1Y74A

Solution structure of mlin-2/mlin-7 l27 domain complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
57
structure length
57
Chain Sequence
LGLERDVSRAVELLERLQRSGELPPQKLQALQRVLQSRFCSAIREVYEQLYDTLDIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A unified assembly mode revealed by the structures of tetrameric L27 domain complexes formed by mLin-2/mLin-7 and Patj/Pals1 scaffold proteins.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
molecule keywords lin 7 homolog b
total genus 22
structure length 57
sequence length 57
chains with identical sequence C
ec nomenclature
pdb deposition date 2004-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.650 Mainly Alpha Orthogonal Bundle Helix Hairpins L27 domain 1y74A00
1Y76B 1Y76A 1VF6A 3B40A 1ZL8B 1VF6C 1ZL8A 1Y74A 1RSOB 1Y74B
chains in the Genus database with same CATH superfamily
4P9PA 2M7WA 2NR5A 5GONA 2ZE8A 1N8RW 1OCRB 4DV4B 1BQZA 2IH3C 2P22C 5K1PA 1FYJA 3CC7V 3TXSA 2Q5ZA 4NTXA 5B3SB 3UM7A 3TGUH 1F23A 5CA0A 4I5SA 5KHGA 1NVPD 3ETDA 5DEDA 1QVGU 5IT9N 3MHSC 2IU3A 1FD9A 4LR3A 1M9NA 3AG7A 4XBFA 2WLIA 5LYJB 4TUYB 1OCZB 1O9HA 2XTAA 2VWJA 2JGDA 2VS0A 4MVRA 4G27B 4DO2A 4AQYO 3P3NA 2ZNIA 1VF5B 1K8AW 3CPWU 1QCEA 4GLXA 2WSSG 4K35A 4ZBMA 4DK0A 1N34O 4JI2B 1S5JA 3OTOO 3QVNA 1VF7A 1MNGA 2EZOA 4QPJA 3IAYA 5IE9A 1BHAA 5J9PC 3RGBA 3JAWB 3CD6V 2YI9A 5ITZB 3E8GA 3K08A 4DW1A 4GX1A 3FX7A 2YXHA 3HKDB 4UCRA 1TVKA 1VEWA 2Q9LA 5LXTA 5IY5B 1HNZO 2GHYA 4J9YB 3QG5A 4PHZA 4WFFA 3ASNB 5DN6G 3M8AA 3VQYA 1XHZA 3VOUA 4ZHQA 1XEQA 1S5HC 3J81N 3FD9A 3S3XA 2JJ2G 2JS5A 1PKXA 3G67A 4JI4O 2KQXA 1FS0G 2QTSA 1HR0O 1PD3A 3Q4HB 3T4ZA 2WLLB 2H3OA 1CEZA 4DV2B 5LHIA 2KB1A 3WB1A 1K5SA 1SESA 1NI8A 2ZDIC 4TV8B 2DWEC 2ZDIA 1AR5A 3QTCA 4PDVA 1G8MA 4B3RB 3AG2B 4FMTA 3OM3B 4LF4B 4NKGB 1Z5WA 4HYOA 3ABMC 4F4LA 2Q4PA 1NVPB 4X62O 3K59A 2DMXA 3L9DA 3E8FA 1K34A 1P7GA 4MVSA 2BOBC 2QTOA 1J5EO 4TOIA 5J2TA 4F6EA 2WLJA 5IWAO 1GTOA 1RFYA 3LNNA 3HKBA 3CC4V 2NLJC 5GONB 4FFBA 4TQDA 3A0HZ 5CA3A 3I5DA 3QO8A 4FZ1A 1P4RA 1IXBA 2ZM6B 2MW2B 4GUNA 3L74H 2RJZA 3C3SA 1Y66A 2UXCO 5EBLC 3CRQA 4X20B 3UCSC 1D5NA 4JI8O 4NTWA 3KCXA 4MTGA 5JJNB 3H1KH 4XDLA 4JI0O 2XAFA 1E79G 2XOKG 1A32A 2P6JA 1VQPV 4PV1B 1LR1A 2QM4A 1Q90D 3GWOA 4J7ZA 5JCOA 1JX9A 4JYCA 2CH7B 2V1DA 2N04A 2ZXWC 5FLXN 3VQWA 2KSDA 4JV5B 1JFFA 3BEHA 5L3FA 1K73W 3JSLA 4Z2WA 3Q4HA 1XMQO 4JI7O 3ZHTA 1VQ4V 1EN5A 3B2EE 4DV6O 2WAMA 1XNRO 1S76D 4O4HA 1W59A 2A9HA 5EBWC 2FTKA 3F5TA 1NU1H 5A9GA 3EVKA 2VQEO 4HBNA 3E35A 3AG1C 4H44B 4N21A 2QWRB 4F6RA 1SZTA 2VWKA 2F23A 3PN1A 4DR7B 3UKMA 4X62B 1G6UA 3KCYA 1S77D 2IW5A 3JAKB 3OGIB 4UCSA 2Z0AA 3KZIZ 1SQQH 4LWSA 4O4JB 1TVKB 2L6LA 1AP5A 4XDKA 1GKFA 5LA6A 5IYCO 1AR1B 3H1JH 1M1KW 1BL8A 1AI4A 2RMKB 3SGIA 3ZMUA 1J5EB 4MVOA 1OHHG 1W0JG 2IU0A 3DC5A 4I9WA 4RO2A 4JPRA 1UPGA 1XMOB 4MW3A 1ZWIC 4U3JB 4O4LB 1NTZH 4JYAB 1D2DA 4J42A 3B09A 1N33B 2PF4E 3L75H 2O57A 3AK1A 1KU9A 2UUBB 1SRYA 3SYAA 3M7MX 4DR3O 1VQ5V 4DV7O 5KA5A 4MSWC 2ZE6A 3BCCH 2UUAO 2XASA 3OMIB 1XNQO 3RFRA 3SYQA 2P67A 4ZI7A 2PY5A 4RQEA 3E83A 4KHPB 2F4VO 1PM9A 4J41A 1GN2A 4MT8A 3E86A 2X6CA 3IC9A 4DR1B 3ZRVA 3BABA 1HNZB 4Q6GA 4UCUA 4I50A 3MD0A 5CA0B 4PA4A 4FLUA 4X8AA 3N2KA 2Z5UA 3P32A 1DGSA 2UXDB 2QDOA 4PDMA 5LGUA 3AEIA 3ZMSA 3JALA 4H13B 3CEIA 4AILC 5JQGB 1Z5VA 1KYOF 2VRZA 4DR6B 2Y4UA 3F5WC 4D7SA 3DXRA 4I4TB 2B1GA 1PV0A 1VMGA 4TV8A 1NQTA 4DV4O 1MOFA 4JI1O 3A2FA 4KHPO 2QWQB 4B08A 1MA1A 4I9QA 4JI8B 4DR4O 4D6TH 1OCCC 3CX5F 5CB4B 4AI8A 3WFVA 1AJNA 2CTQA 4NXNB 2QKCA 1KKCA 3SYCA 3ABMB 2WLKA 2EIMB 1YTFD 5KAFZ 2YIBA 2HEPA 1SA0A 5E79Z 4DW0A 3LDDA 4R50A 4X1KA 4JI0B 2X7RB 3SJBC 4H0LB 2XAHA 4J7KA 4U7NA 3S3WA 5C8YA 3BA8A 1V54C 4O4LA 1H2MA 3AG3B 4IHJA 1TUBB 1JCHA 4MVZA 4YJ2A 2WA3A 3D36C 4X64B 1H2LA 4JASA 1YEWA 4X20A 1TA8A 4GX2A 2P7TC 3L70H 1O9GA 