1Y74A

Solution structure of mlin-2/mlin-7 l27 domain complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
57
structure length
57
Chain Sequence
LGLERDVSRAVELLERLQRSGELPPQKLQALQRVLQSRFCSAIREVYEQLYDTLDIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords lin 7 homolog b
publication title A unified assembly mode revealed by the structures of tetrameric L27 domain complexes formed by mLin-2/mLin-7 and Patj/Pals1 scaffold proteins.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 22
structure length 57
sequence length 57
chains with identical sequence C
ec nomenclature
pdb deposition date 2004-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.650 Mainly Alpha Orthogonal Bundle Helix Hairpins L27 domain 1y74A00
1Y76B 1RSOB 1Y76A 1ZL8A 1VF6A 1ZL8B 1Y74A 3B40A 1Y74B 1VF6C
chains in the Genus database with same CATH superfamily
1YTFB 1M57C 1Y4MA 1IDSA 1KECA 2YXHA 1UFIA 2ZQMA 5JH7A 5LXTB 1Q3EA 1O9GA 4DK0A 1HNZO 1EZVH 1MG1A 1I0HA 3E86A 4WFFA 4K8XA 4GKJB 3K0DA 3OGCC 1THZA 1S3JA 5EZYB 1QU7A 1L1FA 3AG1B 3FX7A 3JARB 2EZPA 5BR8B 3R66A 4PA4A 4DO2A 4L87A 1GN6A 4MVZA 1FFTB 4TV9A 3UO2A 3TCUA 1H8HG 2JJ2G 1VQ4V 1XILA 2DOSA 3ZMTA 3ZMSA 1W2BU 2QWOB 4GT1A 3WB2A 5B1AB 3K79A 4BW9A 4DYLA 1SERA 5CA1B 2NN4A 4X1IA 2Q67A 2GHYA 3CC2V 3LSUA 3CPWU 4JYBA 4PDRA 2E74B 2YIBA 5JQGB 3JASB 4IIJA 3RYHA 3OEHG 5DEDA 2RCVA 4DV4B 2N05A 3ABMC 4QGPA 1NVPD 2WWWA 4I9WA 2UXCB 1OCCC 1P4RA 2QKAA 2DMXA 2XAJA 3SDLA 4FFBA 1D5NA 5BXZA 4DR1O 5A9GA 1QR8A 3UO3A 3K57A 3FD9A 3JD1A 3ASNB 4IHJB 4D6TH 3FFQA 3K5MA 4QJFB 4X1YA 4JI7B 3ICXA 1SA0A 3P32A 2MW2B 1YCIA 1BE3H 1EN4A 1K3EA 2XNDG 1OCOB 4PA3A 4O4IB 1NU1H 4HBNA 1H2SB 2R9RB 3FB5C 4LFBO 3B8MA 1B04A 3I56V 3QO8A 4UCTA 3T4ZA 1RM1B 1PNMA 3WG7B 5C93A 2UUCB 1JJOA 1BL8A 3STLC 2DQ3A 3G71V 5LGNA 3CCJV 2BSKA 3L72H 4F6RA 1VQ6V 4TUYB 3ZRSA 5JJNB 4ZI7A 4LF9O 1JOYA 3NR7A 3L74H 4K35A 4LH6A 2QE7G 3AG2C 5LHHA 1PNKA 5L3FA 3CXCU 2X7RB 5B1BC 2DYSB 2WLIB 3EFFK 4JI3B 1QLNA 5AG2A 2ZNIA 5KHHA 1X59A 4K0KO 1Z5WA 2QTSA 4O4JB 4DR5B 1R1BA 2IJIA 2RMKB 3FB7C 3O9OA 4DV3O 1SQPH 4R7CA 2QWQB 1YVWA 1M57B 1YDXA 3OMNB 4P9OA 1JVMA 4Q6GA 1OCRB 2E5LO 4FJCC 1N33B 4GLXA 1AR4A 1H38A 1E1RG 1TVKA 2UUBB 5KA5A 4X66O 4WCEV 4LF6O 1BSMA 1WA8B 5BMVA 1TUBA 1BQZA 2E76B 4JI1B 4LFCB 3H9VA 3TXSA 5H6QA 4OX9O 5EC2C 2OTJV 5B3SB 1F7YA 4J10A 3JAKA 5IJ9B 3ZBHA 4FM2A 1HNWO 2AGAA 1KP2A 3ABLC 1OV9A 1BCCH 2PY5A 3WB1A 1KKCA 2ARHA 3LSQA 5J2UA 2BE3A 2Y0PA 5IWAO 1YXBA 2LGWA 4KXRA 4X9QA 4JZGA 4B7KA 3CXHF 3ABMB 2ZT9B 2AHZA 4JI4O 1NI8A 4NXMO 3KCXA 2HJFC 2UU9O 3IGAC 4JI8O 5LXTA 1AP6A 2RJZA 4UVBA 5FLXN 4MS2A 5LMUB 4DW1A 5EBWC 2Y0IA 3K9AA 4MTXA 1H2GA 2EX3A 2Q5ZA 3K06A 1P84F 5EZYA 3JARA 4DV0O 4JTDB 2QJ1A 4KHPO 1P7BA 3WB0A 1SQGA 1ZWIC 3OUFA 2XAQA 2HHHB 5CBGA 3SJAC 3RWRD 1FJGB 3K58A 4FLYA 4MVUA 4X1KB 4CH5A 2D2CB 3G67A 3L9DA 2AZ0A 1TA8A 3DTUB 1XNQO 5CA1A 2ZIMA 2GV9A 2DQ0A 4Z1VA 5JQGA 2YIAA 3JASA 5JVDB 1WPBA 2CTWA 3SJBC 3AK3A 5IYZB 3JAWA 3ZIAG 3SR2C 1FXKC 2F43G 3CC4V 4CBCA 1IBLB 5B1BB 3B40A 1H8EG 1BMFG 4Q20A 2XOKG 4FFKA 5CA0B 3SPJA 1NQTA 3I5DA 1FXHA 4IHJA 3ZHTA 1AI4A 1LR1A 2QEXV 2OIEA 4RUFA 1RPOA 2XHBA 1M93A 5CBHA 4O4IA 1XDCA 1XHXA 3Q4HB 3D36A 2P4VA 4CS2A 1M4UA 2F1MA 1NR1A 4LF7B 4TQFA 4F4LA 3CCMV 1EM1A 2Y69B 1HDJA 4R50A 4RO2A 4TUYA 2ZR3A 4BIOA 4BAYA 2XAGA 1JQ0A 2JGDB 2Z0AA 4W4KA 3K08A 4JGSA 3W7XA 2EIKC 4DR2B 1F4NA 2UXDO 1I94O 4JTCB 3T1YB 2CK3G 2Z5UA 3FKSG 2OCCB 2YXLA 3GVMA 4FPPA 1QBZA 5KUKA 4OXSA 4IYHA 1L0LH 4J80A 3E8GA 5LP6B 3U11A 4CC6A 3P3PA 4XDJA 3T4DA 4JI0B 4J9ZB 3K5NA 3LUTB 5IDJA 1S77D 4O4JA 4NXNO 4PI2A 3G4SV 1XOUA 2FYUH 1QVFU 1H2NA 5B1OA 2EIMB 4B3SB 3FYIB 2FTKA 2WLHA 3DSQA 3K5LA 4XDKA 3TK1A 2HLDG 3RVYA 3JATB 1F4MA 3CWBH 1WA8A 1D5AA 1WP7A 1Y76A 3B77A 4DUZB 3CS5A 4TWKA 2UXBB 3BAAA 3A0BZ 5E79Z 4OGQB 4BR6A 5DM6V 4QIWF 2A0LA 