1Y74B

Solution structure of mlin-2/mlin-7 l27 domain complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
50
structure length
50
Chain Sequence
AVQRAKEVLEEISCYPENNDAKELKRILTQPHFMALLQTHDVVAHEVYSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords lin 7 homolog b
publication title A unified assembly mode revealed by the structures of tetrameric L27 domain complexes formed by mLin-2/mLin-7 and Patj/Pals1 scaffold proteins.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 16
structure length 50
sequence length 50
chains with identical sequence D
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2004-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.650 Mainly Alpha Orthogonal Bundle Helix Hairpins L27 domain 1y74B00
1VF6C 1Y74B 1VF6A 3B40A 1Y76A 1Y76B 1ZL8A 1ZL8B 1RSOB 1Y74A
chains in the Genus database with same CATH superfamily
3BAAA 4MVQA 4JYBA 4AQYO 3N2KB 3ETGA 2DYRB 2ADPA 1D5NA 3JAMN 3E8BA 3PJSK 2ZE6A 4FLYA 4JI1O 2JK5C 4PELA 5EYPA 2ZR3A 4HAMA 4B3RO 4FM1A 1AR5A 3ZIAG 4O2AA 4DV3O 3FD9A 3OUSA 1W0JG 5ITZB 4B7KA 5GONB 4H44B 3LDCA 3ASOB 3DC6A 4DV2O 4RUFA 4LNUB 1GN6A 3CX5F 1YJWV 2Q69A 5HFLA 1OCOC 2JGDB 4TWKA 4FZ0A 2F43G 5LMUO 5J2TA 3ZMSA 1WAZA 2OWOA 2HKOA 3DSQA 4LF8B 3B09A 5CB4A 5KHKA 4DUYB 4X1KB 3AG4B 2CH7B 1KYOF 2WPDG 4DW1A 1R3KC 3LSUA 1GM9A 3JSLA 3CCUV 2NLJC 1Q43A 2WLHA 1VQLV 5CBHA 1RSOB 2V1DA 3OT7A 2UUCB 2OT5A 4YHHO 2OIGA 4BAYA 5H6RA 1Q7YW 3OFNG 5J2UA 5KHGA 4JV5O 5IY5B 4AI8A 1JJOA 1HR0O 5LMNB 3H1KH 5L3GA 1X4TA 5EC2C 1R73A 2XNDG 1US6A 4X62B 1QHTA 2Y0PA 5IJ0B 2IU3A 3JD2A 3E22B 5KA5A 1HNXB 3JALB 3H9VA 2GHYA 3D3IA 3P30A 5BY1A 2EILB 4R50A 4DR7B 1P4RA 1KQSU 1IZ3A 2A7WA 3BPZA 3T1HO 3IFXA 4O4LB 2RJZA 2YXLA 1K97A 2OYQA 2IH3C 2FTKA 5JVDA 3CC4V 1R6NA 2M6YA 1BQ0A 3GWKC 4JI8B 5BR8B 2GBOA 4P9PA 2EIKB 3RN4A 1ZTEA 3RFRA 2JIZG 4DR3B 3JD1A 3ML0A 2JJ1G 2DJVA 3FFQA 3K0DA 3GWOA 4X20A 2QE7G 1SA0B 3U0ZA 2GDSA 2E76B 3HKCB 2VWKA 2JEXA 3W7SA 1VQ4V 2EIJC 2ZXWB 3W7WA 4LF5B 4JYCA 3BFRA 1BGYH 3DC5A 2PY5A 4XBFA 4MTOA 3FB7C 4DK1A 2XOKG 4NTWA 4ZOLA 2CGNA 2YXYA 1RM1B 3JASB 4LF8O 1G1XB 3OMNB 4I9WA 4DUYO 1WNSA 4F6EA 2KQXA 3OD4A 4D6TH 3ZHTA 4I50B 4FVMA 2XHBA 4HNAA 5JQGB 5LGTA 2UUCO 3SJAC 1I94B 2LQTA 3QTCA 2JGUA 4GYCB 1MZFA 1N0NA 1UFIA 3TGUH 3T4DA 3UO2A 4GT1A 1FXKA 5LMNO 1E79G 1BHBA 3IGAC 2Q9LA 4X62O 4LFCB 3CXCU 4PDMA 3ABLB 5B66Z 4LH7A 2G38A 3ZN0A 4GUNA 1HNXO 2Q7HA 1VF6A 4D7SA 4KXRA 1W2BU 3N2GB 2Y48A 4QE7A 1B6QA 2QDOA 4DR7O 1ZX3A 1YZBA 1VQ9V 1KKDA 2CGOA 4LCUC 4PA4A 4MVSA 3RGBA 3T1CA 4CS2A 3M99B 1GK9A 2UXCB 1XEQA 2F95B 5KA6A 4JI8O 5BR8O 3CS5A 1PV0A 5EYPB 3C3TA 3TXSA 3JATA 4B3MB 1TA8A 4DR3O 2LW1A 4I55A 3E8GA 2VRZA 5FPRA 4O2AB 2DE0X 5DECA 2DWDC 4YXWG 2X6AA 3CMAV 2R72A 3B8MA 4GKJB 5LP6C 1WPBA 4JTCB 4LF5O 1Y6XA 1NS1A 1EFRG 3JSNA 5J2TB 5CB4B 4EEQA 1RPOA 2QM4A 3ZCCA 5EK0A 4UVAA 2IM9A 3I5DA 5H6QA 4OX9B 1K8AW 3CD6V 1E1RG 2PF4E 1VQ8V 2UU9B 2AHYA 5CA0A 4UCTA 3ZHUA 2OTLV 4X65B 3CHXA 1QVFU 2ZXWC 1MG1A 2HFEC 4R7CA 2Y69B 3VQVA 1P49A 2QWPB 1I94O 1QLEB 3CSXA 4EB6B 5J2UB 3ABUA 4R6ZA 4NTYA 2XUMA 2HJFC 3JCZA 4DXWA 4C7UA 1JMKC 1MMMA 1B3QA 4LFCO 1H38A 1RP3B 1DF5A 3BVOA 3FX7A 5D5QA 3JCUZ 4UVCA 2PTMA 2GUZB 3WFVA 3UQ8A 1H2SB 5JVDB 3LUTB 5LHGA 1I08A 1R3IC 1G8MA 3K79A 5IE9A 1VQ6V 3ZBHA 4JTDB 2UXCO 1N33B 4MTGA 4FLUA 1ZSPA 1M90W 1XUQA 4B3MO 4CH5A 3TETA 1RFYA 5EZYB 1N0JA 1BCCH 5LOVA 2ZE5A 3ABKB 1Y76A 4IIJA 1AJPA 4GKJO 2X6BA 4U7OA 3SYPA 3UO3A 1EN6A 1GM8A 4TT3G 5CBFA 1XL4A 1Z5VA 4ZOLB 5LGNA 4P2ZA 1PPJH 4LR3A 4F4LA 5C8YB 1SQBH 1M56B 1YF2A 1SKVA 3BCCH 3ZRVA 3OGCC 4OX9O 4GX5A 4HNAB 2JGDA 4QJFB 1SZXA 3U11A 3X2QC 2UU9O 1QLNA 1QCEA 1Q86W 2QJ1A 5L3EA 4X65O 3STLC 1THZA 4J7JA 1WLEA 1URFA 5B1AB 3C3SA 1KBHA 4IT5A 1M9NA 3QO7A 1FXKB 1OCZB 1LUVA 2QA4V 1GKFA 1RSOA 3AEIA 1K9MW 2BTQA 4WCEV 5L3DA 3STZC 4J11A 2Y4TA 