2ZNJA 2GDSA 1SQFA 4NVPA 3ZX6A 5IYZA 3RN4A 3W7XA 1HNWB 3H1LH 2EX3A 3BAAA 4X65B 4FFKA 4EB6A 4LFBO 1NZ6A 5CBGA 3O9OA 4HNAA 2Y0PA 1YZBA 3K0DA 1K7DA 1IDSA 1K3EA 2LJ2A 2ZCEA 1RSOB 5CA1A 2BTQB 4YIOA 5H6RA 2UUCB 2PI5A 1WJZA 5JH7B 2ZR3A 5LOVA 3QF7A 1JR9A 2LW7A 1M56C 1GMGA 5FL7G 4DK1A 3OE7G 1P84F 3KKYA 4TT3G 4X1IA 4JTAB 2JK5C 4XDJA 4RUFA 2P4KA 3K5MA 4UCTA 4I0XB 5IYBO 2A79B 2LGWA 4TSFG 4CC6A 4UFZA 2HJDA 3CCSV 1I5YA 4IHJB 3OW2U 4ICGA 5CA1B 4LFBB 5A2QN 5KHIA 5BZBA 3F7VC 4JGSA 4LCUC 2YUAA 3SYOA 1N0NA 2AHYA 1EFRG 3T1HB 5H9CA 4WF9V 4X1YA 1AILA 2HVKC 4OPAA 2VQEB 2YSUB 3OTOB 4DUZO 1M93A 2E75B 3LSUA 2DYSB 3JATA 3ZHUA 1R3IC 4JZGA 1VQMV 4DV6B 4GKKO 1AI6A 1OCOC 5IYDO 4NB5A 4FM2A 2GUZB 3K0GA 5F2VO 4D7TA 4FZ0A 1PL0A 1IVSA 1DLBA 5LGTA 5C93A 3CWBH 4DR7O 1JFFB 2YXLA 4J9ZB 4QGPA 3AG4B 1OZ0A 4EFBA 1L0NH 4DR6O 3RYHB 3SJCC 5IJ0A 3DGEA 1NJIW 4JYAO 2ITCC 3G4SV 2ARHA 3EXAA 2AW9A 1XDCA 1KMIZ 1Q43A 5BMVA 1LUVA 4JAAA 1NBMG 4LF9O 5LMUO 4ABMA 1K92A 4FLVA 3HKCB 5CMUA 4PA9A 1H8HG 1H8EG 2BOCC 5DECA 5L3GA 4DUYO 2NN4A 1R3JC 3LNMB 3FB8C 3R66A 2EBOA 2ITDC 4QJFB 4LNUB 3ZMVA 1VQ6V 4B3SB 1WLEA 2F1MA 2E3CA 4LFAB 4MS2A 3UO3A 1QR9A 5LHGA 1PP9H 3OEEG 3ZIAG 4WCEV 2QGNA 1M5IA 3ABLC 3ASOB 4YY3O 3T4DA 3OFNG 2BSKB 1XL6A 5BR8O 3LDCA 3OGCC 1Q6IA 1SQBH 1QR8A 4NYKA 1F4NA 4B3TO 4FIPC 4I0XA 2HG5C 3ZMZA 1D5AA 1H2SB 3OT7A 3ABTA 3SPJA 4X1IB 4LF4O 1FAFA 3CCMV 1B04A 4X1KB 2WA4A 3RYHA 4PD4F 1XI1A 4JI5O 3QNEA 1BSMA 1KP3A 4YJ2B 5KHKA 5FNVA 2EIJB 3HKEB 3CCRV 2JVDA 3BA9A 2ATKC 2E5LB 3ZN0A 1PNKA 4JYYA 2YC0A 1HNWO 3W7SA 2A3QA 4TV9B 1B3QA 1Y4MA 1PNLA 4O4JA 1WB8A 1S5LZ 1F4MA 1R6NA 4GYCB 4DV3B 3CJHB 1OCOB 1Q6HA 4L8JA 1VQKV 3JAMN 1GN6A 2LGQA 4P30A 1QBZA 3ZCCA 2ADQB 2W6JG 3HB3B 4O4HB 5CBHA 2Z3YA 3E2EA 1L1FA 3GB7C 3RWRD 1HNXO 2Q68A 4U3JA 1SZXA 3ZHSA 2A06H 1V9PA 3JAWA 4E4EA 4DR2B 1IBKB 4GKJB 3K5NA 4B3SO 5BMVB 1IBMB 5LP6A 3ZEDA 2YXYA 4MW8A 4LP8A 4JI6O 3RYFA 1FFXA 5KA6A 3LUTB 4DR5B 1AJPA 4IL6Z 4CBCA 2CGOA 3G80A 1Q3EA 3J7AU 3BFRA 2WLIB 3L72H 3K79A 2Y48A 4UCVA 5EC2C 1IX9A 1SKVA 2A0LA 1F7YA 2UXNA 2GUZA 3HKBB 1S3JA 1HWYA 3FAVA 4W4KA 3RBZA 5HFMA 2XAQA 3K57A 4Q20A 4K8XA 3CRMA 2BE3A 3VBBA 3JYCA 1K97A 3ABKC 4BIUA 3ZHQA 4JTCB 3CMAV 3H01A 4TV9A 4DV1O 3JALB 4DR1O 1BGYH 1WP8A 5IDJA 2Y0IA 2PI4A 1TAEA 4LF6B 1H2NA 4KP4A 5EZYA 2YEVA 4ZKIA 4B7EA 2DE0X 3W7UA 1AB3A 1XL4A 2LO1A 4TUYA 5LMNB 3OTFA 1N32O 4GX5A 2HP8A 1TUEB 3QO5A 5J2UB 1N36O 2ZD9A 4JI2O 1JMKC 4UV9A 1ZL8A 1XHXA 1BZKA 3ABUA 4JYBA 1Q8IA 1BT8A 2CK3G 4LF7O 4LH6A 4O2BA 1VP7A 2V7QG 2B1IA 3N2KB 1SETA 1M57C 1VQLV 1KD1W 2Q73A 1VF6C 4Z1VA 2W6IG 4DV0O 3IC7A 3STLC 1KC8W 1RPOA 1ROPA 1NR1A 1JQ0A 1BCCH 2R9IA 3IGAC 2EULA 1H2GA 3UQ8A 3E22B 1S72V 5LP6C 4IYHA 1QLEC 2XAGA 3DC6A 4JZ2A 3AG3C 2W0XA 3SPHA 5B1BB 1VQ8V 3ZHRA 3I56V 4X1YB 3CMEV 3MDSA 4FK5C 3THOA 3IJ4A 4WFGA 2CH7A 4LF6O 4MTOA 1JA8A 5H5NA 4L87A 1GH6A 5LYJA 4GT1A 4DUZB 1OCZC 4BR6A 2FMLA 1H38A 4JI5B 3E89A 3CXCU 2HR3A 2AGAA 1N36B 4HAMA 4J10A 4KUMA 3VQXA 4CH4A 1UJWB 1BHBA 2DYRC 4X64O 2YS8A 1M4UA 4CS3A 4TWKA 3OD4A 4PJ0Z 1E1RG 3WB0A 5KLVH 2Q0AA 3ZJZA 2Q0OC 1XOUA 3B77A 1YDXA 3F7YC 1UFIA 4DV7B 3B8MA 4OXSA 5D5PA 5EC1C 1VQOV 2DN9A 1N33O 2EIKC 5B1OA 2AXTZ 1OCRC 3I55V 3APOA 2PUSA 1EZVH 1GO3F 1G4YB 4TQFA 3JASA 3CRRA 4FLWA 1U97A 4I4TA 2QWOB 3N27A 4K3AA 4WFHA 1PL4A 3JCUZ 1Y74A 3SPGA 4LNUA 2XAJA 2ZM6O 4X88A 5B1AB 1W0KG 3D3QA 4K0KB 3ETEA 3WB2A 1YF2A 5BR8B 4JI1B 2JS3A 1FXHA 5IJ9A 4N23A 1FPOA 1MZFA 4ZHQB 1KB9F 3GWKC 3N2GA 4UVCA 2HKOA 2UXDO 2YI8A 4JI3B 1K4CC 3TJTA 5JQGA 3ABKB 1ZSPA 4P9OA 3SPCA 3SJQC 2NNUA 1YJ9V 4PDLA 4BW9A 2HVJC 1RSOA 3HKDA 3C90A 1WA8B 2DWDC 1XILA 2IBZH 1FXKA 4O2BB 1Q5OA 2QKAA 1R3LC 2ZE5A 4FJCC 1NKDA 4ZIBA 3CCJV 1GN4A 2UXBO 1LNQA 4FPPA 4DV3O 2JGDB 2DOSA 2F93B 1L0LH 2OT5A 3MAQA 1B06A 1R3KC 1M56B 4LF8O 4X66B 4OPHA 3CCVV 5LL6Y 4BAYA 1QNMA 1WB7A 4LFAO 5B1BC 3K04A 