3E8BA 3LNMB 4DK1A 1U96A 2AXTZ 2NLJC 2OIGA 1NTZH 4JAAA 1IBKB 1R3IC 1IBMB 2WAMA 4IL6Z 1K5QA 2PTMA 2X6CA 4X62O 2CH7B 1WN7A 2ZKOA 2AW9A 3ZHRA 5IE9A 4YY3O 1FXKB 3ABUA 1W0JG 1HR0B 5HFMA 1NT2B 2GTAA 2VQEO 4X65B 2ZM6B 4DV1O 3TXQA 4LCUC 4J42A 3GB7C 1SF9A 5LA6B 4PI0A 4YIOA 4I55A 2YI9A 4WFEA 4DV7O 3JALB 4FLZA 1US6A 1A32A 1YJ9V 3JD3A 1SC5B 2QWPB 4JAVA 5KLVH 3LDEA 2K1EA 1VF6C 2ATKC 5HFLA 1FS0G 4RAIA 2XAHA 2JS3A 4B3MO 3BHPA 1XNRO 3GWOA 1COWG 2F4VO 4LNUB 2H8PC 1UPGA 4X1KA 2UXNA 4X89A 4DR7B 3FAVB 3CYOA 3WFVA 4DR6O 5JVDA 3THOA 4UCSA 5IYZA 3MD0A 2R9AA 2Q7EA 1V54C 2IBZH 3QTCA 2Y48A 2DWEC 4UV9A 2HFEC 3RYCB 3SJCC 4FZ0A 1Q6UA 4PHZA 4A5UB 5J9PC 1OCZC 1ORQC 3O65A 5CA0A 5B66Z 1N36B 4EB6B 2R72A 3B09A 1TGOA 3IJ4A 3ETGA 1MZFA 1FFXB 1GTOA 1VQ8V 1J5EO 1VQMV 4RWUA 5KX5B 3M7MX 4I4TB 1PL0A 4LWSA 5L3GA 1KP3A 2GDSA 5J2TB 4NTXA 1N32O 1R3KC 4WFHA 3DC5A 2Q68A 4ICGA 2P6JA 4UVCA 5IJ0B 1QLEC 2M7WA 1AI5A 5CA3A 4DR1B 4FMTA 4GX0A 2O57A 3AK1A 3A0RA 3JD4A 2EJRA 2LO1A 1CPYA 3ZHUA 1N4CA 2JGDA 2JJ1G 1DTOA 2Q9LA 2P06A 4PDLA 2EIJC 1N34O 1NTMH 2QDOA 4BIUA 4NTYA 2N74A 5JJEB 1PP9H 4KUMA 2DN9A 4JAUA 1WB7A 3L70H 1R6NA 1AVMA 2PUSA 5D5QA 3X2QC 1S5JA 1GM9A 5LP6A 2GSMB 4PDMA 5GTIZ 1IXBA 5EYPB 1YIJV 2E75B 5IYCO 2JEXA 1S76D 3C3SA 2IU3A 3AG7A 3AK2A 3MHSC 4LFAB 3C3TA 3CHXA 4GKJO 3EHBB 1DGSA 4O2AB 3T1CA 1GM7A 1ZX3A 3E89A 3JATA 2K9PA 5BR8O 1B06A 3H1KH 3SGIA 4U7OA 2CGOA 4LF8B 3FB6C 2GTSA 2PZSA 2CTPA 4CC5A 3RYFB 1M9NA 4MVQA 1QNMA 4PA7A 5JCOA 4BW5A 2FB5A 1I08A 3S3XA 5FNVB 1SRYA 2HJDA 4K3AA 2CE4A 1DF4A 3BEHA 2CH7A 2HG5C 3J80N 2YXYA 3UT5B 3F5TA 2YEVB 5LL6Y 1SQXH 1GO3F 2UXXA 1KUQA 2UXCO 4CS4A 2JDIG 1V54B 2QR4A 1NBMG 4HYOA 2W6JG 1OCZB 5LA6A 4DV2B 4JI7O 5LMNB 2Q4PA 1FPOA 1SQFA 3JALA 2ZCEA 1SZTA 4DV5B 3P3NA 4D7TA 1JJ2U 1PV0A 4U3JB 2W0XA 1PKXA 5LYJB 4CH4A 4JI6B 2WLKA 2UUCO 2X6BA 1MMMA 2IJKA 1V55C 4B3RB 1MSWD 3F5WC 1K97A 1NZ6A 3K0GA 3AG3C 2QTOA 2UU9B 1AILA 4DUYB 4JI5B 4JPRA 4LNUA 4WFBV 4UV8A 2D3OW 2P67A 2QGNA 3K3WA 4LF4B 4B08A 2F95B 4JF3A 3CEIA 3CRCA 3FAVA 1FAFA 5KMGA 4U3FH 2KG7B 3D3QA 1H2LA 5DN6G 3JSLA 4MVMA 4ZIBA 3N27A 3E35A 4P2ZA 2EIJB 1T5EA 3BCCH 1N0NA 2YI8A 5CB4A 4JI3O 1ROPA 4H37A 1XREA 3X2QB 3CJHB 4GKKB 4DR5O 4UCUA 1IVSA 4ZKIA 1SS3A 1G8MA 4DV6B 3ZRWB 4EB6A 1OCCB 2KQXA 1N33O 1BGYH 1FFXA 1Q86W 1AP5A 2PYJA 3R65A 1JX9A 2UUBO 2YSUB 5KX5A 1XHZA 3DC6A 2B1IA 4FVMA 4I4TA 2PI4A 4FLTA 3ETQA 3N2KB 2A9HA 4IYIA 2V4DA 4DR4B 1F23A 5J2TA 1VMGA 2WA3A 4X88A 2JGUA 4ZOLB 3ZN0A 3ZCCA 4JI1O 1NVPB 4JYAB 3ETEA 3N2GB 4LFCO 5IJ0A 3CB2A 2Q7GA 4I0XB 4PA6A 3ASOC 5ITZB 3LDDA 2EINC 1HW7A 5LHIA 2P22C 1R6TA 4I5SA 1MNGA 1Q6HA 2CDYA 4Z1MG 3QO7A 3CRRA 1Q82W 1W59A 2PGGA 3AG2B 1K73W 3K59A 3OMIB 1K5SA 3DGEA 1NR7A 3RN4A 3CX5F 2ZDIC 1NKDA 2PYLA 2DJVA 1SQVH 1V9PA 5EYPA 3ZS8C 4NB5A 2R70A 1KYOF 3T1HB 5LMUO 4DR3B 3KKYA 3OM3B 1OJHA 2E3CA 2ZIOA 4ABMA 3OGIB 4B3TB 4AQYB 1HNXB 4O2AA 4MSWC 1NJIW 3W7WA 3JAMN 3SYCA 3SYOA 5D5PA 2N04A 1Y67A 5H5NA 1QCEA 4LF5B 2P4KA 2QA4V 3OTOO 1R3LC 4MT8A 2HHHO 4PA9A 3RYFA 1FJGO 1V55B 3W7UA 2ZE5A 1E1QG 1KQSU 2ADQB 2QSAA 4Z2WA 5JH7B 5LGTA 1QQCA 3AG3B 1JPXA 3SPCA 5KHJA 3RFRA 1PD3A 3OAAG 1MABG 5FNVA 1YEWA 1KBHA 4PJ0Z 1VEWA 1Q5OA 1YJWV 4JV5B 4LBEC 2RNBA 1G6UA 1CXZB 1RP3B 1Q90D 1Q7YW 1Q81W 1B3QA 2YEVA 3ABLB 1IBLO 1KB9F 3HKBB 3TETA 4RQFA 1K4CC 1YTFD 3SYPA 2UUAB 2WLIA 1ZL8B 4GYCB 2BOCC 4KP4A 3RVZA 1BT8A 5L3DA 3CCEV 1XMQB 3UQ8A 4AILC 2L35A 4FLUA 4N23A 4IIJB 4DRXB 5GONB 4X64B 1DLBA 1VQNV 3H1IH 5LYJA 1AJNA 1I7FA 1CEZA 4LF7O 1O9HA 2L6LA 3AG4C 1RFYA 3HB3B 2CGNA 3JCZA 4FFBB 4AHCA 2A3QA 2Q0AA 4DV1B 3ZMZA 3GWKC 1XL6A 3VOUA 3CCUV 2BTQB 3W7SA 2QM4A 3D3IA 4L8JA 3E22B 4DV7B 3NXSA 3LSSA 1R3JC 4DR2O 3ASOB 1P49A 1Y74B 2KG7A 3JCUZ 3T1YO 3FYEB 2EINB 4YJ2B 5IJ9A 2VQFB 4GX1A 4I50B 2QM8A 4WBNB 3ABKC 3OMAB 5H6RA 4IGGA 2WLMA 4YHHB 3B2EE 4C7UA 1RSOB 4JI0O 2R9IA 5KA6A 