5JJEB 4ZI7A 4Z2WA 1SZTA 2LGWA 2ZT9B 4UFZA 3H1IH 2Y69C 2N05A 2OCCB 3S3WA 3CRAA 1WJZA 3OEEG 4UB6Z 4GLXA 5LA6A 5IWAB 2YUAA 4FM0A 1K4CC 4EFEA 1N33O 4I55B 1G6UA 3RYCA 4O4LA 2BOBC 4U3JA 1I5XA 4DV6B 4TV8A 3AK3A 1IBKB 4U7NA 4CC5A 4XDLA 1U96A 4PI0A 4UV9A 1F4NA 1VARA 1HDJA 5B3SB 4JI4B 4JI0B 1S76D 2AHZA 5K1XA 1XHZA 4X1YA 1SA0A 1YCIA 2H8PC 2ZD9A 3THOA 3MAQA 4BW5A 1R6KA 1H2LA 3RVZA 4WBNA 1L0NH 3ZHSA 2P5OA 2QSAA 1FXVA 3AG2B 3T2MA 1R3JC 5CA1A 5CA0B 4GX2A 2CK3G 3CWBH 4ABMA 4ZHQA 3LNMB 4O4IA 2QWOB 2B5UA 5EIBC 2JDIG 2HVKC 2FYUH 1UJWB 3APQA 1AI6A 2EZOA 4NYKA 3WG7C 4RQFA 2Q7GA 1F7YA 4MTXA 4BR6A 2YS8A 1KECA 4J7ZA 1S72V 5H5NA 3ZN1A 4B7EA 1JJ2U 4P9OA 2DOSA 4CS3A 3CCEV 1XHXA 1K7DA 3AG3B 1S0VA 4MW3A 3E86A 3L74H 1RPRA 1HNWB 1EN4A 1LNQA 1MZEA 3ZS8C 3SYCA 1OCCC 2CUGA 1HWYA 4FLWA 3SPIA 5B1AC 2GTSA 3MDSA 2K1EA 1EN5A 1K5QA 2HJDA 3QVNA 1FXKC 2YI9A 3LDEA 1OCZC 5IWAO 4UCSA 5IYBO 1V55C 1I7FA 1QR9A 4PDLA 1AJQA 2P4KA 1FYJA 5LOVB 2ZINA 2QWQB 1VF6C 4DV6O 1P7GA 2IBZH 1Y76B 1IBKO 4IIJB 1PD3A 2FKXA 1G4YB 3GVMA 3D8CA 2E5LB 2XTAA 4JI4O 4JI0O 4H0LB 2AZ0A 4KUMA 3CYOA 2B9ZA 3ZMZA 1K92A 4JAVA 1XI1A 3K5MA 3T1YB 4TQDA 1K5SA 2EINB 3ETQA 2B1IA 4H37A 4H13B 2BOCC 3AG1B 1S5JA 5KAFZ 2DWEC 2HLDG 4N21A 1Q3EA 5FNVA 1NJIW 3RYIA 3JAKA 4LFBB 1SF9A 4J9YB 4LF9B 1D5AA 2ZDIA 4LF4B 2BTQB 4AHCA 4LP8A 4OPAA 4IYIA 5KUMA 1SERA 4EB6A 2Q68A 1V54B 4ZI7B 2DN9A 4MVRA 3K5NA 1I5YA 1HNWO 3AK1A 2Q7EA 4DV1B 1GRJA 2QKCA 3CRQA 1CPYA 1KMIZ 3LSQA 2DYSB 5LA6B 2EBOA 4CH6A 2WA4A 1IDSA 1MABG 3ZEDA 2K9PA 3O65A 4QIWF 1P7BA 1SRYA 2GUZA 3RYCB 5FL7G 4PHZA 4U3JB 5TISZ 2KB1A 4P30A 3FB8C 1GN3A 1GN4A 4TV8B 3A0RA 4B3SB 1FKAO 4DV7B 3L73H 4OGQB 1L0LH 2EIMB 2H3OA 2XAFA 2WA3A 2XASA 1Z2GA 3JARB 1ZUQA 2E5LO 1MSWD 4X1YB 3L9DA 3D36A 5JCOC 5EZYA 1VEWA 2R70A 1X59A 3MHHC 4CBCA 4WBNB 3OUFA 1YXBA 1FAFA 5KHHA 1QR8A 5CA1B 4CC6A 1HW7A 2DYRC 3A0HZ 3CE2A 3MD0A 3RVYA 4ZHQB 4YJ2A 1FXHA 3A8TA 3ZHQA 4O4IB 3T1YO 1KP3A 2ETNA 3G6EV 2R9RB 1OHHG 3ICXA 2PI4A 1GAXA 4NVPA 2IJIA 1DLBA 3CB2A 5C8YA 3KKYA 1F23A 5B1BB 4J9ZB 2ZE7A 2HHHB 4MS2A 4LFBO 4TOIA 2FMLA 3ASOC 1IVSA 2DQ0A 4LF9O 2JJ2G 5B5EZ 4LF4O 2QM8A 3OGIB 4K8ZA 1R6TA 5KAIZ 1FFTB 2DW4A 2Q4PA 2ZR2A 5K1PA 2LFRA 1PNMA 4DW0A 5JH7A 4B3TB 4Z1VA 3AG4C 2ODMA 2VS0A 4DV1O 1F4MA 4N23A 3RYHA 2WSSG 5KLVH 3BA8A 3CJHA 3K03A 2V7QG 1OJHA 5KUKA 4DV4B 2N74A 1NU1H 3JD0A 4X8AA 3HB3B 4B3SO 1YHQV 3VBBA 4B08A 5IY5C 3FAVA 3ZMVA 4DV7O 4E4EA 2ZE8A 1Y67A 4IHJA 4NB5A 1S77D 1M93A 4Q6GA 1WA8A 2P90A 1ROPA 1TUEB 4LH6A 3C90A 4NR1A 4FMTA 2EILC 3WB1A 4PJ0Z 2W0FC 5B1NA 2CAZC 3BEHA 2Z5UA 4QPJA 1AR4A 4H33A 3P32A 3F5TA 2W6JG 2FL4A 2NN4A 3TK1A 1Q6IA 4O4HA 3ASNB 3M7MX 2ADQB 2Y4UA 3BY6A 2EIKC 3H01A 2KSDA 1U97A 5E79Z 1YTFD 2EIMC 4F6RA 3SYAA 5DN6G 1NH2D 2YC0A 5A9GA 5FNVB 4I4TB 4X1IA 3RYIB 3K5OA 3JAKB 3OM3B 3HKDA 5A2QN 3K08A 2HHHO 1XNQB 2EULA 1VQKV 3ZHVA 2Q5ZA 2CTPA 1JOYA 2OTJV 1NBMG 4O2BA 2RCVA 3F7YC 3ABTA 4DO2A 2QM7A 1EBOA 1VQOV 4MVOA 2BE3A 1LUWA 1PM9A 4JGSA 5LXTA 1RM1C 1BE3H 3U10A 1CP9A 4B3TO 5IYDO 1BHAA 1YJ9V 1Y66A 1M5IA 4XDJA 1YVWA 1MNGA 3M8AA 3E83A 2ZM6B 3OR6C 4JI7B 4UB8Z 4DV4O 4FLZA 4WFHA 2WLMA 3EXAA 2CTRA 2P6JA 4O4JB 3HR0A 3VQYA 4YJ3A 2ZIOA 1K33A 2NR5A 4LF6B 2Q67A 2QKAA 1P84F 1VQNV 2WLLA 3R66A 3ABLC 1WB7A 1O9GA 1J5EB 4BWAA 4X64B 1AI4A 3E2EA 3LNNA 4J10A 2GSMB 1QBZA 3I55V 1Q8IA 2BSKA 4YIOA 3SYOA 3P3PA 4PDVA 3UT5A 4YJ2B 3IC7A 3P3NA 4FZ1A 3K58A 3ETEA 5LL6Y 4K35A 1JQ0A 2A06H 1AP6A 3BRCA 3L72H 4TV9A 4OXSA 2GV9A 1Q81W 2UXXA 3K59A 2Q0OC 4EKWA 4XDKA 3G4SV 1KB9F 4PD4F 1V9PA 1H2GA 4U3FH 4UCRA 2Q0AA 3FYIB 1M57B 3OEHG 4GKKB 2YI8A 2QEXV 1XNQO 4A5UB 2M7WA 1NR7A 1Y74A 3QG5A 3DXRA 2QTOA 5JH7B 5EBMC 3ABMB 2KKWA 1TGOA 2O57A 2E3CA 3CCSV 5IDJA 1XMOB 3RYHB 1EM1A 2C2AA 1VQ7V 3CJHB 1IXBA 3K04A 2P06A 1XMQB 3F5WC 2ITCC 3CCVV 2GTAA 2UXNA 4D7TA 2ZM6O 5AG2A 4X89A 4HBNA 4PI2A 3OE7G 4JI7O 1QLEC 