4QPKA 4IIJA 5L3DA 1FXKB 1LUWA 1V54B 5JVDB 1YI2V 3D36A 4NR1A 4LF7B 2RQ6A 5EYPA 2XHBA 3DSQA 5ITZA 2DQ0A 4EEQA 4FLXA 1IURA 3IFXA 4CH6A 1CP9A 3P3PA 4ZOLA 3JD4A 2HLDG 1NH2D 1AVMA 3A0RA 5GW7A 5KHHA 5IY5C 3H1IH 3ZMTA 1SERA 3D8CA 1COWG 1ORQC 3ASNC 4EKWA 3AK2A 5LOVB 2HJFC 2RN9A 4UV8A 2YIAA 1E1QG 1FFXB 4FM0A 3LDEA 1SQVH 2N05A 5LGNA 1N0JA 5E1AC 1MSWD 5JJJB 1XMOO 1MMMA 3ZRWB 4QE7A 3JATB 2B9ZA 1X59A 2ODMA 1P49A 2LFSA 2ZKOA 2JDIG 2Q7EA 1FXVA 3DXRB 2JJ1G 4PI2A 2L35A 1P7BA 1KBHA 2Y69B 2ZINA 1G1XB 1Q6UA 3UT5B 4Z1MG 4JF3A 1DTOA 4DR2O 1IBKO 2F66C 4G2KA 4GKJO 5LMUB 3L73H 1BS3A 4FLZA 1WN7A 1Z2GA 2X6BA 3BVOA 5EK0A 4UVAA 1YHQV 4NTYA 4AHCA 1QLEB 1THZA 4KFMA 3WU2Z 5EIBD 3ZRWA 3U10A 2OCCC 1WNSA 4RAIA 2D2CB 4UCOA 1FJGO 2B5UA 2YIDA 4DV2O 2Y4TA 5EZYB 3JARA 1OJHA 3UT5A 5HFLA 4YY3B 4JAVA 3OEHG 4KL1A 4PDRA 4DR4B 3ZS8C 3JD3A 2N74A 1DF4A 3OR6C 1Q7YW 5KHJA 3CRCA 1RM1C 2UXXA 2P4VA 2XNDG 1KUQA 1ENVA 1EN4A 1ZLZA 2PGGA 3CSXA 2QM7A 5LMNO 2JIZG 1YIJV 2M6YA 1W2BU 3FB6C 5JVDA 4DV0B 5B66Z 2GTAA 3K5OA 1GM8A 1IZ3A 5DM6V 2E76B 3P30A 1FJGB 1NH2B 2H8PC 2ZIOA 5IWAB 5GTHZ 2IJJA 1MZEA 1F51A 5B1AC 1VARA 2IJHA 3JD2A 1I7FA 1FXKC 2LQTA 1FFTB 2CGNA 2Q7GA 2QE7G 4DR3B 2FL4A 5B3SC 1YJWV 3RT3C 2WLHA 4CS2A 4I55A 3APQA 3WG7C 2EILB 4ZOLB 2AZ2A 2WPDG 4UVBA 1AP6A 4DR5O 2BCCH 4G28B 1X4TA 3G6BA 2D3OW 2IJKA 1URFA 5JJEB 1WA8A 2YDEA 2UUAB 2WWWA 4PI0A 1HNXB 5KUKA 3A0BZ 1I0HA 4IT5A 3K58A 2OTLV 2X6AA 4QIWF 1WPXA 1EN6A 4WBNB 3G6EV 4LH7A 3W7TA 1S0VA 3CCQV 4GZRB 2R9AA 2ADPA 2OCCB 3BPZA 5BY1A 1FKAO 3K03A 5IJ9B 2CTRA 2FYUH 1EZJA 4BIZA 3FYEB 3B8NA 2MK3A 4CS4A 1ZX3A 4OX9B 2OTJV 4MVMA 2ZIMA 2WLNA 1JOYA 3OMNB 4U3FH 3RW0A 3OUFA 4E2LA 1BE3H 3E8BA 2HFEC 4W4LA 2JRIA 4MTFA 3FFQA 2XT9A 5KMGB 4YHHB 4J11A 5FNVB 1OCCB 2DJVA 4UXNA 3ETQA 3FYIB 3CB2A 2KG7A 2LP7A 1SQGA 3B40A 2Q8VA 5KX5A 5L3BA 1AR4A 4WFEA 1ZTEA 1J95A 3A8TA 2UU9O 1SF9A 2PYLA 3U0ZA 5GTIZ 1HP8A 4BIOA 3RYIA 4R6ZA 3ZRSA 2PZSA 3T2MA 4LFCB 3ICXA 4WFAV 1ZAUA 4O2AA 3X2QB 2A7WA 2DYRB 1NTMH 4J80A 2UUBO 1JVMA 1XUQA 3STZC 1HR0B 5K1XA 5KX5B 2YEVB 1DF5A 4PA3A 4IIJB 1DK1A 1VQ9V 4WBNA 3SR2C 4PA6A 1K4DC 2EIKB 1V55B 4B7KA 3EFFK 1WP7A 1B6QA 2PTMA 2GSMB 4H37A 4YXWG 3TK1A 4X66O 3CE2A 2CAZC 3ETGA 5C8YB 3JASB 4DUYB 2V4DA 3CJHA 4FM1A 1SQXH 3HKCA 3E8HA 3H9VA 5CBFA 2CE4A 2AHZA 4O4IA 2EILC 1IBMO 3FKSG 1XQ8A 3HR0A 1SC5B 2HHHB 1VIBA 3FAVB 3RYCB 2IM9A 3FB5C 1EBOA 4ZI7B 5H6QA 3DTUB 5LXTB 2F43G 4WFBV 4CZZA 1JJ2U 5EYPB 3VQVA 2CUGA 3ZN1A 1IXMA 2OCHA 4JAUA 3G71V 3BRCA 4RQFA 2Q67A 5L3EA 1MG1A 3JCZA 3JD1A 2DW4A 2ZE7A 3TCUA 4R7CA 2GBOA 1BMFG 3N2GB 2QWNB 5AG2A 2EZPA 4LFCO 2BTOA 4O4IB 2DQ3A 2JEUA 1Q81W 1WAZA 4YJ3A 2AZ0A 1Y74B 3W7WA 1SA0B 4LWSB 5LHHA 1JPXA 2BTQA 3AG1B 3AG2C 4IYIA 3U11A 2DYSC 2QSAA 1M90W 2K1EA 1YCIA 1VQNV 1CXZB 3JAKA 4QE9A 3T1YO 5KMGA 3OR7C 4I7ZB 3CC2V 5KUMA 3CS5A 5EBMC 1NT2B 3CCLV 1H2KA 4LF5O 4NXMO 4FVMA 5TISZ 1IBLB 1QHTA 1ZUQA 3AK3A 4B3TB 3ZBHA 2YIBD 4UB8Z 5IYZB 2OIGA 5FPRA 5JWPA 1U96A 4RUEA 1N34B 4DRXA 2QR4A 3K9AA 2G38A 3PJSK 1US6A 1AI5A 1AROP 4DV5B 1PNMA 4AQYB 3D3IA 3KG2A 3AG4C 4YHHO 4I55B 1R73A 3WG7B 5LA6B 2H94A 4YIPA 2FB5A 2JGUA 1YTFB 4DYLA 1NS1A 4B3MB 4DRXB 1GRJA 5D5QA 1Q82W 1GAXA 3CCUV 1KQSU 4I50B 2ZQMA 3RYIB 2GTSA 3TETA 1YJNV 1GM9A 3ABLB 1IBLO 2IJIA 3X2QC 1KP2A 3SDLA 4CH5A 5KAIZ 4C7UA 2Y69C 1R6TA 3LSQA 4HNAB 1L8DA 1RPRA 1YXBA 1GM7A 2EJ7A 4MVUA 1XBLA 1I08A 2P06A 1ZL8B 1QLNA 2Q69A 3OMAB 2W0FC 3RYCA 4JI4B 3ZRXA 3RVZA 1N32B 2C2AA 1XREA 3CYOA 2CTWA 1Y67A 5FPOA 1K5QA 3R65A 2PYJA 1Y76A 3K3WA 2VQFO 4MTXA 3CCEV 4X89A 1N4CA 2QM8A 2RCVA 3SJAC 1R6KA 3MHHC 2UXBB 5B1NA 4B3RO 2R72A 3T1CA 5L3CA 2QKSA 4EFEA 2EINC 1SS3A 1NTKH 1RP3B 2F95B 2WLMA 3ML0A 2GV9A 3C3TA 1GK9A 4LBEC 3ASOC 4K0KO 2YICA 2X0LA 4CH3A 4OX9O 4JI3O 4CC5A 2QA4V 4EB6B 1K9MW 1YVWA 2QEXV 2EIMC 4J7JA 5B5EZ 4R8CA 2P5OA 2HHHO 2QWPB 2OYQA 2UU9B 3K5LA 