2A79B 1E79G 1LUVA 4ASUG 1YF2A 4J7JA 5B1AC 3CRQA 3L75H 1ZAUA 2IU0A 3UCSC 2GUZB 1VF5B 3ZRWA 3QG5A 2LP7A 2H3OA 4B3SO 4JI2B 3MAQA 2ITDC 5L3CA 3M99B 1I5XA 4X20B 4D7SA 5F2VO 2ZE7A 1WP8A 2X6AA 2ADPA 3OUSA 4TOIA 4JTAB 2EBOA 3N2KA 2Q6AA 3VQYA 1XMOB 2AZ2A 4XBFA 4ZOLA 4WFGA 5H9CA 4DUZO 2IW5A 1DF5A 1KMIZ 2UXBO 1QR9A 1ZLZA 2JVDA 3IC7A 2MK3A 4PV1B 3ZX6A 4I0XA 3VQVA 1HP8A 4JYYA 5BY1A 2JRIA 3RYIB 3HR0A 1OCOC 5GTHZ 1IBKO 5ITZA 1AR5A 1IBMO 2HVJC 1EZJA 4E4EA 3PN1A 2BTOA 1Z2GA 3OW2U 4UCVA 1RM1C 2A7WA 1HNZB 4GCZA 2Q69A 4WFAV 4UB6Z 2IJJA 1TUBB 2EIKB 2P7TC 3UKMA 2LFRA 2G38A 1MA1A 1VF7A 1HR0O 4TT3G 2OWOA 3WU2Z 5EBLC 3CRMA 4X65O 2ZM6O 5LOVB 2XASA 2QWRB 4G27B 1DK1A 2LW7A 3PJSK 1AJQA 1AJPA 3OR6C 3ZJZA 2HR3A 3QNEA 1ZUQA 2M6YA 4H44B 1XUQA 3ML0A 4PDVA 4EKWA 1K34A 2B9ZA 1SQQH 1XL4A 3F7YC 3QO5A 1GN2A 1SZXA 1FD9A 1X4TA 2GBOA 2JK5C 2Q7HA 4WF9V 3DXRB 3Q4HA 5DECA 4RQEA 3RBZA 3L71H 2ZE8A 3AG4B 2BCCH 3D8CA 1I5YA 4JZ2A 2VWKA 1OCRC 3E8HA 2ZNJA 3BABA 2XTAA 4YXWG 3BRCA 3K9SA 3E2EA 4DR7O 3OT7A 3HKCB 3B8NA 2ZE6A 2P90A 4EFEA 3CRAA 2ODMA 1LNQA 2OT5A 4H0LB 1JA8A 4CZZA 5B5EZ 4LFBB 3IAYA 3BA8A 4R6ZA 4UCOA 3SYAA 3ZHQA 2EZOA 3ABKB 1PM9A 3HKBA 4FM0A 1J95A 5B3SC 4HNAB 2HKOA 5BZBA 1ZL8A 3HKDB 2VRZA 1N36O 2LQTA 4YIPA 3MDSA 2QM7A 3HKEB 4LF9B 2X0LA 4DRXA 4MVOA 4PD4F 1S5HC 5GONA 5FPOA 3KZIZ 4LC1A 1PPJH 3JAWB 1GK9A 1VQPV 4O2BB 1KKDA 2F66C 1L0NH 1NTKH 3H1JH 5JJJB 1MSDA 2BOBC 2OYQA 3K5OA 2VWJA 4K8ZA 3ZMVA 2YUAA 3SPIA 1D2DA 4LP8A 1U97A 2DYRC 2WA4A 4K0KB 1EBOA 2BTQA 4FLVA 4DV3B 1LUWA 3E22A 4FLXA 2FKXA 2Z3YA 3TJTA 2E5LB 1S5LZ 1Y74A 3AEIA 3T2MA 3OFNG 3STZC 4DW0A 4YJ2A 3KG2A 3J81N 4QPKA 2EILC 4I50A 4IT5A 4WBNA 2NNUA 4X66B 3IFXA 4DXWA 4LF6B 1WLEA 3OEEG 1RSOA 4DV4O 2JEUA 2P5OA 1VQOV 1AROP 2Q0OC 1FXKA 2LJ2A 1XQ8A 1YSCA 4GX2A 3ZRXA 2GUZA 4EEQA 5LHGA 2ZDIA 1WB8A 4OX9B 1Q6IA 5IYBO 1M1KW 1YZBA 2ITCC 4LFAO 4X20A 1SETA 3MHHC 5EC1C 4OPAA 1HNWB 2CTRA 4TV8B 4FLWA 4TQDA 2V7QG 2ILMA 2Q73A 3RGBA 2JIZG 5IWAB 1AI6A 4LF8O 2Y4UA 3TGUH 5KAFZ 3QF7A 3ZEDA 3M8AA 2C2AA 3CSXA 1BHBA 2LFSA 4JI4B 4NXMB 3RW0A 1EFRG 3G80A 4MTFA 5B1NA 3RYIA 1QLEB 1GKFA 5IY5C 5TISZ 3OTFA 4JI8B 1HWYA 4ZHQB 2IH3C 4FIPC 2QWNB 4OPHA 1OZ0A 2XT9A 4I9QA 2ZINA 2YIBD 3VBBA 2RQ6A 4YJ3B 1Y76B 3VQWA 1P7GA 3CD6V 2Y69C 1AR1B 3KCYA 1BHAA 2YICA 4DV0B 4NYKA 4KHPB 3APQA 4H33A 5FPRA 3SJQC 5CN0A 5JWPA 3K03A 5LOVA 3RYCA 1TAEA 2DE0X 4TSFG 2OCHA 4DV2O 2FMLA 5LMNO 3E83A 3H1HH 2QKSA 1YI2V 1BZKA 3IC9A 2OCCC 1AB3A 4DV5O 4B7EA 1BS3A 1K92A 4QPJA 1XNQB 5EBMC 1KC8W 5H2FZ 1MZEA 5K1PA 1VQ7V 1Q43A 1XI1A 5LP6C 4O4HB 3SYQA 5KHGA 5C8YB 3SPGA 2B1GA 4JI6O 1FXVA 1GN3A 3VQXA 3FB8C 3DXRA 4B3RO 4UXNA 3RT3C 2F93B 4J9YB 1EN6A 2EIMC 4I55B 4DUYO 4UFZA 4JI5O 2WLNA 1WAZA 4NTWA 2DYRB 4LF4O 3HKCA 1L8DA 3U10A 1K9MW 4LR3A 3ZMUA 1Y66A 4O4LB 2HP8A 3LDCA 3ZHVA 3JSNA 1ENVA 3ZN1A 1GM8A 2EILB 2XUMA 3U0ZA 3JD0A 4KL1A 3OTOB 2NR5A 5JCOC 3EXAA 3OR7C 4GKKO 4HNAA 3ZHSA 1R73A 2Q8VA 4DV6O 3HKDA 3JD2A 4EFBA 2KKWA 1N8RW 1IX9A 4FK5C 1MOFA 2YC0A 3L73H 3HKEA 4JYCA 1YITV 2Y4TA 2WLJA 2HEPA 3C90A 1QHTA 5KHIA 1XBLA 4E2LA 1M56C 4O2BA 5GW7A 2UXDB 2WLLB 1I94B 1KU9A 3CE2A 1H2MA 4DR4O 4G2KA 2FL4A 1NS1A 1NH2D 4CH6A 4MTOA 4JYAO 1G1XB 1JFFB 4HAMA 3H01A 5L3EA 3ABTA 2OTLV 1BQ0A 3CCRV 1VF6A 3CMAV 4NR1A 4NXNB 1ZTEA 5EK0A 2IJHA 5IY5B 4NKGB 2ZXWC 5EIBD 1K8AW 5KUMA 2ZR2A 4LWSB 4P9PA 3A2FA 1GH6A 2RN9A 1Y6XA 4I7ZB 4CS3A 1B6QA 1Z5VA 2PI5A 3A0HZ 1K4DC 1GMGA 2VS0A 4PELA 3UT5A 5LGUA 4TV9B 4HZ3A 3BPZA 1VP7A 1VQ9V 1SQBH 3F7VC 3K04A 5EIBC 2YS8A 4GX5A 4RUEA 1FKAO 3T1HO 1M90W 1Q8IA 4MTGA 3B4SA 3W7TA 4DR3O 4ZBMA 3QVNA 5K1XA 4QE9A 4X1IB 3UM7A 1GAXA 3CCLV 2KB1A 2A06H 4B3TO 3RYHB 4AQYO 4TV8A 4MW8A 4X62B 1HNXO 3BVOA 1CP9A 3CP1A 4U3JA 1ZSPA 1M5IA 4N21A 4LF5O 4H13B 1SKVA 3S3WA 4XDLA 2IH1C 4GUNA 4YY3B 3CCSV 4BWAA 1QVGU 4MVSA 4R8CA 1JR9A 1G4YB 2EJ7A 1WNSA 3LNNA 4U7NA 3I55V 