1AI5A 2X6CA 3FAVB 4KFMA 1YTFB 4LFAB 1GO3F 2R9IA 2HP8A 2LO1A 1QVGU 1PL0A 1NH2B 4IHJB 2Z3YA 3S3XA 3QO5A 2A9HA 4WFEA 5L3CA 1WA8B 4MT8A 2LFSA 4LF6O 1R3LC 3K06A 4FLXA 3G67A 5GW7A 3UM7A 2W0XA 1WP7A 2ZQMA 1T5EA 3CPWU 1K3EA 5LYJA 1J5EO 4JZGA 4X64O 1IBMB 1L8DA 3WB0A 3E35A 2AZ2A 4O4HB 3G6BA 3JARA 4IGGA 5LP6A 5FLXN 3TJTA 1OCOB 4FM2A 1NR1A 4F6RB 4UCVA 4I5SA 4X1IB 2BCCH 2YIBA 3FB6C 2FB5A 3HKDB 3R65A 4FLTA 1ZWIC 4X88A 3ABKC 5B1OA 4NKGB 1TVKA 4GKKO 1SQGA 4O2BB 1AR1B 4G27B 4DR4B 2PYJA 3RYFA 2UUAB 3SJQC 4G2KA 2MW2B 1K4DC 1AROP 3Q4HB 2E74B 1AILA 5LXTB 2OIEA 1Q6HA 5L3FA 1M56C 4LC1A 1XMOO 2YIBD 3HPLC 3JD4A 3MHSC 2Z0AA 1H2NA 3K9SA 4J7KA 1M57C 1XMQO 1N34B 3JD3A 1MOFA 1KC8W 3OMAB 4QGPA 3WB2A 2L6LA 4YJ3B 1NI8A 5JWPA 3G71V 1Q5OA 1AVMA 4LFAO 2F4VB 2QGNA 2HEPA 4L8JA 1VQPV 2HVJC 3BHPA 2WLLB 2H94A 2E75B 2AGAA 3CCLV 3SPJA 5L3BA 4J42A 1NT2B 4DYLA 5IYZA 5LHIA 1WN7A 3KZIZ 4TUYA 3CC7V 4NXMB 5CN0A 4WFAV 1SQPH 4ASUG 3E8FA 2BSKB 1H8HG 2EIJB 1IBMO 1XDCA 3UT5B 2OCCC 2QWNB 4CH4A 4DUZB 1JFFA 4TV9B 2UUBB 1WP8A 1A32A 2JRIA 1N36B 3GB7C 4E2LA 5CA3A 4NTXA 3ZX6A 2D3OW 1HNZB 3DTUB 2YSUB 3W7XA 4LWSA 1AB3A 2WLNA 5KHJA 4I0XA 3WU2Z 2AXTZ 4Z1MG 1NZ6A 1ZL8A 2Q6AA 3K57A 4UCUA 3DGEA 4ICGA 2ZNJA 3FYEB 5B3SC 4DR4O 2UUAO 1Y74B 3DXRB 1S5LZ 4I4TA 1KU9A 2RNBA 4UCOA 1PP9H 4I9QA 2PYLA 3HKBA 1XL6A 1BQZA 3AG2C 3LDDA 2WAMA 3A0BZ 5KMGA 4DRXA 1YDXA 3SPGA 4RO2A 4JI2B 2QTSA 4K0KB 5D5PA 1D2DA 5LHHA 4HZ3A 2ZCEA 3I56V 3QO8A 1N34O 3RWRD 3W7TA 1XOUA 3ZJZA 4TSFG 3BABA 4X66O 4DR1B 1KP2A 2AW9A 2JS5A 2F4VO 2IJJA 4JYAB 3CC2V 2JEUA 1ENVA 4PV1B 3APOA 4O4JA 3SJCC 5LYJB 3AG3C 1SS3A 2A79B 3ZRSA 2ARHA 4NXMO 3F7VC 3ZMTA 3ZRXA 4WFBV 1QQCA 5LP6B 4KL1A 3IC9A 2EZPA 1NQTA 3B40A 1OZ0A 3QNEA 4DUZO 2ILMA 2UUBO 1N36O 1CXZB 4JAUA 3B8NA 4GCZA 4MSWC 1IXMA 1YJNV 2NNUA 4UV8A 3CRRA 3AK2A 1HNZO 3A2FA 2F23A 3RW0A 1JVMA 1BZKA 1TVKB 5GTHZ 1KD1W 5BMVB 1XQ8A 4JF3A 3RYFB 1AI7A 3G80A 1UPGA 4ZBMA 1SQXH 1HP8A 4FJCC 4JI3B 4R8CA 1DTOA 1OCRB 1H8EG 4FFBA 5BZBA 1S5HC 4PA9A 4W4KA 2RMKB 1Z5WA 3CCJV 3J81N 3BA9A 1XBLA 2UXBB 2D2CB 2A0LA 4BW9A 2EINC 1MSDA 1VP7A 4DV0B 2CTWA 3CCQV 4JI2O 3IJ4A 1S3JA 4K0KO 1IBLB 5LGUA 2R9AA 2YIDA 3AG1C 1AJNA 4BIOA 1YI2V 1GM7A 2EX3A 2WLJA 4MVUA 1J95A 3SGIA 1EZJA 2RN9A 3K0GA 2MK3A 5EIBD 3ZMUA 3K5LA 2X7RB 2YEVA 3OAAG 4JYYA 3CEIA 4DR1O 2V4DA 4JYAO 4LF7B 4TQFA 3K9AA 4UUJC 5IYZB 3OTOB 3RBZA 1V54C 4TUYB 4OPHA 4JASA 2Q73A 5KX5A 2WLIA 4PDRA 2XAJA 1JFFB 3T4ZA 2P22C 2DYSC 5IJ9A 1GH6A 4RUEA 3ZHRA 3OW2U 2LP7A 3SJBC 2ZKOA 4WFGA 3VOUA 5FPOA 1LR1A 2QR4A 4LWSB 4I0XB 1FD9A 3KG2A 3E89A 2YXHA 3FB5C 1ZL8B 4YY3B 2XT9A 4GX0A 3VQWA 3W7UA 2LW7A 1YEWA 1OV9A 3ETDA 2P7TC 1BT8A 3X2QB 2W6IG 2ATKC 2EJRA 1O9HA 4DV5B 4DR5B 1YSCA 3JAWA 1XNRB 2P67A 1BSMA 1WB8A 1JR9A 3B2EE 4JI3O 3N27A 2F66C 5J9PC 1XILA 3EHBB 3HKBB 2IW5A 1Q90D 2BTOA 4IL6Z 1NKDA 3FKSG 3L70H 5KMGB 4DRXB 2VWJA 2A3QA 1SQFA 1W0KG 1SETA 4CH3A 2UXBO 3E8HA 5CBGA 4KP4A 2ZNIA 4DV0O 3Q4HA 1CEZA 4RQEA 1IBLO 3B4SA 1ORQC 4YIPA 4JPRA 4Q20A 4HYOA 3ZRWA 1WPXA 4MTFA 5F2VO 1B04A 5BXZA 5B1BC 2VQEB 4CZZA 1FFXA 4RAIA 1OCRC 5JJNB 1SQQH 3CMEV 3PN1A 2IJKA 2VQFB 2RQ6A 4NXNB 2CDYA 2LJ2A 3OR7C 4IYHA 4LF7O 3KCXA 1FJGB 1Y4MA 4KHPB 1SQVH 3OTOO 3HKEA 2HG5C 1I0HA 1VF5B 4K3AA 4J80A 2IH1C 2KG7A 2PI5A 2PZSA 1F51A 3SPCA 1JX9A 1TAEA 1VMGA 5EBLC 3LSSA 4WF9V 5JCOA 1DGSA 2UXDB 3CCRV 1TUBA 2X0LA 4FK5C 1ZLZA 4ZKIA 1GN2A 3L71H 1K34A 4X20B 1KKCA 1Q6UA 1NVPD 3OTFA 4YY3O 1H2KA 3N2KA 3J80N 3SPHA 1FS0G 2Q8VA 4LBEC 1IX9A 5CMUA 5DM6V 4PA6A 2F1MA 4JI6B 2XAQA 4DV5O 4X9QA 4DR5O 1XNRO 4WFFA 4FFBB 1DK1A 1BL8A 2PGGA 1COWG 3CXHF 1PL4A 2EJ7A 2XAGA 3CP1A 3WG7B 1E1QG 5ITZA 2ZIMA 4JI5B 5GONA 2JS3A 1YIJV 4FPPA 4LNUA 1NTZH 3SYQA 3ASNC 4JAAA 3JYCA 3CRCA 2YICA 1NTMH 5C93A 1IURA 4CS4A 4RWUA 3VQXA 1W59A 1JA8A 1OCCB 1N32B 3L75H 4X1KA 2YEVB 1QU7A 2VQEO 4PA7A 2CH7A 1NTKH 2ZDIC 3CRMA 