3CHXA 1QU7A 3OAAG 4UB6Z 3QO7A 3CXHF 4LC1A 1NR7A 2K9PA 4B3MO 4JI6B 2P90A 3UO2A 1XMQB 4JI7B 2CDYA 3RVYA 3SYPA 2EIJC 4LF9B 5CN0A 3K9SA 3L71H 4YJ3B 2LFRA 3M99B 2CTPA 1CPYA 4ASUG 1KECA 2EJRA 4FFBB 1AJQA 5CB4A 3CP1A 1KKDA 1T5EA 1SQPH 2IH1C 4X65O 2F4VB 1XNRB 2QJ1A 3LSSA 1I5XA 5LBQA 2UUCO 3JARB 2XUMA 1I94B 4IGGA 3T1YB 2RNBA 1QQCA 3K06A 3H1HH 2R9RB 2ETNA 2E74B 3J80N 3HPLC 4K8ZA 1YITV 4GCZA 3T1HO 1AI7A 4NXNO 4HZ3A 5EIBC 4PA7A 1YSCA 3NXSA 1EM1A 3FB7C 4O2AB 1HDJA 3ZHVA 4BWAA 3O65A 4PELA 4F6RB 4H33A 2OWOA 4DXWA 3NR7A 4X9QA 4RWUA 1OV9A 1VF6A 2WLLA 1BQ0A 1HW7A 3B4SA 2E5LO 1M57B 5IJ0B 1Y76B 1R1BA 4JTDB 2EINB 2KKWA 5BXZA 1GN3A 3GVMA 2ILMA 2VQFB 2KG7B 5H2FZ 1MABG 3HKEA 4U7OA 4QNHB 1QVFU 1MSDA 2ZXWB 2RDCA 2Q6AA 4LF8B 3SPIA 4BW5A 2FKXA 1K33A 3TXQA 1RM1B 3E22A 2JEXA 5J2TB 5J2UA 4GX0A 2UXCB 1I94O 3BY6A 5LP6B 4LF5B 4NXMB 2ZT9B 4JV5O 4GKKB 5JCOC 1VQ7V 4A5UB 4DV5O 1TUBA 1XNQB 1JJOA 3RYFB 1PPJH 4DV1B 2R70A 2LW1A 3JD0A 4KXRA 2Q7HA 3JSNA 2BSKA 3BHPA 3CRAA 4P2ZA 1WPBA 2ZR2A 1TGOA 5JH7A 4MVQA 1Y6XA 3OUSA 1V55C 2OIEA 3EHBB 4UUJC 4FLYA 4FLTA 1Q86W 4OGQB
chains in the Genus database with same CATH topology
1Y76B 1Y76A 1VF6A 3B40A 1ZL8B 1VF6C 1ZL8A 1Y74A 1RSOB 1Y74B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y76 B;  1Y76 A;  1VF6 A;  3B40 A;  1ZL8 B;  1VF6 C;  1ZL8 A;  1Y74 A;  1RSO B;  1Y74 B; 
#chains in the Genus database with same CATH topology
 4P9P A;  2M7W A;  2NR5 A;  5GON A;  2ZE8 A;  1N8R W;  1OCR B;  4DV4 B;  1BQZ A;  2IH3 C;  2P22 C;  5K1P A;  1FYJ A;  3CC7 V;  3TXS A;  2Q5Z A;  4NTX A;  5B3S B;  3UM7 A;  3TGU H;  1F23 A;  5CA0 A;  4I5S A;  5KHG A;  1NVP D;  3ETD A;  5DED A;  1QVG U;  5IT9 N;  3MHS C;  2IU3 A;  1FD9 A;  4LR3 A;  1M9N A;  3AG7 A;  4XBF A;  2WLI A;  5LYJ B;  4TUY B;  1OCZ B;  1O9H A;  2XTA A;  2VWJ A;  2JGD A;  2VS0 A;  4MVR A;  4G27 B;  4DO2 A;  4AQY O;  3P3N A;  2ZNI A;  1VF5 B;  1K8A W;  3CPW U;  1QCE A;  4GLX A;  2WSS G;  4K35 A;  4ZBM A;  4DK0 A;  1N34 O;  4JI2 B;  1S5J A;  3OTO O;  3QVN A;  1VF7 A;  1MNG A;  2EZO A;  4QPJ A;  3IAY A;  5IE9 A;  1BHA A;  5J9P C;  3RGB A;  3JAW B;  3CD6 V;  2YI9 A;  5ITZ B;  3E8G A;  3K08 A;  4DW1 A;  4GX1 A;  3FX7 A;  2YXH A;  3HKD B;  4UCR A;  1TVK A;  1VEW A;  2Q9L A;  5LXT A;  5IY5 B;  1HNZ O;  2GHY A;  4J9Y B;  3QG5 A;  4PHZ A;  4WFF A;  3ASN B;  5DN6 G;  3M8A A;  3VQY A;  1XHZ A;  3VOU A;  4ZHQ A;  1XEQ A;  1S5H C;  3J81 N;  3FD9 A;  3S3X A;  2JJ2 G;  2JS5 A;  1PKX A;  3G67 A;  4JI4 O;  2KQX A;  1FS0 G;  2QTS A;  1HR0 O;  1PD3 A;  3Q4H B;  3T4Z A;  2WLL B;  2H3O A;  1CEZ A;  4DV2 B;  5LHI A;  2KB1 A;  3WB1 A;  1K5S A;  1SES A;  1NI8 A;  2ZDI C;  4TV8 B;  2DWE C;  2ZDI A;  1AR5 A;  3QTC A;  4PDV A;  1G8M A;  4B3R B;  3AG2 B;  4FMT A;  3OM3 B;  4LF4 B;  4NKG B;  1Z5W A;  4HYO A;  3ABM C;  4F4L A;  2Q4P A;  1NVP B;  4X62 O;  3K59 A;  2DMX A;  3L9D A;  3E8F A;  1K34 A;  1P7G A;  4MVS A;  2BOB C;  2QTO A;  1J5E O;  4TOI A;  5J2T A;  4F6E A;  2WLJ A;  5IWA O;  1GTO A;  1RFY A;  3LNN A;  3HKB A;  3CC4 V;  2NLJ C;  5GON B;  4FFB A;  4TQD A;  3A0H Z;  5CA3 A;  3I5D A;  3QO8 A;  4FZ1 A;  1P4R A;  1IXB A;  2ZM6 B;  2MW2 B;  4GUN A;  3L74 H;  2RJZ A;  3C3S A;  1Y66 A;  2UXC O;  5EBL C;  3CRQ A;  4X20 B;  3UCS C;  1D5N A;  4JI8 O;  4NTW A;  3KCX A;  4MTG A;  5JJN B;  3H1K H;  4XDL A;  4JI0 O;  2XAF A;  1E79 G;  2XOK G;  1A32 A;  2P6J A;  1VQP V;  4PV1 B;  1LR1 A;  2QM4 A;  1Q90 D;  3GWO A;  4J7Z A;  5JCO A;  1JX9 A;  4JYC A;  2CH7 B;  2V1D A;  2N04 A;  2ZXW C;  5FLX N;  3VQW A;  2KSD A;  4JV5 B;  1JFF A;  3BEH A;  5L3F A;  1K73 W;  3JSL A;  4Z2W A;  3Q4H A;  1XMQ O;  4JI7 O;  3ZHT A;  1VQ4 V;  1EN5 A;  3B2E E;  4DV6 O;  2WAM A;  1XNR O;  1S76 D;  4O4H A;  1W59 A;  2A9H A;  5EBW C;  2FTK A;  3F5T A;  1NU1 H;  5A9G A;  3EVK