MVR A;  4X1K A;  4MTO A;  4FM1 A;  1YTF D;  2DE0 X;  1GN6 A;  3MD0 A;  3MHS C;  5IDJ A;  4GYC B;  1DF4 A;  4I55 B;  3OMI B;  5L3C A;  4JAS A;  4N21 A;  1M4U A;  1YVW A;  2OTL V;  5FPO A;  4FLV A;  2ZR3 A;  4XDK A;  4DW0 A;  4DR3 O;  3ZBH A;  4DV0 O;  1M57 C;  1YZB A;  1K3E A;  4PDV A;  1W59 A;  4JF3 A;  2B5U A;  4ZOL B;  1ROP A;  2MW2 B;  4JYC A;  4LF4 O;  3ZX6 A;  4EFB A;  3JAM N;  3HKC B;  1R3I C;  5IJ9 B;  4AQY B;  4YY3 B;  1JA8 A;  5CB4 A;  3CRR A;  2NNU A;  1HR0 O;  3L73 H;  2ZIM A;  1IBL B;  2EUL A;  5B1N A;  3OE7 G;  1S76 D;  2UU9 O;  2HKO A;  3E8G A;  2N05 A;  3D3I A;  3HKE A;  4PD4 F;  3IAY A;  3K5O A;  1FAF A;  1LR1 A;  3RYH A;  3TJT A;  1JJ2 U;  2ADP A;  1JX9 A;  2BSK B;  1VQ5 V;  1T5E A;  4TT3 G;  1PPJ H;  4Z1V A;  4AI8 A;  1S5L Z;  3K9A A;  3W7T A;  5LYJ A;  4R8C A;  1LNQ A;  5LGU A;  1HNZ O;  2P5O A;  4JYB A;  5EBL C;  2UXC B;  4K8Z A;  1XI1 A;  2A3Q A;  1Q90 D;  1GMG A;  1EZV H;  5IY5 B;  2QWQ B;  3OT7 A;  3ZJZ A;  4LF5 B;  4LF6 O;  3CMA V;  5J2T A;  1PV0 A;  4CC6 A;  4FLW A;  5CBG A;  4JI7 O;  5LHG A;  1WNS A;  1H2S B;  5IWA B;  4JI6 O;  2Y4U A;  4I9Q A;  3CCJ V;  1D5N A;  4UCR A;  3AG2 C;  2CH7 A;  3JAT A;  4U7N A;  2KB1 A;  1GK9 A;  4P30 A;  2QWN B;  1JJO A;  2DJV A;  2EIM C;  3P32 A;  3CCV V;  3DC6 A;  3SYO A;  5BZB A;  4B3R B;  2ITC C;  3JAS B;  4TWK A;  3ZIA G;  2BOB C;  3AG7 A;  1F4M A;  2YI9 A;  4PA9 A;  2P4V A;  2W6I G;  1XHZ A;  2WLL B;  4AQY O;  1VQK V;  4IGG A;  2LP7 A;  1BS3 A;  2EX3 A;  4P9P A;  4YJ3 B;  4DV6 B;  3J80 N;  3CYO A;  2UUA B;  1M1K W;  1E1Q G;  3AK2 A;  4F4L A;  1YHQ V;  4A5U B;  2EIL C;  4GT1 A;  1NT2 B;  3JD3 A;  3J7A U;  5DEC A;  2IJH A;  2RNB A;  5H5N A;  1EN6 A;  3B77 A;  4DYL A;  4ZI7 A;  2YIC A;  4GX5 A;  2XTA A;  4QPK A;  1FPO A;  3E83 A;  1WN7 A;  1OCR B;  3RYF A;  5JH7 A;  2NR5 A;  1H8H G;  1RPR A;  3T2M A;  5LMN O;  2WLI B;  3SPC A;  4DR1 B;  4WFF A;  3RBZ A;  1F51 A;  3TK1 A;  4E4E A;  4GKK B;  2HEP A;  4F6E A;  1XNQ B;  1WA8 B;  2XAS A;  2UXN A;  1VEW A;  4NTX A;  1KQS U;  1H2G A;  4NXN B;  4ZKI A;  4FM0 A;  5LBQ A;  1V55 C;  3ZMS A;  4FIP C;  1Q8I A;  4RAI A;  1VQP V;  4EB6 A;  5IYB O;  5LMU B;  1QR9 A;  4B3S B;  4G28 B;  1M57 B;  3AG3 B;  5KHG A;  2JVD A;  5D5P A;  1RM1 C;  2YIB D;  4B3R O;  1XL6 A;  1CEZ A;  1AR4 A;  3CJH B;  3TGU H;  