2VQEB 1IZ3A 2DWDC 2H94A 1JMKC 4KFMA 1R6KA 4G28B 5IT9N 4X1YB 1WJZA 2RDCA 4ZHQA 1SA0B 1VARA 4J7ZA 3P30A 4JV5O 2W0FC 1S72V 1IURA 1PL4A 2YDEA 2ZD9A 3CMEV 3AG1C 1JCHA 1RPRA 4FM1A 1OHHG 4YJ3A 2XAFA 3CC7V 1WPXA 2F23A 2UUAO 4X8AA 4B3MB 1VQ5V 2BSKB 4BIZA 3OD4A 4F6RB 3BY6A 1PNLA 3CJHA 1XMQO 1XNRB 4UB8Z 4NVPA 4ZI7B 1XEQA 2F4VB 2JS5A 4X64O 3BA9A 4J41A 1YJNV 1GN4A 1VQLV 2LW1A 1YHQV 5FL7G 4DR6B 4O4HA 4FZ1A 5C8YA 1M56B 3OE7G 2QKCA 4QNHB 5IYDO 2WSSG 3HPLC 3SPHA 1GRJA 1VQKV 4AI8A 4CH3A 4F6EA 4JASA 5LBQA 3N2GA 5A2QN 1H2KA 3ASNC 2LGQA 2PF4E 5CMUA 4J7KA 5KAIZ 1URFA 5L3BA 1K7DA 4GZRB 2HVKC 2W6IG 1N0JA 1W0KG 1EN5A 4UVAA 2VQFO 1J5EB 2ZXWB 1TVKB 3D36C 4O4LA 4MVRA 2V1DA 4YHHO 1VIBA 1NH2B 3WG7C 2AHYA 2B5UA 2DW4A 2EULA 1UJWB 3APOA 5BMVB 1N32B 4W4LA 1FYJA 4J11A 3H1LH 1K33A 2CTQA 3G6BA 5KMGB 1AI7A 2KSDA 3EVKA 4JI2O 1KD1W 3ZRVA 3JAKB 5CBFA 2ETNA 3BFRA 4QE7A 1F51A 4LH7A 5CB4B 3G6EV 1S0VA 3CCVV 1SESA 2WPDG 2CUGA 3E8FA 1N34B 2WLLA 4MW3A 1TUEB 1XMOO 4UCRA 5J2UB 2DYSC 5KHKA 3ETDA 5E1AC 1IXMA 3JYCA 3J7AU 4UUJC 2YIDA 3A8TA 2IM9A 4P30A 2CAZC 3CCQV 1JFFA
chains in the Genus database with same CATH topology
1Y76B 1RSOB 1Y76A 1ZL8A 1VF6A 1ZL8B 1Y74A 3B40A 1Y74B 1VF6C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y76 B;  1RSO B;  1Y76 A;  1ZL8 A;  1VF6 A;  1ZL8 B;  1Y74 A;  3B40 A;  1Y74 B;  1VF6 C; 
#chains in the Genus database with same CATH topology
 1YTF B;  1M57 C;  1Y4M A;  1IDS A;  1KEC A;  2YXH A;  1UFI A;  2ZQM A;  5JH7 A;  5LXT B;  1Q3E A;  1O9G A;  4DK0 A;  1HNZ O;  1EZV H;  1MG1 A;  1I0H A;  3E86 A;  4WFF A;  4K8X A;  4GKJ B;  3K0D A;  3OGC C;  1THZ A;  1S3J A;  5EZY B;  1QU7 A;  1L1F A;  3AG1 B;  3FX7 A;  3JAR B;  2EZP A;  5BR8 B;  3R66 A;  4PA4 A;  4DO2 A;  4L87 A;  1GN6 A;  4MVZ A;  1FFT B;  4TV9 A;  3UO2 A;  3TCU A;  1H8H G;  2JJ2 G;  1VQ4 V;  1XIL A;  2DOS A;  3ZMT A;  3ZMS A;  1W2B U;  2QWO B;  4GT1 A;  3WB2 A;  5B1A B;  3K79 A;  4BW9 A;  4DYL A;  1SER A;  5CA1 B;  2NN4 A;  4X1I A;  2Q67 A;  2GHY A;  3CC2 V;  3LSU A;  3CPW U;  4JYB A;  4PDR A;  2E74 B;  2YIB A;  5JQG B;  3JAS B;  4IIJ A;  3RYH A;  3OEH G;  5DED A;  2RCV A;  4DV4 B;  2N05 A;  3ABM C;  4QGP A;  1NVP D;  2WWW A;  4I9W A;  2UXC B;  1OCC C;  1P4R A;  2QKA A;  2DMX A;  2XAJ A;  3SDL A;  4FFB A;  1D5N A;  5BXZ A;  4DR1 O;  5A9G A;  1QR8 A;  3UO3 A;  3K57 A;  3FD9 A;  3JD1 A;  3ASN B;  4IHJ B;  4D6T H;  3FFQ A;  3K5M A;  4QJF B;  4X1Y A;  4JI7 B;  3ICX A;  1SA0 A;  3P32 A;  2MW2 B;  1YCI A;  1BE3 H;  1EN4 A;  1K3E A;  2XND G;  1OCO B;  4PA3 A;  4O4I B;  1NU1 H;  4HBN A;  1H2S B;  2R9R B;  3FB5 C;  4LFB O;  3B8M A;  1B04 A;  3I56 V;  3QO8 A;  4UCT A;  3T4Z A;  1RM1 B;  1PNM A;  3WG7 B;  5C93 A;  2UUC B;  1JJO A;  1BL8 A;  3STL C;  2DQ3 A;  3G71 V;  5LGN A;  3CCJ V;  2BSK A;  3L72 H;  4F6R A;  1VQ6 V;  4TUY B;  3ZRS A;  5JJN B;  4ZI7 A;  4LF9 O;  1JOY A;  3NR7 A;  3L74 H;  4K35 A;  4LH6 A;  2QE7 G;  3AG2 C;  5LHH A;  1PNK A;  5L3F A;  3CXC U;  2X7R B;  5B1B C;  2DYS B;  2WLI B;  3EFF K;  4JI3 B;  1QLN A;  5AG2 A;  2ZNI A;  5KHH A;  1X59 A;  4K0K O;  1Z5W A;  2QTS A;  4O4J B;  4DR5 B;  1R1B A;  2IJI A;  2RMK B;  3FB7 C;  3O9O A;  4DV3 O;  1SQP H;  4R7C A;  2QWQ B;  1YVW A;  1M57 B;  1YDX A;  3OMN B;  4P9O A;  1JVM A;  4Q6G A;  1OCR B;  2E5L O;  4FJC C;  1N33 B;  4GLX A;  1AR4 A;  1H38 A;  1E1R G;  1TVK A;  2UUB B;  5KA5 A;  4X66 O;  4WCE V;  4LF6 O;  1BSM A;  1WA8 B;  5BMV A;  1TUB A;  1BQZ A;  2E76 B;  4JI1 B;  4LFC B;  3H9V A;  3TXS A;  5H6Q A;  4OX9 O;  5EC2 C;  2OTJ V;  5B3S B;  1F7Y A;  4J10 A;  3JAK A;  5IJ9 B;  3ZBH A;  4FM2 A;  1HNW O;  2AGA A;  1KP2 A;  3ABL C;  1OV9 A;  1BCC H;  2PY5 A;  3WB1 A;  1KKC A;  2ARH A;  3LSQ A;  5J2U A;  2BE3 A;  2Y0P A;  5IWA O;  1YXB A;  2LGW A;  4KXR A;  4X9Q A;  4JZG A;  