A;  2VQE O;  4HBN A;  3E35 A;  3AG1 C;  4H44 B;  4N21 A;  2QWR B;  4F6R A;  1SZT A;  2VWK A;  2F23 A;  3PN1 A;  4DR7 B;  3UKM A;  4X62 B;  1G6U A;  3KCY A;  1S77 D;  2IW5 A;  3JAK B;  3OGI B;  4UCS A;  2Z0A A;  3KZI Z;  1SQQ H;  4LWS A;  4O4J B;  1TVK B;  2L6L A;  1AP5 A;  4XDK A;  1GKF A;  5LA6 A;  5IYC O;  1AR1 B;  3H1J H;  1M1K W;  1BL8 A;  1AI4 A;  2RMK B;  3SGI A;  3ZMU A;  1J5E B;  4MVO A;  1OHH G;  1W0J G;  2IU0 A;  3DC5 A;  4I9W A;  4RO2 A;  4JPR A;  1UPG A;  1XMO B;  4MW3 A;  1ZWI C;  4U3J B;  4O4L B;  1NTZ H;  4JYA B;  1D2D A;  4J42 A;  3B09 A;  1N33 B;  2PF4 E;  3L75 H;  2O57 A;  3AK1 A;  1KU9 A;  2UUB B;  1SRY A;  3SYA A;  3M7M X;  4DR3 O;  1VQ5 V;  4DV7 O;  5KA5 A;  4MSW C;  2ZE6 A;  3BCC H;  2UUA O;  2XAS A;  3OMI B;  1XNQ O;  3RFR A;  3SYQ A;  2P67 A;  4ZI7 A;  2PY5 A;  4RQE A;  3E83 A;  4KHP B;  2F4V O;  1PM9 A;  4J41 A;  1GN2 A;  4MT8 A;  3E86 A;  2X6C A;  3IC9 A;  4DR1 B;  3ZRV A;  3BAB A;  1HNZ B;  4Q6G A;  4UCU A;  4I50 A;  3MD0 A;  5CA0 B;  4PA4 A;  4FLU A;  4X8A A;  3N2K A;  2Z5U A;  3P32 A;  1DGS A;  2UXD B;  2QDO A;  4PDM A;  5LGU A;  3AEI A;  3ZMS A;  3JAL A;  4H13 B;  3CEI A;  4AIL C;  5JQG B;  1Z5V A;  1KYO F;  2VRZ A;  4DR6 B;  2Y4U A;  3F5W C;  4D7S A;  3DXR A;  4I4T B;  2B1G A;  1PV0 A;  1VMG A;  4TV8 A;  1NQT A;  4DV4 O;  1MOF A;  4JI1 O;  3A2F A;  4KHP O;  2QWQ B;  4B08 A;  1MA1 A;  4I9Q A;  4JI8 B;  4DR4 O;  4D6T H;  1OCC C;  3CX5 F;  5CB4 B;  4AI8 A;  3WFV A;  1AJN A;  2CTQ A;  4NXN B;  2QKC A;  1KKC A;  3SYC A;  3ABM B;  2WLK A;  2EIM B;  1YTF D;  5KAF Z;  2YIB A;  2HEP A;  1SA0 A;  5E79 Z;  4DW0 A;  3LDD A;  4R50 A;  4X1K A;  4JI0 B;  2X7R B;  3SJB C;  4H0L B;  2XAH A;  4J7K A;  4U7N A;  3S3W A;  5C8Y A;  3BA8 A;  1V54 C;  4O4L A;  1H2M A;  3AG3 B;  4IHJ A;  1TUB B;  1JCH A;  4MVZ A;  4YJ2 A;  2WA3 A;  3D36 C;  4X64 B;  1H2L A;  4JAS A;  1YEW A;  4X20 A;  1TA8 A;  4GX2 A;  2P7T C;  3L70 H;  1O9G A;  2ZNJ A;  2GDS A;  1SQF A;  4NVP A;  3ZX6 A;  5IYZ A;  3RN4 A;  3W7X A;  1HNW B;  3H1L H;  2EX3 A;  3BAA A;  4X65 B;  4FFK A;  4EB6 A;  4LFB O;  1NZ6 A;  5CBG A;  3O9O A;  4HNA A;  2Y0P A;  1YZB A;  3K0D A;  1K7D A;  1IDS A;  1K3E A;  2LJ2 A;  2ZCE A;  1RSO B;  5CA1 A;  2BTQ B;  4YIO A;  5H6R A;  2UUC B;  2PI5 A;  1WJZ A;  5JH7 B;  2ZR3 A;  5LOV A;  3QF7 A;  1JR9 A;  2LW7 A;  1M56 C;  1GMG A;  5FL7 G;  4DK1 A;  3OE7 G;  1P84 F;  3KKY A;  4TT3 G;  4X1I A;  4JTA B;  2JK5 C;  4XDJ A;  4RUF A;  2P4K A;  3K5M A;  4UCT A;  4I0X B;  5IYB O;  2A79 B;  2LGW A;  4TSF G;  4CC6 A;  4UFZ A;  2HJD A;  3CCS V;  1I5Y A;  4IHJ B;  3OW2 U;  4ICG A;  5CA1 B;  4LFB B;  5A2Q N;  5KHI A;  5BZB A;  3F7V C;  4JGS A;  4LCU C;  2YUA A;  3SYO A;  1N0N A;  2AHY A;  1EFR G;  3T1H B;  5H9C A;  4WF9 V;  4X1Y A;  1AIL A;  2HVK C;  4OPA A;  2VQE B;  2YSU B;  3OTO B;  4DUZ O;  1M93 A;  2E75 B;  3LSU A;  2DYS B;  3JAT A;  3ZHU A;  1R3I C;  4JZG A;  1VQM V;  4DV6 B;  4GKK O;  1AI6 A;  1OCO C;  5IYD O;  4NB5 A;  4FM2 A;  2GUZ B;  3K0G A;  5F2V O;  4D7T A;  4FZ0 A;  1PL0 A;  1IVS A;  1DLB A;  5LGT A;  5C93 A;  3CWB H;  4DR7 O;  1JFF B;  2YXL A;  4J9Z B;  4QGP A;  3AG4 B;  1OZ0 A;  4EFB A;  1L0N H;  4DR6 O;  3RYH B;  3SJC C;  5IJ0 A;  3DGE A;  1NJI W;  4JYA O;  2ITC C;  3G4S V;  2ARH A;  3EXA A;  2AW9 A;  1XDC A;  1KMI Z;  1Q43 A;  5BMV A;  1LUV A;  4JAA A;  1NBM G;  4LF9 O;  5LMU O;  4ABM A;  1K92 A;  4FLV A;  3HKC B;  5CMU A;  4PA9 A;  1H8H G;  1H8E G;  2BOC C;  5DEC A;  5L3G A;  4DUY O;  2NN4 A;  1R3J C;  3LNM B;  3FB8 C;  3R66 A;  2EBO A;  2ITD C;  4QJF B;  4LNU B;  3ZMV A;  1VQ6 V;  4B3S B;  1WLE A;  2F1M A;  2E3C A;  4LFA B;  4MS2 A;  3UO3 A;  1QR9 A;  5LHG A;  1PP9 H;  3OEE G;  3ZIA G;  4WCE V;  2QGN A;  1M5I A;  3ABL C;  3ASO B;  4YY3 O;  3T4D A;  3OFN