2R70 A;  1H2M A;  4DV1 O;  5E1A C;  1VF7 A;  2RJZ A;  5LXT B;  1J5E O;  1XHX A;  3GVM A;  1I5Y A;  4X1I A;  1MZF A;  4ABM A;  4BR6 A;  1VQM V;  2YIB A;  5KX5 B;  1N33 B;  2QR4 A;  2XND G;  3UKM A;  1N0N A;  1RFY A;  2JIZ G;  2N74 A;  4DV7 B;  2YXY A;  4I5S A;  1N8R W;  2LQT A;  3ZRX A;  3B4S A;  1VP7 A;  2AZ2 A;  2QM7 A;  1YIJ V;  4JI4 O;  1YJ9 V;  4MW3 A;  3ASO C;  2RN9 A;  2WAM A;  2W0X A;  2RCV A;  1G4Y B;  4DK0 A;  5EBW C;  4FMT A;  3L70 H;  1HNW O;  1NQT A;  2A7W A;  4O2B A;  2PZS A;  1Q6I A;  3EHB B;  3OR7 C;  3WB2 A;  1P84 F;  2D3O W;  1JMK C;  5B3S C;  2D2C B;  4JTA B;  3CX5 F;  2XAQ A;  5DM6 V;  4IYI A;  4XDL A;  5LA6 A;  4O4I B;  2XAJ A;  2WWW A;  4QE7 A;  2DQ3 A;  2RDC A;  1K5Q A;  4TSF G;  1IBK B;  4TV9 A;  4DR1 O;  5IYZ A;  4GUN A;  3AG4 B;  1UFI A;  2HFE C;  1JR9 A;  3CC4 V;  1KYO F;  4GKK O;  2EBO A;  4K35 A;  1BT8 A;  4J9Z B;  1K4D C;  4I4T B;  1QLN A;  4TUY A;  2QKS A;  2KG7 B;  4U3F H;  1U97 A;  1BE3 H;  3SYA A;  4B7K A;  4NXN O;  3ZED A;  1SF9 A;  4ZHQ A;  1S0V A;  3TXQ A;  2MK3 A;  1Q43 A;  3BAA A;  4O4H A;  3I56 V;  5LMU O;  3FFQ A;  4JYA O;  5L3F A;  4GKJ B;  2F23 A;  2YDE A;  3G6E V;  3JAW A;  1IBM B;  3SDL A;  2EIN B;  2B1I A;  3OFN G;  3SPG A;  1R6T A;  2IJK A;  1SC5 B;  4BW5 A;  2LW1 A;  2ZDI C;  4X20 B;  4DV3 B;  2PUS A;  1ZL8 A;  5JVD B;  4JI2 B;  3E22 A;  4MVQ A;  3CXH F;  5B66 Z;  5JQG A;  1Q82 W;  1N33 O;  4HYO A;  3JAK B;  1HNX B;  5F2V O;  3O65 A;  3R66 A;  1ARO P;  4X65 B;  2XUM A;  1K7D A;  3EVK A;  4DR2 B;  5C8Y A;  4LR3 A;  2EIL B;  3RW0 A;  3FB8 C;  2UUC B;  4FVM A;  2PF4 E;  1YSC A;  4YXW G;  2IM9 A;  4WFG A;  5LHH A;  3RN4 A;  4UB8 Z;  4TQD A;  2CE4 A;  2CUG A;  3CCU V;  3HB3 B;  3ETD A;  1H8E G;  1NTK H;  1COW G;  3E35 A;  4FLZ A;  1FJG B;  2R9R B;  2WLJ A;  2HJD A;  4H0L B;  2ATK C;  3UO3 A;  2QM8 A;  2HHH B;  5HFL A;  1YJN V;  3HKB B;  2CTR A;  4EKW A;  1NR1 A;  2DN9 A;  2DYR B;  3K79 A;  1VF5 B;  3RYC B;  4B7E A;  5IY5 C;  2VS0 A;  1K33 A;  1IXB A;  2QKC A;  4YHH O;  4U3J B;  4PV1 B;  2A0L A;  3CEI A;  4OGQ B;  1VIB A;  3W7S A;  2EIK B;  4DO2 A;  2OWO A;  5GON A;  4FLX A;  1RSO B;  5B1B C;  3CRC A;  3K5L A;  3JCU Z;  1IX9 A;  1NZ6 A;  1BHA A;  4O4J B;  1ZSP A;  1V55 B;  4LF7 O;  4JZ2 A;  3Q4H B;  5EK0 A;  2UXX A;  4WF9 V;  2XOK G;  3FX7 A;  4QGP A;  