4B7K A;  3CXH F;  3ABM B;  2ZT9 B;  2AHZ A;  4JI4 O;  1NI8 A;  4NXM O;  3KCX A;  2HJF C;  2UU9 O;  3IGA C;  4JI8 O;  5LXT A;  1AP6 A;  2RJZ A;  4UVB A;  5FLX N;  4MS2 A;  5LMU B;  4DW1 A;  5EBW C;  2Y0I A;  3K9A A;  4MTX A;  1H2G A;  2EX3 A;  2Q5Z A;  3K06 A;  1P84 F;  5EZY A;  3JAR A;  4DV0 O;  4JTD B;  2QJ1 A;  4KHP O;  1P7B A;  3WB0 A;  1SQG A;  1ZWI C;  3OUF A;  2XAQ A;  2HHH B;  5CBG A;  3SJA C;  3RWR D;  1FJG B;  3K58 A;  4FLY A;  4MVU A;  4X1K B;  4CH5 A;  2D2C B;  3G67 A;  3L9D A;  2AZ0 A;  1TA8 A;  3DTU B;  1XNQ O;  5CA1 A;  2ZIM A;  2GV9 A;  2DQ0 A;  4Z1V A;  5JQG A;  2YIA A;  3JAS A;  5JVD B;  1WPB A;  2CTW A;  3SJB C;  3AK3 A;  5IYZ B;  3JAW A;  3ZIA G;  3SR2 C;  1FXK C;  2F43 G;  3CC4 V;  4CBC A;  1IBL B;  5B1B B;  3B40 A;  1H8E G;  1BMF G;  4Q20 A;  2XOK G;  4FFK A;  5CA0 B;  3SPJ A;  1NQT A;  3I5D A;  1FXH A;  4IHJ A;  3ZHT A;  1AI4 A;  1LR1 A;  2QEX V;  2OIE A;  4RUF A;  1RPO A;  2XHB A;  1M93 A;  5CBH A;  4O4I A;  1XDC A;  1XHX A;  3Q4H B;  3D36 A;  2P4V A;  4CS2 A;  1M4U A;  2F1M A;  1NR1 A;  4LF7 B;  4TQF A;  4F4L A;  3CCM V;  1EM1 A;  2Y69 B;  1HDJ A;  4R50 A;  4RO2 A;  4TUY A;  2ZR3 A;  4BIO A;  4BAY A;  2XAG A;  1JQ0 A;  2JGD B;  2Z0A A;  4W4K A;  3K08 A;  4JGS A;  3W7X A;  2EIK C;  4DR2 B;  1F4N A;  2UXD O;  1I94 O;  4JTC B;  3T1Y B;  2CK3 G;  2Z5U A;  3FKS G;  2OCC B;  2YXL A;  3GVM A;  4FPP A;  1QBZ A;  5KUK A;  4OXS A;  4IYH A;  1L0L H;  4J80 A;  3E8G A;  5LP6 B;  3U11 A;  4CC6 A;  3P3P A;  4XDJ A;  3T4D A;  4JI0 B;  4J9Z B;  3K5N A;  3LUT B;  5IDJ A;  1S77 D;  4O4J A;  4NXN O;  4PI2 A;  3G4S V;  1XOU A;  2FYU H;  1QVF U;  1H2N A;  5B1O A;  2EIM B;  4B3S B;  3FYI B;  2FTK A;  2WLH A;  3DSQ A;  3K5L A;  4XDK A;  3TK1 A;  2HLD G;  3RVY A;  3JAT B;  1F4M A;  3CWB H;  1WA8 A;  1D5A A;  1WP7 A;  1Y76 A;  3B77 A;  4DUZ B;  3CS5 A;  4TWK A;  2UXB B;  3BAA A;  3A0B Z;  5E79 Z;  4OGQ B;  4BR6 A;  5DM6 V;  4QIW F;  2A0L A;  3E8B A;  3LNM B;  4DK1 A;  1U96 A;  2AXT Z;  2NLJ C;  2OIG A;  1NTZ H;  4JAA A;  1IBK B;  1R3I C;  1IBM B;  2WAM A;  4IL6 Z;  1K5Q A;  2PTM A;  2X6C A;  4X62 O;  2CH7 B;  1WN7 A;  2ZKO A;  2AW9 A;  3ZHR A;  5IE9 A;  4YY3 O;  1FXK B;  3ABU A;  1W0J G;  1HR0 B;  5HFM A;  1NT2 B;  2GTA A;  2VQE O;  4X65 B;  2ZM6 B;  4DV1 O;  3TXQ A;  4LCU C;  4J42 A;  3GB7 C;  1SF9 A;  5LA6 B;  4PI0 A;  4YIO A;  4I55 A;  2YI9 A;  4WFE A;  4DV7 O;  3JAL B;  4FLZ A;  1US6 A;  1A32 A;  1YJ9 V;  3JD3 A;  1SC5 B;  2QWP B;  4JAV A;  5KLV H;  3LDE A;  2K1E A;  1VF6 C;  2ATK C;  5HFL A;  1FS0 G;  4RAI A;  2XAH A;  2JS3 A;  4B3M O;  3BHP A;  1XNR O;  3GWO A;  1COW G;  2F4V O;  4LNU B;  2H8P C;  1UPG A;  4X1K A;  2UXN A;  4X89 A;  4DR7 B;  3FAV B;  3CYO A;  3WFV A;  4DR6 O;  5JVD A;  3THO A;  4UCS A;  5IYZ A;  3MD0 A;  2R9A A;  2Q7E A;  1V54 C;  2IBZ H;  3QTC A;  2Y48 A;  2DWE C;  4UV9 A;  2HFE C;  3RYC B;  3SJC C;  4FZ0 A;  1Q6U A;  4PHZ A;  4A5U B;  5J9P C;  1OCZ C;  1ORQ C;  3O65 A;  5CA0 A;  5B66 Z;  1N36 B;  4EB6 B;  2R72 A;  3B09 A;  1TGO A;  3IJ4 A;  3ETG A;  1MZF A;  1FFX B;  1GTO A;  1VQ8 V;  1J5E O;  1VQM V;  4RWU A;  5KX5 B;  3M7M X;  4I4T B;  1PL0 A;  4LWS A;  5L3G A;  1KP3 A;  2GDS A;  5J2T B;  4NTX A;  1N32 O;  1R3K C;  4WFH A;  3DC5 A;  2Q68 A;  4ICG A;  2P6J A;  4UVC A;  5IJ0 B;  1QLE C;  2M7W A;  1AI5 A;  5CA3 A;  4DR1 B;  4FMT A;  4GX0 A;  2O57 A;  3AK1 A;  3A0R A;  3JD4 A;  2EJR A;  2LO1 A;  1CPY A;  3ZHU A;  1N4C A;  2JGD A;  2JJ1 G;  1DTO A;  2Q9L A;  2P06 A;  4PDL A;  2EIJ C;  1N34 O;  1NTM H;  2QDO A;  4BIU A;  4NTY A;  2N74 A;  5JJE B;  1PP9 H;  4KUM A;  2DN9 A;  4JAU A;  1WB7 A;  3L70 H;  1R6N A;  1AVM A;  2PUS A;  5D5Q A;  3X2Q C;  1S5J A;  1GM9 A;  5LP6 A;  2GSM B;  4PDM A;  5GTI Z;  1IXB A;  5EYP B;  1YIJ V;  2E75 