G;  2BSK B;  1XL6 A;  5BR8 O;  3LDC A;  3OGC C;  1Q6I A;  1SQB H;  1QR8 A;  4NYK A;  1F4N A;  4B3T O;  4FIP C;  4I0X A;  2HG5 C;  3ZMZ A;  1D5A A;  1H2S B;  3OT7 A;  3ABT A;  3SPJ A;  4X1I B;  4LF4 O;  1FAF A;  3CCM V;  1B04 A;  4X1K B;  2WA4 A;  3RYH A;  4PD4 F;  1XI1 A;  4JI5 O;  3QNE A;  1BSM A;  1KP3 A;  4YJ2 B;  5KHK A;  5FNV A;  2EIJ B;  3HKE B;  3CCR V;  2JVD A;  3BA9 A;  2ATK C;  2E5L B;  3ZN0 A;  1PNK A;  4JYY A;  2YC0 A;  1HNW O;  3W7S A;  2A3Q A;  4TV9 B;  1B3Q A;  1Y4M A;  1PNL A;  4O4J A;  1WB8 A;  1S5L Z;  1F4M A;  1R6N A;  4GYC B;  4DV3 B;  3CJH B;  1OCO B;  1Q6H A;  4L8J A;  1VQK V;  3JAM N;  1GN6 A;  2LGQ A;  4P30 A;  1QBZ A;  3ZCC A;  2ADQ B;  2W6J G;  3HB3 B;  4O4H B;  5CBH A;  2Z3Y A;  3E2E A;  1L1F A;  3GB7 C;  3RWR D;  1HNX O;  2Q68 A;  4U3J A;  1SZX A;  3ZHS A;  2A06 H;  1V9P A;  3JAW A;  4E4E A;  4DR2 B;  1IBK B;  4GKJ B;  3K5N A;  4B3S O;  5BMV B;  1IBM B;  5LP6 A;  3ZED A;  2YXY A;  4MW8 A;  4LP8 A;  4JI6 O;  3RYF A;  1FFX A;  5KA6 A;  3LUT B;  4DR5 B;  1AJP A;  4IL6 Z;  4CBC A;  2CGO A;  3G80 A;  1Q3E A;  3J7A U;  3BFR A;  2WLI B;  3L72 H;  3K79 A;  2Y48 A;  4UCV A;  5EC2 C;  1IX9 A;  1SKV A;  2A0L A;  1F7Y A;  2UXN A;  2GUZ A;  3HKB B;  1S3J A;  1HWY A;  3FAV A;  4W4K A;  3RBZ A;  5HFM A;  2XAQ A;  3K57 A;  4Q20 A;  4K8X A;  3CRM A;  2BE3 A;  3VBB A;  3JYC A;  1K97 A;  3ABK C;  4BIU A;  3ZHQ A;  4JTC B;  3CMA V;  3H01 A;  4TV9 A;  4DV1 O;  3JAL B;  4DR1 O;  1BGY H;  1WP8 A;  5IDJ A;  2Y0I A;  2PI4 A;  1TAE A;  4LF6 B;  1H2N A;  4KP4 A;  5EZY A;  2YEV A;  4ZKI A;  4B7E A;  2DE0 X;  3W7U A;  1AB3 A;  1XL4 A;  2LO1 A;  4TUY A;  5LMN B;  3OTF A;  1N32 O;  4GX5 A;  2HP8 A;  1TUE B;  3QO5 A;  5J2U B;  1N36 O;  2ZD9 A;  4JI2 O;  1JMK C;  4UV9 A;  1ZL8 A;  1XHX A;  1BZK A;  3ABU A;  4JYB A;  1Q8I A;  1BT8 A;  2CK3 G;  4LF7 O;  4LH6 A;  4O2B A;  1VP7 A;  2V7Q G;  2B1I A;  3N2K B;  1SET A;  1M57 C;  1VQL V;  1KD1 W;  2Q73 A;  1VF6 C;  4Z1V A;  2W6I G;  4DV0 O;  3IC7 A;  3STL C;  1KC8 W;  1RPO A;  1ROP A;  1NR1 A;  1JQ0 A;  1BCC H;  2R9I A;  3IGA C;  2EUL A;  1H2G A;  3UQ8 A;  3E22 B;  1S72 V;  5LP6 C;  4IYH A;  1QLE C;  2XAG A;  3DC6 A;  4JZ2 A;  3AG3 C;  2W0X A;  3SPH A;  5B1B B;  1VQ8 V;  3ZHR A;  3I56 V;  4X1Y B;  3CME V;  3MDS A;  4FK5 C;  3THO A;  3IJ4 A;  4WFG A;  2CH7 A;  4LF6 O;  4MTO A;  1JA8 A;  5H5N A;  4L87 A;  1GH6 A;  5LYJ A;  4GT1 A;  4DUZ B;  1OCZ C;  4BR6 A;  2FML A;  1H38 A;  4JI5 B;  3E89 A;  3CXC U;  2HR3 A;  2AGA A;  1N36 B;  4HAM A;  4J10 A;  4KUM A;  3VQX A;  4CH4 A;  1UJW B;  1BHB A;  2DYR C;  4X64 O;  2YS8 A;  1M4U A;  4CS3 A;  4TWK A;  3OD4 A;  4PJ0 Z;  1E1R G;  3WB0 A;  5KLV H;  2Q0A A;  3ZJZ A;  2Q0O C;  1XOU A;  3B77 A;  1YDX A;  3F7Y C;  1UFI A;  4DV7 B;  3B8M A;  4OXS A;  5D5P A;  5EC1 C;  1VQO V;  2DN9 A;  1N33 O;  2EIK C;  5B1O A;  2AXT Z;  1OCR C;  3I55 V;  3APO A;  2PUS A;  1EZV H;  1GO3 F;  1G4Y B;  4TQF A;  3JAS A;  3CRR A;  4FLW A;  1U97 A;  4I4T A;  2QWO B;  3N27 A;  4K3A A;  4WFH A;  1PL4 A;  3JCU Z;  1Y74 A;  3SPG A;  4LNU A;  2XAJ A;  2ZM6 O;  4X88 A;  5B1A B;  1W0K G;  3D3Q A;  4K0K B;  3ETE A;  3WB2 A;  1YF2 A;  5BR8 B;  4JI1 B;  2JS3 A;  1FXH A;  5IJ9 A;  4N23 A;  1FPO A;  1MZF A;  4ZHQ B;  1KB9 F;  3GWK C;  3N2G A;  4UVC A;  2HKO A;  2UXD O;  2YI8 A;  4JI3 B;  1K4C C;  3TJT A;  5JQG A;  3ABK B;  1ZSP A;  4P9O A;  3SPC A;  3SJQ C;  2NNU A;  1YJ9 V;  4PDL A;  4BW9 A;  2HVJ C;  1RSO A;  3HKD A;  3C90 A;  1WA8 B;  2DWD C;  1XIL A;  2IBZ H;  1FXK A;  4O2B B;  1Q5O A;  2QKA A;  1R3L C;  2ZE5 A;  4FJC C;  1NKD A;  4ZIB A;  3CCJ V;  1GN4 A;  2UXB O;  1LNQ A;  4FPP A;  4DV3 O;  2JGD B;  2DOS A;  2F93 B;  1L0L H;  2OT5 A;  3MAQ A;  1B06 A;  1R3K C;  1M56 B;  4LF8 O;  4X66 B;  4OPH A;  3CCV V;  