1AP5A 4GZRB 4J41A 4K8XA 1N8RW 3H1HH 2VQFO 5GTIZ 4UVBA 1V55B 4NXNO 5H2FZ 1M4UA 1PNKA 4JTAB 5EBWC 5KX5B 1FJGO 4KHPO 4G28B 2WLIB 3UCSC 1BS3A 4DR2B 3SDLA 2IJHA 1QNMA 1PKXA 3D3QA 3H1LH 5IT9N 1DF4A 3AG7A 4AILC 5IJ9B 3TXQA 5IJ0A 2QKSA 3H1JH 3E22A 3JALA 4MVMA 5LBQA 2F93B 3JATB 1R1BA 5JJJB 2UXDO 4DR6B 2JVDA 4JZ2A 5IYCO 2DQ3A 4AQYB 4QE9A 2CE4A 4ZIBA 4FLVA 1VF7A 5E1AC 3EVKA 1JPXA 4JI1B 1EZVH 2YIAA 1H2MA 3JAWB 1L1FA 4B3RB 4QPKA 3CCMV 2XAHA 3D36C 4JI6O 4PA3A 1JCHA 4DV3B 1N4CA 2B1GA 2WLKA 1PNLA 1YITV 2RDCA 3UKMA 3NR7A 5BMVA 3HKCA 1MA1A 4DV2B 4JI5O 3RT3C 2N04A 1VIBA 1M1KW 5DEDA 4L87A 1ZAUA 2ITDC 4BIUA 4I7ZB 4MW8A 5HFMA 5LMUB 2HR3A 1KUQA 3ZRWB 2Y0IA 1VQ5V 1B06A 1SESA 2PUSA 3K3WA 1N32O 3JASA 1FFXB 4GX1A 1VQMV 1BMFG 2OCHA 1FPOA 4BIZA 1GMGA 3TCUA 1K73W 4UXNA 4I50A 1SC5B 3KCYA 4YHHB 1GTOA 4DK0A 5EC1C 3EFFK 5JQGA 1NVPB 1Q82W 3HKEB 5H9CA 4FFKA 4QNHB 1XREA 2KG7B 2P4VA 3O9OA 3B77A 3ABMC 4X66B 4JV5B 1HR0B 4DR2O 2YDEA 3IAYA 2L35A 2CTQA 3NXSA 3QF7A 2LGQA 4FIPC 3J7AU 3OMIB 3SR2C 2WWWA 4W4LA 4EFBA 4MVZA 2IU0A 1TUBB 2DMXA 3N2GA 5KHIA 3T1HB 4DR6O 2QWRB
chains in the Genus database with same CATH topology
1VF6C 1Y74B 1VF6A 3B40A 1Y76A 1Y76B 1ZL8A 1ZL8B 1RSOB 1Y74A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VF6 C;  1Y74 B;  1VF6 A;  3B40 A;  1Y76 A;  1Y76 B;  1ZL8 A;  1ZL8 B;  1RSO B;  1Y74 A; 
#chains in the Genus database with same CATH topology
 3BAA A;  4MVQ A;  4JYB A;  4AQY O;  3N2K B;  3ETG A;  2DYR B;  2ADP A;  1D5N A;  3JAM N;  3E8B A;  3PJS K;  2ZE6 A;  4FLY A;  4JI1 O;  2JK5 C;  4PEL A;  5EYP A;  2ZR3 A;  4HAM A;  4B3R O;  4FM1 A;  1AR5 A;  3ZIA G;  4O2A A;  4DV3 O;  3FD9 A;  3OUS A;  1W0J G;  5ITZ B;  4B7K A;  5GON B;  4H44 B;  3LDC A;  3ASO B;  3DC6 A;  4DV2 O;  4RUF A;  4LNU B;  1GN6 A;  3CX5 F;  1YJW V;  2Q69 A;  5HFL A;  1OCO C;  2JGD B;  4TWK A;  4FZ0 A;  2F43 G;  5LMU O;  5J2T A;  3ZMS A;  1WAZ A;  2OWO A;  2HKO A;  3DSQ A;  4LF8 B;  3B09 A;  5CB4 A;  5KHK A;  4DUY B;  4X1K B;  3AG4 B;  2CH7 B;  1KYO F;  2WPD G;  4DW1 A;  1R3K C;  3LSU A;  1GM9 A;  3JSL A;  3CCU V;  2NLJ C;  1Q43 A;  2WLH A;  1VQL V;  5CBH A;  1RSO B;  2V1D A;  3OT7 A;  2UUC B;  2OT5 A;  4YHH O;  2OIG A;  4BAY A;  5H6R A;  1Q7Y W;  3OFN G;  5J2U A;  5KHG A;  4JV5 O;  5IY5 B;  4AI8 A;  1JJO A;  1HR0 O;  5LMN B;  3H1K H;  5L3G A;  1X4T A;  5EC2 C;  1R73 A;  2XND G;  1US6 A;  4X62 B;  1QHT A;  2Y0P A;  5IJ0 B;  2IU3 A;  3JD2 A;  3E22 B;  5KA5 A;  1HNX B;  3JAL B;  3H9V A;  2GHY A;  3D3I A;  3P30 A;  5BY1 A;  2EIL B;  4R50 A;  4DR7 B;  1P4R A;  1KQS U;  1IZ3 A;  2A7W A;  3BPZ A;  3T1H O;  3IFX A;  4O4L B;  2RJZ A;  2YXL A;  1K97 A;  2OYQ A;  2IH3 C;  2FTK A;  5JVD A;  3CC4 V;  1R6N A;  2M6Y A;  1BQ0 A;  3GWK C;  4JI8 B;  5BR8 B;  2GBO A;  4P9P A;  2EIK B;  3RN4 A;  1ZTE A;  3RFR A;  2JIZ G;  4DR3 B;  3JD1 A;  3ML0 A;  2JJ1 G;  2DJV A;  3FFQ A;  3K0D A;  3GWO A;  4X20 A;  2QE7 G;  1SA0 B;  3U0Z A;  2GDS A;  2E76 B;  3HKC B;  2VWK A;  2JEX A;  3W7S A;  1VQ4 V;  2EIJ C;  2ZXW B;  3W7W A;  4LF5 B;  4JYC A;  3BFR A;  1BGY H;  3DC5 A;  2PY5 A;  4XBF A;  4MTO A;  3FB7 C;  4DK1 A;  2XOK G;  4NTW A;  4ZOL A;  2CGN A;  2YXY A;  1RM1 B;  3JAS B;  4LF8 O;  1G1X B;  3OMN B;  4I9W A;  4DUY O;  1WNS A;  4F6E A;  2KQX A;  3OD4 A;  4D6T H;  3ZHT A;  4I50 B;  4FVM A;  2XHB A;  4HNA A;  5JQG B;  5LGT A;  2UUC O;  3SJA C;  1I94 B;  2LQT A;  3QTC A;  2JGU A;  4GYC B;  1MZF A;  1N0N A;  1UFI A;  3TGU H;  3T4D A;  3UO2 A;  4GT1 A;  1FXK A;  5LMN O;  1E79 G;  1BHB A;  3IGA C;  2Q9L A;  4X62 O;  4LFC B;  3CXC U;  4PDM A;  3ABL B;  5B66 Z;  4LH7 A;  2G38 A;  3ZN0 A;  4GUN A;  1HNX O;  2Q7H A;  1VF6 A;  4D7S A;  4KXR A;  1W2B U;  3N2G B;  2Y48 A;  4QE7 A;  1B6Q A;  2QDO A;  4DR7 O;  1ZX3 A;  1YZB A;  1VQ9 V;  1KKD A;  