4TV8 B;  4DR3 B;  1XMO B;  1AJN A;  1SRY A;  3N2G A;  3H1K H;  1S3J A;  1R73 A;  4DV4 O;  1RM1 B;  4LFB B;  4G2K A;  1VQ8 V;  4JV5 O;  1EFR G;  3LDC A;  3N27 A;  3JCZ A;  1R3J C;  1DTO A;  2K9P A;  2H94 A;  3BPZ A;  4O4L B;  4HNA A;  2ZE6 A;  2YID A;  1I0H A;  4LP8 A;  4MTX A;  3SJC C;  5L3G A;  3RT3 C;  3E86 A;  1HR0 B;  1K34 A;  1HDJ A;  1W2B U;  2EIJ C;  5JCO A;  3SGI A;  1SQG A;  2OIE A;  1LUV A;  5CA0 B;  1ZAU A;  2Q67 A;  5IJ0 B;  4RQF A;  2QSA A;  2R72 A;  1KMI Z;  3G6B A;  1SQF A;  2Q5Z A;  1VQ4 V;  3SJA C;  1VAR A;  5B3S B;  2O57 A;  5K1P A;  2QWO B;  2IH3 C;  1K92 A;  3CCQ V;  2IW5 A;  1EBO A;  2RMK B;  1FFT B;  3WB0 A;  4JPR A;  1XIL A;  3ZMU A;  1HNZ B;  4OPA A;  1WP8 A;  1OCR C;  3STL C;  2VQE B;  2QEX V;  1FJG O;  3UO2 A;  3QF7 A;  3H1H H;  1XQ8 A;  2IU0 A;  1SQQ H;  4LF6 B;  1IVS A;  3K0D A;  1O9G A;  4JI7 B;  1PM9 A;  3G67 A;  4MS2 A;  4NR1 A;  4WFH A;  4YJ2 A;  4JI6 B;  1JPX A;  4X1K B;  3ML0 A;  2YEV B;  3H01 A;  5KHI A;  4FFB B;  1FFX B;  2Y69 B;  4H44 B;  3JAR B;  5TIS Z;  4KFM A;  3ABM C;  2Q0O C;  4OX9 O;  3LNN A;  1YTF B;  4DUZ O;  1XMO O;  1BMF G;  4UVB A;  3C3T A;  3OTF A;  1M56 C;  2W0F C;  3AG3 C;  3DXR B;  1L0L H;  1KD1 W;  5KUK A;  4LF8 O;  4LFB O;  1SA0 B;  3M7M X;  4I55 A;  3JD0 A;  1L1F A;  1Q6H A;  3H1I H;  4MW8 A;  4IHJ B;  2E5L O;  4JI0 O;  2P4K A;  5CMU A;  3IC7 A;  3OMA B;  4J80 A;  3T1C A;  1FXK B;  3W7U A;  4ZOL A;  4PA7 A;  5CBH A;  1KP3 A;  2E3C A;  4I0X B;  3ZRV A;  5LP6 B;  3CCS V;  1VF6 C;  1ZTE A;  1NTM H;  3UT5 B;  3E89 A;  1SER A;  2F43 G;  4W4L A;  5B1A B;  3HKC A;  5IJ9 A;  2HG5 C;  2IU3 A;  5EIB C;  4I50 B;  2V4D A;  1EZJ A;  4H33 A;  5KHJ A;  2PTM A;  2FB5 A;  5B1O A;  4D6T H;  3APO A;  3SPI A;  2JGD B;  2R9I A;  5LMN B;  4LFA O;  3W7X A;  1PNK A;  1R6K A;  3ZCC A;  5C93 A;  2VQE O;  1IZ3 A;  2BSK A;  5JWP A;  2Q7G A;  3AG4 C;  2PY5 A;  1F23 A;  1NI8 A;  1HWY A;  1XRE A;  4Q20 A;  1WP7 A;  3KCX A;  2QTS A;  3CXC U;  2F95 B;  5B1B B;  2B9Z A;  1KKC A;  4PDR A;  4D7S A;  4JI3 B;  3ABL C;  1WPX A;  2Y0I A;  1Y74 B;  4KUM A;  2CTQ A;  2Q8V A;  2ZXW C; 
#chains in the Genus database with same CATH homology
 1ZL8 A;  1ZL8 B;  1Y76 B;  3B40 A;  1RSO B;  1Y74 A;  1Y74 B;  1VF6 C;  1VF6 A;  1Y76 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...