B;  5IYC O;  2JEX A;  1S76 D;  3C3S A;  2IU3 A;  3AG7 A;  3AK2 A;  3MHS C;  4LFA B;  3C3T A;  3CHX A;  4GKJ O;  3EHB B;  1DGS A;  4O2A B;  3T1C A;  1GM7 A;  1ZX3 A;  3E89 A;  3JAT A;  2K9P A;  5BR8 O;  1B06 A;  3H1K H;  3SGI A;  4U7O A;  2CGO A;  4LF8 B;  3FB6 C;  2GTS A;  2PZS A;  2CTP A;  4CC5 A;  3RYF B;  1M9N A;  4MVQ A;  1QNM A;  4PA7 A;  5JCO A;  4BW5 A;  2FB5 A;  1I08 A;  3S3X A;  5FNV B;  1SRY A;  2HJD A;  4K3A A;  2CE4 A;  1DF4 A;  3BEH A;  2CH7 A;  2HG5 C;  3J80 N;  2YXY A;  3UT5 B;  3F5T A;  2YEV B;  5LL6 Y;  1SQX H;  1GO3 F;  2UXX A;  1KUQ A;  2UXC O;  4CS4 A;  2JDI G;  1V54 B;  2QR4 A;  1NBM G;  4HYO A;  2W6J G;  1OCZ B;  5LA6 A;  4DV2 B;  4JI7 O;  5LMN B;  2Q4P A;  1FPO A;  1SQF A;  3JAL A;  2ZCE A;  1SZT A;  4DV5 B;  3P3N A;  4D7T A;  1JJ2 U;  1PV0 A;  4U3J B;  2W0X A;  1PKX A;  5LYJ B;  4CH4 A;  4JI6 B;  2WLK A;  2UUC O;  2X6B A;  1MMM A;  2IJK A;  1V55 C;  4B3R B;  1MSW D;  3F5W C;  1K97 A;  1NZ6 A;  3K0G A;  3AG3 C;  2QTO A;  2UU9 B;  1AIL A;  4DUY B;  4JI5 B;  4JPR A;  4LNU A;  4WFB V;  4UV8 A;  2D3O W;  2P67 A;  2QGN A;  3K3W A;  4LF4 B;  4B08 A;  2F95 B;  4JF3 A;  3CEI A;  3CRC A;  3FAV A;  1FAF A;  5KMG A;  4U3F H;  2KG7 B;  3D3Q A;  1H2L A;  5DN6 G;  3JSL A;  4MVM A;  4ZIB A;  3N27 A;  3E35 A;  4P2Z A;  2EIJ B;  1T5E A;  3BCC H;  1N0N A;  2YI8 A;  5CB4 A;  4JI3 O;  1ROP A;  4H37 A;  1XRE A;  3X2Q B;  3CJH B;  4GKK B;  4DR5 O;  4UCU A;  1IVS A;  4ZKI A;  1SS3 A;  1G8M A;  4DV6 B;  3ZRW B;  4EB6 A;  1OCC B;  2KQX A;  1N33 O;  1BGY H;  1FFX A;  1Q86 W;  1AP5 A;  2PYJ A;  3R65 A;  1JX9 A;  2UUB O;  2YSU B;  5KX5 A;  1XHZ A;  3DC6 A;  2B1I A;  4FVM A;  4I4T A;  2PI4 A;  4FLT A;  3ETQ A;  3N2K B;  2A9H A;  4IYI A;  2V4D A;  4DR4 B;  1F23 A;  5J2T A;  1VMG A;  2WA3 A;  4X88 A;  2JGU A;  4ZOL B;  3ZN0 A;  3ZCC A;  4JI1 O;  1NVP B;  4JYA B;  3ETE A;  3N2G B;  4LFC O;  5IJ0 A;  3CB2 A;  2Q7G A;  4I0X B;  4PA6 A;  3ASO C;  5ITZ B;  3LDD A;  2EIN C;  1HW7 A;  5LHI A;  2P22 C;  1R6T A;  4I5S A;  1MNG A;  1Q6H A;  2CDY A;  4Z1M G;  3QO7 A;  3CRR A;  1Q82 W;  1W59 A;  2PGG A;  3AG2 B;  1K73 W;  3K59 A;  3OMI B;  1K5S A;  3DGE A;  1NR7 A;  3RN4 A;  3CX5 F;  2ZDI C;  1NKD A;  2PYL A;  2DJV A;  1SQV H;  1V9P A;  5EYP A;  3ZS8 C;  4NB5 A;  2R70 A;  1KYO F;  3T1H B;  5LMU O;  4DR3 B;  3KKY A;  3OM3 B;  1OJH A;  2E3C A;  2ZIO A;  4ABM A;  3OGI B;  4B3T B;  4AQY B;  1HNX B;  4O2A A;  4MSW C;  1NJI W;  3W7W A;  3JAM N;  3SYC A;  3SYO A;  5D5P A;  2N04 A;  1Y67 A;  5H5N A;  1QCE A;  4LF5 B;  2P4K A;  2QA4 V;  3OTO O;  1R3L C;  4MT8 A;  2HHH O;  4PA9 A;  3RYF A;  1FJG O;  1V55 B;  3W7U A;  2ZE5 A;  1E1Q G;  1KQS U;  2ADQ B;  2QSA A;  4Z2W A;  5JH7 B;  5LGT A;  1QQC A;  3AG3 B;  1JPX A;  3SPC A;  5KHJ A;  3RFR A;  1PD3 A;  3OAA G;  1MAB G;  5FNV A;  1YEW A;  1KBH A;  4PJ0 Z;  1VEW A;  1Q5O A;  1YJW V;  4JV5 B;  4LBE C;  2RNB A;  1G6U A;  1CXZ B;  1RP3 B;  1Q90 D;  1Q7Y W;  1Q81 W;  1B3Q A;  2YEV A;  3ABL B;  1IBL O;  1KB9 F;  3HKB B;  3TET A;  4RQF A;  1K4C C;  1YTF D;  3SYP A;  2UUA B;  2WLI A;  1ZL8 B;  4GYC B;  2BOC C;  4KP4 A;  3RVZ A;  1BT8 A;  5L3D A;  3CCE V;  1XMQ B;  3UQ8 A;  4AIL C;  2L35 A;  4FLU A;  4N23 A;  4IIJ B;  4DRX B;  5GON B;  4X64 B;  1DLB A;  1VQN V;  3H1I H;  5LYJ A;  1AJN A;  1I7F A;  1CEZ A;  4LF7 O;  1O9H A;  2L6L A;  3AG4 C;  1RFY A;  3HB3 B;  2CGN A;  3JCZ A;  4FFB B;  4AHC A;  2A3Q A;  2Q0A A;  4DV1 B;  3ZMZ A;  3GWK C;  1XL6 A;  3VOU A;  3CCU V;  2BTQ B;  3W7S A;  2QM4 A;  3D3I A;  4L8J A;  3E22 B;  4DV7 B;  3NXS A;  3LSS A;  1R3J C;  4DR2 O;  3ASO B;  1P49 A;  1Y74 B;  2KG7 A;  3JCU Z;  3T1Y O;  3FYE B;  2EIN B;  4YJ2 B;  5IJ9 A;  2VQF B;  4GX1 A;  4I50 B;  2QM8 A;  4WBN B;  3ABK C;  3OMA B;  5H6R A;  4IGG A;  2WLM A;  4YHH