2CGO A;  4LCU C;  4PA4 A;  4MVS A;  3RGB A;  3T1C A;  4CS2 A;  3M99 B;  1GK9 A;  2UXC B;  1XEQ A;  2F95 B;  5KA6 A;  4JI8 O;  5BR8 O;  3CS5 A;  1PV0 A;  5EYP B;  3C3T A;  3TXS A;  3JAT A;  4B3M B;  1TA8 A;  4DR3 O;  2LW1 A;  4I55 A;  3E8G A;  2VRZ A;  5FPR A;  4O2A B;  2DE0 X;  5DEC A;  2DWD C;  4YXW G;  2X6A A;  3CMA V;  2R72 A;  3B8M A;  4GKJ B;  5LP6 C;  1WPB A;  4JTC B;  4LF5 O;  1Y6X A;  1NS1 A;  1EFR G;  3JSN A;  5J2T B;  5CB4 B;  4EEQ A;  1RPO A;  2QM4 A;  3ZCC A;  5EK0 A;  4UVA A;  2IM9 A;  3I5D A;  5H6Q A;  4OX9 B;  1K8A W;  3CD6 V;  1E1R G;  2PF4 E;  1VQ8 V;  2UU9 B;  2AHY A;  5CA0 A;  4UCT A;  3ZHU A;  2OTL V;  4X65 B;  3CHX A;  1QVF U;  2ZXW C;  1MG1 A;  2HFE C;  4R7C A;  2Y69 B;  3VQV A;  1P49 A;  2QWP B;  1I94 O;  1QLE B;  3CSX A;  4EB6 B;  5J2U B;  3ABU A;  4R6Z A;  4NTY A;  2XUM A;  2HJF C;  3JCZ A;  4DXW A;  4C7U A;  1JMK C;  1MMM A;  1B3Q A;  4LFC O;  1H38 A;  1RP3 B;  1DF5 A;  3BVO A;  3FX7 A;  5D5Q A;  3JCU Z;  4UVC A;  2PTM A;  2GUZ B;  3WFV A;  3UQ8 A;  1H2S B;  5JVD B;  3LUT B;  5LHG A;  1I08 A;  1R3I C;  1G8M A;  3K79 A;  5IE9 A;  1VQ6 V;  3ZBH A;  4JTD B;  2UXC O;  1N33 B;  4MTG A;  4FLU A;  1ZSP A;  1M90 W;  1XUQ A;  4B3M O;  4CH5 A;  3TET A;  1RFY A;  5EZY B;  1N0J A;  1BCC H;  5LOV A;  2ZE5 A;  3ABK B;  1Y76 A;  4IIJ A;  1AJP A;  4GKJ O;  2X6B A;  4U7O A;  3SYP A;  3UO3 A;  1EN6 A;  1GM8 A;  4TT3 G;  5CBF A;  1XL4 A;  1Z5V A;  4ZOL B;  5LGN A;  4P2Z A;  1PPJ H;  4LR3 A;  4F4L A;  5C8Y B;  1SQB H;  1M56 B;  1YF2 A;  1SKV A;  3BCC H;  3ZRV A;  3OGC C;  4OX9 O;  4GX5 A;  4HNA B;  2JGD A;  4QJF B;  1SZX A;  3U11 A;  3X2Q C;  2UU9 O;  1QLN A;  1QCE A;  1Q86 W;  2QJ1 A;  5L3E A;  4X65 O;  3STL C;  1THZ A;  4J7J A;  1WLE A;  1URF A;  5B1A B;  3C3S A;  1KBH A;  4IT5 A;  1M9N A;  3QO7 A;  1FXK B;  1OCZ B;  1LUV A;  2QA4 V;  1GKF A;  1RSO A;  3AEI A;  1K9M W;  2BTQ A;  4WCE V;  5L3D A;  3STZ C;  4J11 A;  2Y4T A;  5JJE B;  4ZI7 A;  4Z2W A;  1SZT A;  2LGW A;  2ZT9 B;  4UFZ A;  3H1I H;  2Y69 C;  2N05 A;  2OCC B;  3S3W A;  3CRA A;  1WJZ A;  3OEE G;  4UB6 Z;  4GLX A;  5LA6 A;  5IWA B;  2YUA A;  4FM0 A;  1K4C C;  4EFE A;  1N33 O;  4I55 B;  1G6U A;  3RYC A;  4O4L A;  2BOB C;  4U3J A;  1I5X A;  4DV6 B;  4TV8 A;  3AK3 A;  1IBK B;  4U7N A;  4CC5 A;  4XDL A;  1U96 A;  4PI0 A;  4UV9 A;  1F4N A;  1VAR A;  1HDJ A;  5B3S B;  4JI4 B;  4JI0 B;  1S76 D;  2AHZ A;  5K1X A;  1XHZ A;  4X1Y A;  1SA0 A;  1YCI A;  2H8P C;  2ZD9 A;  3THO A;  3MAQ A;  4BW5 A;  1R6K A;  1H2L A;  3RVZ A;  4WBN A;  1L0N H;  3ZHS A;  2P5O A;  2QSA A;  1FXV A;  3AG2 B;  3T2M A;  1R3J C;  5CA1 A;  5CA0 B;  4GX2 A;  2CK3 G;  3CWB H;  4ABM A;  4ZHQ A;  3LNM B;  4O4I A;  2QWO B;  2B5U A;  5EIB C;  2JDI G;  2HVK C;  2FYU H;  1UJW B;  3APQ A;  1AI6 A;  2EZO A;  4NYK A;  3WG7 C;  4RQF A;  2Q7G A;  1F7Y A;  4MTX A;  4BR6 A;  2YS8 A;  1KEC A;  4J7Z A;  1S72 V;  5H5N A;  3ZN1 A;  4B7E A;  1JJ2 U;  4P9O A;  2DOS A;  4CS3 A;  3CCE V;  1XHX A;  1K7D A;  3AG3 B;  1S0V A;  4MW3 A;  3E86 A;  3L74 H;  1RPR A;  1HNW B;  1EN4 A;  1LNQ A;  1MZE A;  3ZS8 C;  3SYC A;  1OCC C;  2CUG A;  1HWY A;  4FLW A;  3SPI A;  5B1A C;  2GTS A;  3MDS A;  2K1E A;  1EN5 A;  1K5Q A;  2HJD A;  3QVN A;  1FXK C;  2YI9 A;  3LDE A;  1OCZ C;  5IWA O;  4UCS A;  5IYB O;  1V55 C;  1I7F A;  1QR9 A;  4PDL A;  1AJQ A;  2P4K A;  1FYJ A;  5LOV B;  2ZIN A;  2QWQ B;  1VF6 C;  4DV6 O;  1P7G A;  2IBZ H;  1Y76 B;  1IBK O;  4IIJ B;  1PD3 A;  2FKX A;  1G4Y B;  3GVM A;  3D8C A;  2E5L B;  2XTA A;  4JI4 O;  4JI0 O;  4H0L B;  2AZ0 A;  4KUM A;  3CYO A;  2B9Z A;  3ZMZ A;  1K92 A;  4JAV A;  1XI1 A;  3K5M A;  3T1Y B;  4TQD A;  1K5S A;  2EIN B;  3ETQ A;  2B1I A;  4H37 A;  4H13 B;  2BOC C;  3AG1 B;  1S5J A;  5KAF Z;  2DWE C;  2HLD G;  4N21 A;  1Q3E A;  