5LL6 Y;  4BAY A;  1QNM A;  1WB7 A;  4LFA O;  5B1B C;  3K04 A;  4QPK A;  4IIJ A;  5L3D A;  1FXK B;  1LUW A;  1V54 B;  5JVD B;  1YI2 V;  3D36 A;  4NR1 A;  4LF7 B;  2RQ6 A;  5EYP A;  2XHB A;  3DSQ A;  5ITZ A;  2DQ0 A;  4EEQ A;  4FLX A;  1IUR A;  3IFX A;  4CH6 A;  1CP9 A;  3P3P A;  4ZOL A;  3JD4 A;  2HLD G;  1NH2 D;  1AVM A;  3A0R A;  5GW7 A;  5KHH A;  5IY5 C;  3H1I H;  3ZMT A;  1SER A;  3D8C A;  1COW G;  1ORQ C;  3ASN C;  4EKW A;  3AK2 A;  5LOV B;  2HJF C;  2RN9 A;  4UV8 A;  2YIA A;  1E1Q G;  1FFX B;  4FM0 A;  3LDE A;  1SQV H;  2N05 A;  5LGN A;  1N0J A;  5E1A C;  1MSW D;  5JJJ B;  1XMO O;  1MMM A;  3ZRW B;  4QE7 A;  3JAT B;  2B9Z A;  1X59 A;  2ODM A;  1P49 A;  2LFS A;  2ZKO A;  2JDI G;  2Q7E A;  1FXV A;  3DXR B;  2JJ1 G;  4PI2 A;  2L35 A;  1P7B A;  1KBH A;  2Y69 B;  2ZIN A;  1G1X B;  1Q6U A;  3UT5 B;  4Z1M G;  4JF3 A;  1DTO A;  4DR2 O;  1IBK O;  2F66 C;  4G2K A;  4GKJ O;  5LMU B;  3L73 H;  1BS3 A;  4FLZ A;  1WN7 A;  1Z2G A;  2X6B A;  3BVO A;  5EK0 A;  4UVA A;  1YHQ V;  4NTY A;  4AHC A;  1QLE B;  1THZ A;  4KFM A;  3WU2 Z;  5EIB D;  3ZRW A;  3U10 A;  2OCC C;  1WNS A;  4RAI A;  2D2C B;  4UCO A;  1FJG O;  2B5U A;  2YID A;  4DV2 O;  2Y4T A;  5EZY B;  3JAR A;  1OJH A;  3UT5 A;  5HFL A;  4YY3 B;  4JAV A;  3OEH G;  4KL1 A;  4PDR A;  4DR4 B;  3ZS8 C;  3JD3 A;  2N74 A;  1DF4 A;  3OR6 C;  1Q7Y W;  5KHJ A;  3CRC A;  1RM1 C;  2UXX A;  2P4V A;  2XND G;  1KUQ A;  1ENV A;  1EN4 A;  1ZLZ A;  2PGG A;  3CSX A;  2QM7 A;  5LMN O;  2JIZ G;  1YIJ V;  2M6Y A;  1W2B U;  3FB6 C;  5JVD A;  4DV0 B;  5B66 Z;  2GTA A;  3K5O A;  1GM8 A;  1IZ3 A;  5DM6 V;  2E76 B;  3P30 A;  1FJG B;  1NH2 B;  2H8P C;  2ZIO A;  5IWA B;  5GTH Z;  2IJJ A;  1MZE A;  1F51 A;  5B1A C;  1VAR A;  2IJH A;  3JD2 A;  1I7F A;  1FXK C;  2LQT A;  1FFT B;  2CGN A;  2Q7G A;  2QE7 G;  4DR3 B;  2FL4 A;  5B3S C;  1YJW V;  3RT3 C;  2WLH A;  4CS2 A;  4I55 A;  3APQ A;  3WG7 C;  2EIL B;  4ZOL B;  2AZ2 A;  2WPD G;  4UVB A;  1AP6 A;  4DR5 O;  2BCC H;  4G28 B;  1X4T A;  3G6B A;  2D3O W;  2IJK A;  1URF A;  5JJE B;  1WA8 A;  2YDE A;  2UUA B;  2WWW A;  4PI0 A;  1HNX B;  5KUK A;  3A0B Z;  1I0H A;  4IT5 A;  3K58 A;  2OTL V;  2X6A A;  4QIW F;  1WPX A;  1EN6 A;  4WBN B;  3G6E V;  4LH7 A;  3W7T A;  1S0V A;  3CCQ V;  4GZR B;  2R9A A;  2ADP A;  2OCC B;  3BPZ A;  5BY1 A;  1FKA O;  3K03 A;  5IJ9 B;  2CTR A;  2FYU H;  1EZJ A;  4BIZ A;  3FYE B;  3B8N A;  2MK3 A;  4CS4 A;  1ZX3 A;  4OX9 B;  2OTJ V;  4MVM A;  2ZIM A;  2WLN A;  1JOY A;  3OMN B;  4U3F H;  3RW0 A;  3OUF A;  4E2L A;  1BE3 H;  3E8B A;  2HFE C;  4W4L A;  2JRI A;  4MTF A;  3FFQ A;  2XT9 A;  5KMG B;  4YHH B;  4J11 A;  5FNV B;  1OCC B;  2DJV A;  4UXN A;  3ETQ A;  3FYI B;  3CB2 A;  2KG7 A;  2LP7 A;  1SQG A;  3B40 A;  2Q8V A;  5KX5 A;  5L3B A;  1AR4 A;  4WFE A;  1ZTE A;  1J95 A;  3A8T A;  2UU9 O;  1SF9 A;  2PYL A;  3U0Z A;  5GTI Z;  1HP8 A;  4BIO A;  3RYI A;  4R6Z A;  3ZRS A;  2PZS A;  3T2M A;  4LFC B;  3ICX A;  4WFA V;  1ZAU A;  4O2A A;  3X2Q B;  2A7W A;  2DYR B;  1NTM H;  4J80 A;  2UUB O;  1JVM A;  1XUQ A;  3STZ C;  1HR0 B;  5K1X A;  5KX5 B;  2YEV B;  1DF5 A;  4PA3 A;  4IIJ B;  1DK1 A;  1VQ9 V;  4WBN A;  3SR2 C;  4PA6 A;  1K4D C;  2EIK B;  1V55 B;  4B7K A;  3EFF K;  1WP7 A;  1B6Q A;  2PTM A;  2GSM B;  4H37 A;  4YXW G;  3TK1 A;  4X66 O;  3CE2 A;  2CAZ C;  3ETG A;  5C8Y B;  3JAS B;  4DUY B;  2V4D A;  3CJH A;  4FM1 A;  1SQX H;  3HKC A;  3E8H A;  3H9V A;  5CBF A;  2CE4 A;  2AHZ A;  4O4I A;  2EIL C;  1IBM O;  3FKS G;  1XQ8 A;  3HR0 A;  1SC5 B;  2HHH B;  1VIB A;  3FAV B;  3RYC B;  2IM9 A;  3FB5 C;  1EBO A;  4ZI7 B;  5H6Q A;  3DTU B;  5LXT B;  2F43 G;  4WFB V;  4CZZ A;  1JJ2 U;  5EYP B;  3VQV A;  2CUG A;  3ZN1 A;  1IXM A;  2OCH A;  4JAU A;  3G71 V;  3BRC A;  4RQF A;  2Q67 A;  5L3E A;  1MG1 A;  