B;  3B2E E;  4C7U A;  1RSO B;  4JI0 O;  2R9I A;  5KA6 A;  2A79 B;  1E79 G;  1LUV A;  4ASU G;  1YF2 A;  4J7J A;  5B1A C;  3CRQ A;  3L75 H;  1ZAU A;  2IU0 A;  3UCS C;  2GUZ B;  1VF5 B;  3ZRW A;  3QG5 A;  2LP7 A;  2H3O A;  4B3S O;  4JI2 B;  3MAQ A;  2ITD C;  5L3C A;  3M99 B;  1I5X A;  4X20 B;  4D7S A;  5F2V O;  2ZE7 A;  1WP8 A;  2X6A A;  2ADP A;  3OUS A;  4TOI A;  4JTA B;  2EBO A;  3N2K A;  2Q6A A;  3VQY A;  1XMO B;  2AZ2 A;  4XBF A;  4ZOL A;  4WFG A;  5H9C A;  4DUZ O;  2IW5 A;  1DF5 A;  1KMI Z;  2UXB O;  1QR9 A;  1ZLZ A;  2JVD A;  3IC7 A;  2MK3 A;  4PV1 B;  3ZX6 A;  4I0X A;  3VQV A;  1HP8 A;  4JYY A;  5BY1 A;  2JRI A;  3RYI B;  3HR0 A;  1OCO C;  5GTH Z;  1IBK O;  5ITZ A;  1AR5 A;  1IBM O;  2HVJ C;  1EZJ A;  4E4E A;  3PN1 A;  2BTO A;  1Z2G A;  3OW2 U;  4UCV A;  1RM1 C;  2A7W A;  1HNZ B;  4GCZ A;  2Q69 A;  4WFA V;  4UB6 Z;  2IJJ A;  1TUB B;  2EIK B;  2P7T C;  3UKM A;  2LFR A;  2G38 A;  1MA1 A;  1VF7 A;  1HR0 O;  4TT3 G;  2OWO A;  3WU2 Z;  5EBL C;  3CRM A;  4X65 O;  2ZM6 O;  5LOV B;  2XAS A;  2QWR B;  4G27 B;  1DK1 A;  2LW7 A;  3PJS K;  1AJQ A;  1AJP A;  3OR6 C;  3ZJZ A;  2HR3 A;  3QNE A;  1ZUQ A;  2M6Y A;  4H44 B;  1XUQ A;  3ML0 A;  4PDV A;  4EKW A;  1K34 A;  2B9Z A;  1SQQ H;  1XL4 A;  3F7Y C;  3QO5 A;  1GN2 A;  1SZX A;  1FD9 A;  1X4T A;  2GBO A;  2JK5 C;  2Q7H A;  4WF9 V;  3DXR B;  3Q4H A;  5DEC A;  4RQE A;  3RBZ A;  3L71 H;  2ZE8 A;  3AG4 B;  2BCC H;  3D8C A;  1I5Y A;  4JZ2 A;  2VWK A;  1OCR C;  3E8H A;  2ZNJ A;  3BAB A;  2XTA A;  4YXW G;  3BRC A;  3K9S A;  3E2E A;  4DR7 O;  3OT7 A;  3HKC B;  3B8N A;  2ZE6 A;  2P90 A;  4EFE A;  3CRA A;  2ODM A;  1LNQ A;  2OT5 A;  4H0L B;  1JA8 A;  4CZZ A;  5B5E Z;  4LFB B;  3IAY A;  3BA8 A;  4R6Z A;  4UCO A;  3SYA A;  3ZHQ A;  2EZO A;  3ABK B;  1PM9 A;  3HKB A;  4FM0 A;  1J95 A;  5B3S C;  4HNA B;  2HKO A;  5BZB A;  1ZL8 A;  3HKD B;  2VRZ A;  1N36 O;  2LQT A;  4YIP A;  3MDS A;  2QM7 A;  3HKE B;  4LF9 B;  2X0L A;  4DRX A;  4MVO A;  4PD4 F;  1S5H C;  5GON A;  5FPO A;  3KZI Z;  4LC1 A;  1PPJ H;  3JAW B;  1GK9 A;  1VQP V;  4O2B B;  1KKD A;  2F66 C;  1L0N H;  1NTK H;  3H1J H;  5JJJ B;  1MSD A;  2BOB C;  2OYQ A;  3K5O A;  2VWJ A;  4K8Z A;  3ZMV A;  2YUA A;  3SPI A;  1D2D A;  4LP8 A;  1U97 A;  2DYR C;  2WA4 A;  4K0K B;  1EBO A;  2BTQ A;  4FLV A;  4DV3 B;  1LUW A;  3E22 A;  4FLX A;  2FKX A;  2Z3Y A;  3TJT A;  2E5L B;  1S5L Z;  1Y74 A;  3AEI A;  3T2M A;  3OFN G;  3STZ C;  4DW0 A;  4YJ2 A;  3KG2 A;  3J81 N;  4QPK A;  2EIL C;  4I50 A;  4IT5 A;  4WBN A;  2NNU A;  4X66 B;  3IFX A;  4DXW A;  4LF6 B;  1WLE A;  3OEE G;  1RSO A;  4DV4 O;  2JEU A;  2P5O A;  1VQO V;  1ARO P;  2Q0O C;  1FXK A;  2LJ2 A;  1XQ8 A;  1YSC A;  4GX2 A;  3ZRX A;  2GUZ A;  4EEQ A;  5LHG A;  2ZDI A;  1WB8 A;  4OX9 B;  1Q6I A;  5IYB O;  1M1K W;  1YZB A;  2ITC C;  4LFA O;  4X20 A;  1SET A;  3MHH C;  5EC1 C;  4OPA A;  1HNW B;  2CTR A;  4TV8 B;  4FLW A;  4TQD A;  2V7Q G;  2ILM A;  2Q73 A;  3RGB A;  2JIZ G;  5IWA B;  1AI6 A;  4LF8 O;  2Y4U A;  3TGU H;  5KAF Z;  3QF7 A;  3ZED A;  3M8A A;  2C2A A;  3CSX A;  1BHB A;  2LFS A;  4JI4 B;  4NXM B;  3RW0 A;  1EFR G;  3G80 A;  4MTF A;  5B1N A;  3RYI A;  1QLE B;  1GKF A;  5IY5 C;  5TIS Z;  3OTF A;  4JI8 B;  1HWY A;  4ZHQ B;  2IH3 C;  4FIP C;  2QWN B;  4OPH A;  1OZ0 A;  2XT9 A;  4I9Q A;  2ZIN A;  2YIB D;  3VBB A;  2RQ6 A;  4YJ3 B;  1Y76 B;  3VQW A;  1P7G A;  3CD6 V;  2Y69 C;  1AR1 B;  3KCY A;  1BHA A;  2YIC A;  4DV0 B;  4NYK A;  4KHP B;  3APQ A;  4H33 A;  5FPR A;  3SJQ C;  5CN0 A;  5JWP A;  3K03 A;  5LOV A;  3RYC A;  1TAE A;  2DE0 X;  4TSF G;  2OCH A;  4DV2 O;  2FML A;  5LMN O;  3E83 A;  3H1H H;  2QKS A;  1YI2 V;  1BZK A;  3IC9 A;  2OCC C;  1AB3 A;  4DV5 O;  4B7E A;  1BS3 A;  1K92 A;  4QPJ A;  1XNQ B;  5EBM C;  1KC8 W;  5H2F Z;  