5FNV A;  1NJI W;  3RYI A;  3JAK A;  4LFB B;  1SF9 A;  4J9Y B;  4LF9 B;  1D5A A;  2ZDI A;  4LF4 B;  2BTQ B;  4AHC A;  4LP8 A;  4OPA A;  4IYI A;  5KUM A;  1SER A;  4EB6 A;  2Q68 A;  1V54 B;  4ZI7 B;  2DN9 A;  4MVR A;  3K5N A;  1I5Y A;  1HNW O;  3AK1 A;  2Q7E A;  4DV1 B;  1GRJ A;  2QKC A;  3CRQ A;  1CPY A;  1KMI Z;  3LSQ A;  2DYS B;  5LA6 B;  2EBO A;  4CH6 A;  2WA4 A;  1IDS A;  1MAB G;  3ZED A;  2K9P A;  3O65 A;  4QIW F;  1P7B A;  1SRY A;  2GUZ A;  3RYC B;  5FL7 G;  4PHZ A;  4U3J B;  5TIS Z;  2KB1 A;  4P30 A;  3FB8 C;  1GN3 A;  1GN4 A;  4TV8 B;  3A0R A;  4B3S B;  1FKA O;  4DV7 B;  3L73 H;  4OGQ B;  1L0L H;  2EIM B;  2H3O A;  2XAF A;  2WA3 A;  2XAS A;  1Z2G A;  3JAR B;  1ZUQ A;  2E5L O;  1MSW D;  4X1Y B;  3L9D A;  3D36 A;  5JCO C;  5EZY A;  1VEW A;  2R70 A;  1X59 A;  3MHH C;  4CBC A;  4WBN B;  3OUF A;  1YXB A;  1FAF A;  5KHH A;  1QR8 A;  5CA1 B;  4CC6 A;  1HW7 A;  2DYR C;  3A0H Z;  3CE2 A;  3MD0 A;  3RVY A;  4ZHQ B;  4YJ2 A;  1FXH A;  3A8T A;  3ZHQ A;  4O4I B;  3T1Y O;  1KP3 A;  2ETN A;  3G6E V;  2R9R B;  1OHH G;  3ICX A;  2PI4 A;  1GAX A;  4NVP A;  2IJI A;  1DLB A;  3CB2 A;  5C8Y A;  3KKY A;  1F23 A;  5B1B B;  4J9Z B;  2ZE7 A;  2HHH B;  4MS2 A;  4LFB O;  4TOI A;  2FML A;  3ASO C;  1IVS A;  2DQ0 A;  4LF9 O;  2JJ2 G;  5B5E Z;  4LF4 O;  2QM8 A;  3OGI B;  4K8Z A;  1R6T A;  5KAI Z;  1FFT B;  2DW4 A;  2Q4P A;  2ZR2 A;  5K1P A;  2LFR A;  1PNM A;  4DW0 A;  5JH7 A;  4B3T B;  4Z1V A;  3AG4 C;  2ODM A;  2VS0 A;  4DV1 O;  1F4M A;  4N23 A;  3RYH A;  2WSS G;  5KLV H;  3BA8 A;  3CJH A;  3K03 A;  2V7Q G;  1OJH A;  5KUK A;  4DV4 B;  2N74 A;  1NU1 H;  3JD0 A;  4X8A A;  3HB3 B;  4B3S O;  1YHQ V;  3VBB A;  4B08 A;  5IY5 C;  3FAV A;  3ZMV A;  4DV7 O;  4E4E A;  2ZE8 A;  1Y67 A;  4IHJ A;  4NB5 A;  1S77 D;  1M93 A;  4Q6G A;  1WA8 A;  2P90 A;  1ROP A;  1TUE B;  4LH6 A;  3C90 A;  4NR1 A;  4FMT A;  2EIL C;  3WB1 A;  4PJ0 Z;  2W0F C;  5B1N A;  2CAZ C;  3BEH A;  2Z5U A;  4QPJ A;  1AR4 A;  4H33 A;  3P32 A;  3F5T A;  2W6J G;  2FL4 A;  2NN4 A;  3TK1 A;  1Q6I A;  4O4H A;  3ASN B;  3M7M X;  2ADQ B;  2Y4U A;  3BY6 A;  2EIK C;  3H01 A;  2KSD A;  1U97 A;  5E79 Z;  1YTF D;  2EIM C;  4F6R A;  3SYA A;  5DN6 G;  1NH2 D;  2YC0 A;  5A9G A;  5FNV B;  4I4T B;  4X1I A;  3RYI B;  3K5O A;  3JAK B;  3OM3 B;  3HKD A;  5A2Q N;  3K08 A;  2HHH O;  1XNQ B;  2EUL A;  1VQK V;  3ZHV A;  2Q5Z A;  2CTP A;  1JOY A;  2OTJ V;  1NBM G;  4O2B A;  2RCV A;  3F7Y C;  3ABT A;  4DO2 A;  2QM7 A;  1EBO A;  1VQO V;  4MVO A;  2BE3 A;  1LUW A;  1PM9 A;  4JGS A;  5LXT A;  1RM1 C;  1BE3 H;  3U10 A;  1CP9 A;  4B3T O;  5IYD O;  1BHA A;  1YJ9 V;  1Y66 A;  1M5I A;  4XDJ A;  1YVW A;  1MNG A;  3M8A A;  3E83 A;  2ZM6 B;  3OR6 C;  4JI7 B;  4UB8 Z;  4DV4 O;  4FLZ A;  4WFH A;  2WLM A;  3EXA A;  2CTR A;  2P6J A;  4O4J B;  3HR0 A;  3VQY A;  4YJ3 A;  2ZIO A;  1K33 A;  2NR5 A;  4LF6 B;  2Q67 A;  2QKA A;  1P84 F;  1VQN V;  2WLL A;  3R66 A;  3ABL C;  1WB7 A;  1O9G A;  1J5E B;  4BWA A;  4X64 B;  1AI4 A;  3E2E A;  3LNN A;  4J10 A;  2GSM B;  1QBZ A;  3I55 V;  1Q8I A;  2BSK A;  4YIO A;  3SYO A;  3P3P A;  4PDV A;  3UT5 A;  4YJ2 B;  3IC7 A;  3P3N A;  4FZ1 A;  3K58 A;  3ETE A;  5LL6 Y;  4K35 A;  1JQ0 A;  2A06 H;  1AP6 A;  3BRC A;  3L72 H;  4TV9 A;  4OXS A;  2GV9 A;  1Q81 W;  2UXX A;  3K59 A;  2Q0O C;  4EKW A;  4XDK A;  3G4S V;  1KB9 F;  4PD4 F;  1V9P A;  1H2G A;  4U3F H;  4UCR A;  2Q0A A;  3FYI B;  1M57 B;  3OEH G;  4GKK B;  2YI8 A;  2QEX V;  1XNQ O;  4A5U B;  2M7W A;  1NR7 A;  1Y74 A;  3QG5 A;  3DXR A;  2QTO A;  5JH7 B;  5EBM C;  3ABM B;  2KKW A;  1TGO A;  2O57 A;  2E3C A;  3CCS V;  5IDJ A;  1XMO B;  3RYH B;  1EM1 A;  2C2A A;  1VQ7 V;  3CJH B;  1IXB A;  3K04 A;  2P06 A;  1XMQ B;  3F5W C;  2ITC C;  3CCV V;  2GTA A;  2UXN A;  4D7T A;  2ZM6 O;  5AG2 A;  