3JCZ A;  3JD1 A;  2DW4 A;  2ZE7 A;  3TCU A;  4R7C A;  2GBO A;  1BMF G;  3N2G B;  2QWN B;  5AG2 A;  2EZP A;  4LFC O;  2BTO A;  4O4I B;  2DQ3 A;  2JEU A;  1Q81 W;  1WAZ A;  4YJ3 A;  2AZ0 A;  1Y74 B;  3W7W A;  1SA0 B;  4LWS B;  5LHH A;  1JPX A;  2BTQ A;  3AG1 B;  3AG2 C;  4IYI A;  3U11 A;  2DYS C;  2QSA A;  1M90 W;  2K1E A;  1YCI A;  1VQN V;  1CXZ B;  3JAK A;  4QE9 A;  3T1Y O;  5KMG A;  3OR7 C;  4I7Z B;  3CC2 V;  5KUM A;  3CS5 A;  5EBM C;  1NT2 B;  3CCL V;  1H2K A;  4LF5 O;  4NXM O;  4FVM A;  5TIS Z;  1IBL B;  1QHT A;  1ZUQ A;  3AK3 A;  4B3T B;  3ZBH A;  2YIB D;  4UB8 Z;  5IYZ B;  2OIG A;  5FPR A;  5JWP A;  1U96 A;  4RUE A;  1N34 B;  4DRX A;  2QR4 A;  3K9A A;  2G38 A;  3PJS K;  1US6 A;  1AI5 A;  1ARO P;  4DV5 B;  1PNM A;  4AQY B;  3D3I A;  3KG2 A;  3AG4 C;  4YHH O;  4I55 B;  1R73 A;  3WG7 B;  5LA6 B;  2H94 A;  4YIP A;  2FB5 A;  2JGU A;  1YTF B;  4DYL A;  1NS1 A;  4B3M B;  4DRX B;  1GRJ A;  5D5Q A;  1Q82 W;  1GAX A;  3CCU V;  1KQS U;  4I50 B;  2ZQM A;  3RYI B;  2GTS A;  3TET A;  1YJN V;  1GM9 A;  3ABL B;  1IBL O;  2IJI A;  3X2Q C;  1KP2 A;  3SDL A;  4CH5 A;  5KAI Z;  4C7U A;  2Y69 C;  1R6T A;  3LSQ A;  4HNA B;  1L8D A;  1RPR A;  1YXB A;  1GM7 A;  2EJ7 A;  4MVU A;  1XBL A;  1I08 A;  2P06 A;  1ZL8 B;  1QLN A;  2Q69 A;  3OMA B;  2W0F C;  3RYC A;  4JI4 B;  3ZRX A;  3RVZ A;  1N32 B;  2C2A A;  1XRE A;  3CYO A;  2CTW A;  1Y67 A;  5FPO A;  1K5Q A;  3R65 A;  2PYJ A;  1Y76 A;  3K3W A;  2VQF O;  4MTX A;  3CCE V;  4X89 A;  1N4C A;  2QM8 A;  2RCV A;  3SJA C;  1R6K A;  3MHH C;  2UXB B;  5B1N A;  4B3R O;  2R72 A;  3T1C A;  5L3C A;  2QKS A;  4EFE A;  2EIN C;  1SS3 A;  1NTK H;  1RP3 B;  2F95 B;  2WLM A;  3ML0 A;  2GV9 A;  3C3T A;  1GK9 A;  4LBE C;  3ASO C;  4K0K O;  2YIC A;  2X0L A;  4CH3 A;  4OX9 O;  4JI3 O;  4CC5 A;  2QA4 V;  4EB6 B;  1K9M W;  1YVW A;  2QEX V;  2EIM C;  4J7J A;  5B5E Z;  4R8C A;  2P5O A;  2HHH O;  2QWP B;  2OYQ A;  2UU9 B;  3K5L A;  3CHX A;  1QU7 A;  3OAA G;  4UB6 Z;  3QO7 A;  3CXH F;  4LC1 A;  1NR7 A;  2K9P A;  4B3M O;  4JI6 B;  2P90 A;  3UO2 A;  1XMQ B;  4JI7 B;  2CDY A;  3RVY A;  3SYP A;  2EIJ C;  4LF9 B;  5CN0 A;  3K9S A;  3L71 H;  4YJ3 B;  2LFR A;  3M99 B;  2CTP A;  1CPY A;  4ASU G;  1KEC A;  2EJR A;  4FFB B;  1AJQ A;  5CB4 A;  3CP1 A;  1KKD A;  1T5E A;  1SQP H;  2IH1 C;  4X65 O;  2F4V B;  1XNR B;  2QJ1 A;  3LSS A;  1I5X A;  5LBQ A;  2UUC O;  3JAR B;  2XUM A;  1I94 B;  4IGG A;  3T1Y B;  2RNB A;  1QQC A;  3K06 A;  3H1H H;  2R9R B;  2ETN A;  2E74 B;  3J80 N;  3HPL C;  4K8Z A;  1YIT V;  4GCZ A;  3T1H O;  1AI7 A;  4NXN O;  4HZ3 A;  5EIB C;  4PA7 A;  1YSC A;  3NXS A;  1EM1 A;  3FB7 C;  4O2A B;  1HDJ A;  3ZHV A;  4BWA A;  3O65 A;  4PEL A;  4F6R B;  4H33 A;  2OWO A;  4DXW A;  3NR7 A;  4X9Q A;  4RWU A;  1OV9 A;  1VF6 A;  2WLL A;  1BQ0 A;  1HW7 A;  3B4S A;  2E5L O;  1M57 B;  5IJ0 B;  1Y76 B;  1R1B A;  4JTD B;  2EIN B;  2KKW A;  5BXZ A;  1GN3 A;  3GVM A;  2ILM A;  2VQF B;  2KG7 B;  5H2F Z;  1MAB G;  3HKE A;  4U7O A;  4QNH B;  1QVF U;  1MSD A;  2ZXW B;  2RDC A;  2Q6A A;  4LF8 B;  3SPI A;  4BW5 A;  2FKX A;  1K33 A;  3TXQ A;  1RM1 B;  3E22 A;  2JEX A;  5J2T B;  5J2U A;  4GX0 A;  2UXC B;  1I94 O;  3BY6 A;  5LP6 B;  4LF5 B;  4NXM B;  2ZT9 B;  4JV5 O;  4GKK B;  5JCO C;  1VQ7 V;  4A5U B;  4DV5 O;  1TUB A;  1XNQ B;  1JJO A;  3RYF B;  1PPJ H;  4DV1 B;  2R70 A;  2LW1 A;  3JD0 A;  4KXR A;  2Q7H A;  3JSN A;  2BSK A;  3BHP A;  3CRA A;  4P2Z A;  1WPB A;  2ZR2 A;  1TGO A;  5JH7 A;  4MVQ A;  1Y6X A;  3OUS A;  1V55 C;  2OIE A;  3EHB B;  4UUJ C;  4FLY A;  4FLT A;  1Q86 W;  4OGQ B; 
#chains in the Genus database with same CATH homology
 1Y76 B;  1Y76 A;  1VF6 A;  3B40 A;  1ZL8 B;  1VF6 C;  1ZL8 A;  1Y74 A;  1RSO B;  1Y74 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...