1MZE A;  5K1P A;  1VQ7 V;  1Q43 A;  1XI1 A;  5LP6 C;  4O4H B;  3SYQ A;  5KHG A;  5C8Y B;  3SPG A;  2B1G A;  4JI6 O;  1FXV A;  1GN3 A;  3VQX A;  3FB8 C;  3DXR A;  4B3R O;  4UXN A;  3RT3 C;  2F93 B;  4J9Y B;  1EN6 A;  2EIM C;  4I55 B;  4DUY O;  4UFZ A;  4JI5 O;  2WLN A;  1WAZ A;  4NTW A;  2DYR B;  4LF4 O;  3HKC A;  1L8D A;  3U10 A;  1K9M W;  4LR3 A;  3ZMU A;  1Y66 A;  4O4L B;  2HP8 A;  3LDC A;  3ZHV A;  3JSN A;  1ENV A;  3ZN1 A;  1GM8 A;  2EIL B;  2XUM A;  3U0Z A;  3JD0 A;  4KL1 A;  3OTO B;  2NR5 A;  5JCO C;  3EXA A;  3OR7 C;  4GKK O;  4HNA A;  3ZHS A;  1R73 A;  2Q8V A;  4DV6 O;  3HKD A;  3JD2 A;  4EFB A;  2KKW A;  1N8R W;  1IX9 A;  4FK5 C;  1MOF A;  2YC0 A;  3L73 H;  3HKE A;  4JYC A;  1YIT V;  2Y4T A;  2WLJ A;  2HEP A;  3C90 A;  1QHT A;  5KHI A;  1XBL A;  4E2L A;  1M56 C;  4O2B A;  5GW7 A;  2UXD B;  2WLL B;  1I94 B;  1KU9 A;  3CE2 A;  1H2M A;  4DR4 O;  4G2K A;  2FL4 A;  1NS1 A;  1NH2 D;  4CH6 A;  4MTO A;  4JYA O;  1G1X B;  1JFF B;  4HAM A;  3H01 A;  5L3E A;  3ABT A;  2OTL V;  1BQ0 A;  3CCR V;  1VF6 A;  3CMA V;  4NR1 A;  4NXN B;  1ZTE A;  5EK0 A;  2IJH A;  5IY5 B;  4NKG B;  2ZXW C;  5EIB D;  1K8A W;  5KUM A;  2ZR2 A;  4LWS B;  4P9P A;  3A2F A;  1GH6 A;  2RN9 A;  1Y6X A;  4I7Z B;  4CS3 A;  1B6Q A;  1Z5V A;  2PI5 A;  3A0H Z;  1K4D C;  1GMG A;  2VS0 A;  4PEL A;  3UT5 A;  5LGU A;  4TV9 B;  4HZ3 A;  3BPZ A;  1VP7 A;  1VQ9 V;  1SQB H;  3F7V C;  3K04 A;  5EIB C;  2YS8 A;  4GX5 A;  4RUE A;  1FKA O;  3T1H O;  1M90 W;  1Q8I A;  4MTG A;  3B4S A;  3W7T A;  4DR3 O;  4ZBM A;  3QVN A;  5K1X A;  4QE9 A;  4X1I B;  3UM7 A;  1GAX A;  3CCL V;  2KB1 A;  2A06 H;  4B3T O;  3RYH B;  4AQY O;  4TV8 A;  4MW8 A;  4X62 B;  1HNX O;  3BVO A;  1CP9 A;  3CP1 A;  4U3J A;  1ZSP A;  1M5I A;  4N21 A;  4LF5 O;  4H13 B;  1SKV A;  3S3W A;  4XDL A;  2IH1 C;  4GUN A;  4YY3 B;  3CCS V;  4BWA A;  1QVG U;  4MVS A;  4R8C A;  1JR9 A;  1G4Y B;  2EJ7 A;  1WNS A;  3LNN A;  4U7N A;  3I55 V;  2VQE B;  1IZ3 A;  2DWD C;  2H94 A;  1JMK C;  4KFM A;  1R6K A;  4G28 B;  5IT9 N;  4X1Y B;  1WJZ A;  2RDC A;  4ZHQ A;  1SA0 B;  1VAR A;  4J7Z A;  3P30 A;  4JV5 O;  2W0F C;  1S72 V;  1IUR A;  1PL4 A;  2YDE A;  2ZD9 A;  3CME V;  3AG1 C;  1JCH A;  1RPR A;  4FM1 A;  1OHH G;  4YJ3 A;  2XAF A;  3CC7 V;  1WPX A;  2F23 A;  2UUA O;  4X8A A;  4B3M B;  1VQ5 V;  2BSK B;  4BIZ A;  3OD4 A;  4F6R B;  3BY6 A;  1PNL A;  3CJH A;  1XMQ O;  1XNR B;  4UB8 Z;  4NVP A;  4ZI7 B;  1XEQ A;  2F4V B;  2JS5 A;  4X64 O;  3BA9 A;  4J41 A;  1YJN V;  1GN4 A;  1VQL V;  2LW1 A;  1YHQ V;  5FL7 G;  4DR6 B;  4O4H A;  4FZ1 A;  5C8Y A;  1M56 B;  3OE7 G;  2QKC A;  4QNH B;  5IYD O;  2WSS G;  3HPL C;  3SPH A;  1GRJ A;  1VQK V;  4AI8 A;  4CH3 A;  4F6E A;  4JAS A;  5LBQ A;  3N2G A;  5A2Q N;  1H2K A;  3ASN C;  2LGQ A;  2PF4 E;  5CMU A;  4J7K A;  5KAI Z;  1URF A;  5L3B A;  1K7D A;  4GZR B;  2HVK C;  2W6I G;  1N0J A;  1W0K G;  1EN5 A;  4UVA A;  2VQF O;  1J5E B;  2ZXW B;  1TVK B;  3D36 C;  4O4L A;  4MVR A;  2V1D A;  4YHH O;  1VIB A;  1NH2 B;  3WG7 C;  2AHY A;  2B5U A;  2DW4 A;  2EUL A;  1UJW B;  3APO A;  5BMV B;  1N32 B;  4W4L A;  1FYJ A;  4J11 A;  3H1L H;  1K33 A;  2CTQ A;  3G6B A;  5KMG B;  1AI7 A;  2KSD A;  3EVK A;  4JI2 O;  1KD1 W;  3ZRV A;  3JAK B;  5CBF A;  2ETN A;  3BFR A;  4QE7 A;  1F51 A;  4LH7 A;  5CB4 B;  3G6E V;  1S0V A;  3CCV V;  1SES A;  2WPD G;  2CUG A;  3E8F A;  1N34 B;  2WLL A;  4MW3 A;  1TUE B;  1XMO O;  4UCR A;  5J2U B;  2DYS C;  5KHK A;  3ETD A;  5E1A C;  1IXM A;  3JYC A;  3J7A U;  4UUJ C;  2YID A;  3A8T A;  2IM9 A;  4P30 A;  2CAZ C;  3CCQ V;  1JFF A; 
#chains in the Genus database with same CATH homology
 1Y76 B;  1RSO B;  1Y76 A;  1ZL8 A;  1VF6 A;  1ZL8 B;  1Y74 A;  3B40 A;  1Y74 B;  1VF6 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...