4X89 A;  4HBN A;  4PI2 A;  3OE7 G;  4JI7 O;  1QLE C;  1AI5 A;  2X6C A;  3FAV B;  4KFM A;  1YTF B;  4LFA B;  1GO3 F;  2R9I A;  2HP8 A;  2LO1 A;  1QVG U;  1PL0 A;  1NH2 B;  4IHJ B;  2Z3Y A;  3S3X A;  3QO5 A;  2A9H A;  4WFE A;  5L3C A;  1WA8 B;  4MT8 A;  2LFS A;  4LF6 O;  1R3L C;  3K06 A;  4FLX A;  3G67 A;  5GW7 A;  3UM7 A;  2W0X A;  1WP7 A;  2ZQM A;  1T5E A;  3CPW U;  1K3E A;  5LYJ A;  1J5E O;  4JZG A;  4X64 O;  1IBM B;  1L8D A;  3WB0 A;  3E35 A;  2AZ2 A;  4O4H B;  3G6B A;  3JAR A;  4IGG A;  5LP6 A;  5FLX N;  3TJT A;  1OCO B;  4FM2 A;  1NR1 A;  4F6R B;  4UCV A;  4I5S A;  4X1I B;  2BCC H;  2YIB A;  3FB6 C;  2FB5 A;  3HKD B;  3R65 A;  4FLT A;  1ZWI C;  4X88 A;  3ABK C;  5B1O A;  4NKG B;  1TVK A;  4GKK O;  1SQG A;  4O2B B;  1AR1 B;  4G27 B;  4DR4 B;  2PYJ A;  3RYF A;  2UUA B;  3SJQ C;  4G2K A;  2MW2 B;  1K4D C;  1ARO P;  3Q4H B;  2E74 B;  1AIL A;  5LXT B;  2OIE A;  1Q6H A;  5L3F A;  1M56 C;  4LC1 A;  1XMO O;  2YIB D;  3HPL C;  3JD4 A;  3MHS C;  2Z0A A;  1H2N A;  3K9S A;  4J7K A;  1M57 C;  1XMQ O;  1N34 B;  3JD3 A;  1MOF A;  1KC8 W;  3OMA B;  4QGP A;  3WB2 A;  2L6L A;  4YJ3 B;  1NI8 A;  5JWP A;  3G71 V;  1Q5O A;  1AVM A;  4LFA O;  2F4V B;  2QGN A;  2HEP A;  4L8J A;  1VQP V;  2HVJ C;  3BHP A;  2WLL B;  2H94 A;  2E75 B;  2AGA A;  3CCL V;  3SPJ A;  5L3B A;  4J42 A;  1NT2 B;  4DYL A;  5IYZ A;  5LHI A;  1WN7 A;  3KZI Z;  4TUY A;  3CC7 V;  4NXM B;  5CN0 A;  4WFA V;  1SQP H;  4ASU G;  3E8F A;  2BSK B;  1H8H G;  2EIJ B;  1IBM O;  1XDC A;  3UT5 B;  2OCC C;  2QWN B;  4CH4 A;  4DUZ B;  1JFF A;  4TV9 B;  2UUB B;  1WP8 A;  1A32 A;  2JRI A;  1N36 B;  3GB7 C;  4E2L A;  5CA3 A;  4NTX A;  3ZX6 A;  2D3O W;  1HNZ B;  3DTU B;  2YSU B;  3W7X A;  4LWS A;  1AB3 A;  2WLN A;  5KHJ A;  4I0X A;  3WU2 Z;  2AXT Z;  4Z1M G;  1NZ6 A;  1ZL8 A;  2Q6A A;  3K57 A;  4UCU A;  3DGE A;  4ICG A;  2ZNJ A;  3FYE B;  5B3S C;  4DR4 O;  2UUA O;  1Y74 B;  3DXR B;  1S5L Z;  4I4T A;  1KU9 A;  2RNB A;  4UCO A;  1PP9 H;  4I9Q A;  2PYL A;  3HKB A;  1XL6 A;  1BQZ A;  3AG2 C;  3LDD A;  2WAM A;  3A0B Z;  5KMG A;  4DRX A;  1YDX A;  3SPG A;  4RO2 A;  4JI2 B;  2QTS A;  4K0K B;  5D5P A;  1D2D A;  5LHH A;  4HZ3 A;  2ZCE A;  3I56 V;  3QO8 A;  1N34 O;  3RWR D;  3W7T A;  1XOU A;  3ZJZ A;  4TSF G;  3BAB A;  4X66 O;  4DR1 B;  1KP2 A;  2AW9 A;  2JS5 A;  2F4V O;  2IJJ A;  4JYA B;  3CC2 V;  2JEU A;  1ENV A;  4PV1 B;  3APO A;  4O4J A;  3SJC C;  5LYJ B;  3AG3 C;  1SS3 A;  2A79 B;  3ZRS A;  2ARH A;  4NXM O;  3F7V C;  3ZMT A;  3ZRX A;  4WFB V;  1QQC A;  5LP6 B;  4KL1 A;  3IC9 A;  2EZP A;  1NQT A;  3B40 A;  1OZ0 A;  3QNE A;  4DUZ O;  2ILM A;  2UUB O;  1N36 O;  1CXZ B;  4JAU A;  3B8N A;  4GCZ A;  4MSW C;  1IXM A;  1YJN V;  2NNU A;  4UV8 A;  3CRR A;  3AK2 A;  1HNZ O;  3A2F A;  2F23 A;  3RW0 A;  1JVM A;  1BZK A;  1TVK B;  5GTH Z;  1KD1 W;  5BMV B;  1XQ8 A;  4JF3 A;  3RYF B;  1AI7 A;  3G80 A;  1UPG A;  4ZBM A;  1SQX H;  1HP8 A;  4FJC C;  4JI3 B;  4R8C A;  1DTO A;  1OCR B;  1H8E G;  4FFB A;  5BZB A;  1S5H C;  4PA9 A;  4W4K A;  2RMK B;  1Z5W A;  3CCJ V;  3J81 N;  3BA9 A;  1XBL A;  2UXB B;  2D2C B;  2A0L A;  4BW9 A;  2EIN C;  1MSD A;  1VP7 A;  4DV0 B;  2CTW A;  3CCQ V;  4JI2 O;  3IJ4 A;  1S3J A;  4K0K O;  1IBL B;  5LGU A;  2R9A A;  2YID A;  3AG1 C;  1AJN A;  4BIO A;  1YI2 V;  1GM7 A;  2EX3 A;  2WLJ A;  4MVU A;  1J95 A;  3SGI A;  1EZJ A;  2RN9 A;  3K0G A;  2MK3 A;  5EIB D;  3ZMU A;  3K5L A;  2X7R B;  2YEV A;  3OAA G;  4JYY A;  3CEI A;  4DR1 O;  2V4D A;  4JYA O;  4LF7 B;  4TQF A;  3K9A A;  4UUJ C;  5IYZ B;  3OTO B;  3RBZ A;  1V54 C;  4TUY B;  4OPH A;  4JAS A;  2Q73 A;  5KX5 A;  2WLI A;  4PDR A;  2XAJ A;  1JFF B;  3T4Z A;  2P22 C;  2DYS C;  5IJ9 A;  1GH6 A;  4RUE A;  3ZHR A;  3OW2 U;  2LP7 A;  3SJB C;  2ZKO A;  4WFG A;  3VOU A;  5FPO A;  1LR1 A;  2QR4 A;  4LWS B;  4I0X B;  1FD9 A;  3KG2 A;  3E89 A;  2YXH A;  3FB5 C;  1ZL8 B;  4YY3 B;  2XT9 A;  4GX0 A;  3VQW A;  3W7U A;  2LW7 A;  1YEW A;  1OV9 A;  3ETD A;  2P7T C;  1BT8 A;  3X2Q B;  2W6I G;  2ATK C;  2EJR A;  1O9H A;  4DV5 B;  4DR5 B;  1YSC A;  3JAW A;  1XNR B;  2P67 A;  1BSM A;  1WB8 A;  1JR9 A;  3B2E E;  4JI3 O;  3N27 A;  2F66 C;  5J9P C;  1XIL A;  3EHB B;  3HKB B;  2IW5 A;  1Q90 D;  2BTO A;  4IL6 Z;  1NKD A;  3FKS G;  3L70 H;  5KMG B;  4DRX B;  2VWJ A;  2A3Q A;  1SQF A;  1W0K G;  1SET A;  4CH3 A;  2UXB O;  3E8H A;  5CBG A;  4KP4 A;  2ZNI A;  4DV0 O;  3Q4H A;  1CEZ A;  4RQE A;  1IBL O;  3B4S A;  1ORQ C;  4YIP A;  4JPR A;  4Q20 A;  4HYO A;  3ZRW A;  1WPX A;  4MTF A;  5F2V O;  1B04 A;  5BXZ A;  5B1B C;  2VQE B;  4CZZ A;  1FFX A;  4RAI A;  1OCR C;  5JJN B;  1SQQ H;  3CME V;  3PN1 A;  2IJK A;  2VQF B;  2RQ6 A;  4NXN B;  2CDY A;  2LJ2 A;  3OR7 C;  4IYH A;  4LF7 O;  3KCX A;  1FJG B;  1Y4M A;  4KHP B;  1SQV H;  3OTO O;  3HKE A;  2HG5 C;  1I0H A;  1VF5 B;  4K3A A;  4J80 A;  2IH1 C;  2KG7 A;  2PI5 A;  2PZS A;  1F51 A;  3SPC A;  1JX9 A;  1TAE A;  1VMG A;  5EBL C;  3LSS A;  4WF9 V;  5JCO A;  1DGS A;  2UXD B;  3CCR V;  1TUB A;  2X0L A;  4FK5 C;  1ZLZ A;  4ZKI A;  1GN2 A;  3L71 H;  1K34 A;  4X20 B;  1KKC A;  1Q6U A;  1NVP D;  3OTF A;  4YY3 O;  1H2K A;  3N2K A;  3J80 N;  3SPH A;  1FS0 G;  2Q8V A;  4LBE C;  1IX9 A;  5CMU A;  5DM6 V;  4PA6 A;  2F1M A;  4JI6 B;  2XAQ A;  4DV5 O;  4X9Q A;  4DR5 O;  1XNR O;  4WFF A;  4FFB B;  1DK1 A;  1BL8 A;  2PGG A;  1COW G;  3CXH F;  1PL4 A;  2EJ7 A;  2XAG A;  3CP1 A;  3WG7 B;  1E1Q G;  5ITZ A;  2ZIM A;  4JI5 B;  5GON A;  2JS3 A;  1YIJ V;  4FPP A;  4LNU A;  1NTZ H;  3SYQ A;  3ASN C;  4JAA A;  3JYC A;  3CRC A;  2YIC A;  1NTM H;  5C93 A;  1IUR A;  4CS4 A;  4RWU A;  3VQX A;  1W59 A;  1JA8 A;  1OCC B;  1N32 B;  3L75 H;  4X1K A;  2YEV B;  1QU7 A;  2VQE O;  4PA7 A;  2CH7 A;  1NTK H;  2ZDI C;  3CRM A;  1AP5 A;  4GZR B;  4J41 A;  4K8X A;  1N8R W;  3H1H H;  2VQF O;  5GTI Z;  4UVB A;  1V55 B;  4NXN O;  5H2F Z;  1M4U A;  1PNK A;  4JTA B;  5EBW C;  5KX5 B;  1FJG O;  4KHP O;  4G28 B;  2WLI B;  3UCS C;  1BS3 A;  4DR2 B;  3SDL A;  2IJH A;  1QNM A;  1PKX A;  3D3Q A;  3H1L H;  5IT9 N;  1DF4 A;  3AG7 A;  4AIL C;  5IJ9 B;  3TXQ A;  5IJ0 A;  2QKS A;  3H1J H;  3E22 A;  3JAL A;  4MVM A;  5LBQ A;  2F93 B;  3JAT B;  1R1B A;  5JJJ B;  2UXD O;  4DR6 B;  2JVD A;  4JZ2 A;  5IYC O;  2DQ3 A;  4AQY B;  4QE9 A;  2CE4 A;  4ZIB A;  4FLV A;  1VF7 A;  5E1A C;  3EVK A;  1JPX A;  4JI1 B;  1EZV H;  2YIA A;  1H2M A;  3JAW B;  1L1F A;  4B3R B;  4QPK A;  3CCM V;  2XAH A;  3D36 C;  4JI6 O;  4PA3 A;  1JCH A;  4DV3 B;  1N4C A;  2B1G A;  2WLK A;  1PNL A;  1YIT V;  2RDC A;  3UKM A;  3NR7 A;  5BMV A;  3HKC A;  1MA1 A;  4DV2 B;  4JI5 O;  3RT3 C;  2N04 A;  1VIB A;  1M1K W;  5DED A;  4L87 A;  1ZAU A;  2ITD C;  4BIU A;  4I7Z B;  4MW8 A;  5HFM A;  5LMU B;  2HR3 A;  1KUQ A;  3ZRW B;  2Y0I A;  1VQ5 V;  1B06 A;  1SES A;  2PUS A;  3K3W A;  1N32 O;  3JAS A;  1FFX B;  4GX1 A;  1VQM V;  1BMF G;  2OCH A;  1FPO A;  4BIZ A;  1GMG A;  3TCU A;  1K73 W;  4UXN A;  4I50 A;  1SC5 B;  3KCY A;  4YHH B;  1GTO A;  4DK0 A;  5EC1 C;  3EFF K;  5JQG A;  1NVP B;  1Q82 W;  3HKE B;  5H9C A;  4FFK A;  4QNH B;  1XRE A;  2KG7 B;  2P4V A;  3O9O A;  3B77 A;  3ABM C;  4X66 B;  4JV5 B;  1HR0 B;  4DR2 O;  2YDE A;  3IAY A;  2L35 A;  2CTQ A;  3NXS A;  3QF7 A;  2LGQ A;  4FIP C;  3J7A U;  3OMI B;  3SR2 C;  2WWW A;  4W4L A;  4EFB A;  4MVZ A;  2IU0 A;  1TUB B;  2DMX A;  3N2G A;  5KHI A;  3T1H B;  4DR6 O;  2QWR B; 
#chains in the Genus database with same CATH homology
 1VF6 C;  1Y74 B;  1VF6 A;  3B40 A;  1Y76 A;  1Y76 B;  1ZL8 A;  1ZL8 B;  1RSO B;  1Y74 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...