1Y74B

Solution structure of mlin-2/mlin-7 l27 domain complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
50
structure length
50
Chain Sequence
AVQRAKEVLEEISCYPENNDAKELKRILTQPHFMALLQTHDVVAHEVYSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A unified assembly mode revealed by the structures of tetrameric L27 domain complexes formed by mLin-2/mLin-7 and Patj/Pals1 scaffold proteins.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
molecule keywords lin 7 homolog b
total genus 16
structure length 50
sequence length 50
chains with identical sequence D
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2004-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.650 Mainly Alpha Orthogonal Bundle Helix Hairpins L27 domain 1y74B00
1VF6A 1ZL8A 1Y74B 3B40A 1RSOB 1Y76A 1Y74A 1Y76B 1VF6C 1ZL8B
chains in the Genus database with same CATH superfamily
1SQGA 1X4TA 2XTAA 2CGNA 4CS2A 2OWOA 1JVMA 3CEIA 3THOA 4KXRA 2WLIA 2IH3C 4DV2O 1KUQA 4UVBA 3CRMA 3FKSG 3WG7B 4K8XA 2UXXA 4JZGA 3S3WA 4UCUA 2XT9A 3BY6A 3B8MA 3CCMV 4YHHB 5BMVB 2ZDIA 3VOUA 1Y4MA 5H5NA 2LQTA 4TSFG 5LL6Y 3K5LA 1Q86W 3ZHRA 1JA8A 1BZKA 2GV9A 4GLXA 1G6UA 1K5QA 3RFRA 3TXSA 1XREA 1OZ0A 3K0DA 4HZ3A 5EBMC 3E22A 2PI4A 4RUFA 2EILB 2DJVA 1RPOA 3C3SA 3A8TA 3N2KB 5EZYA 1N33O 3K5NA 3APQA 1F23A 2F23A 3OEHG 1HP8A 2DN9A 3LSQA 5GONA 1U97A 3LUTB 1XNRO 4X1KB 1OCCB 1SQPH 2YDEA 3WB0A 3JYCA 4R6ZA 4IL6Z 4LF4O 1M93A 1CEZA 3HKBA 2AGAA 2E5LO 1F7YA 2FYUH 4JAUA 2Z0AA 3RYHB 4LNUB 1AI4A 1XDCA 3CD6V 2QR4A 2YSUB 2XAFA 4GX5A 3E22B 2UU9B 5LP6B 4OPAA 4O2AB 3UT5B 2BOCC 2JEXA 1VQNV 2YIBD 4MTOA 1VF6C 3A2FA 1NKDA 4WBNA 2YXYA 3JARB 2R72A 4LH6A 3W7SA 3CRCA 1YI2V 3DSQA 4GX2A 5IWAO 1AB3A 1PL0A 1K73W 5LMUO 1YDXA 4UCVA 3H1HH 4Z1VA 3BA9A 3CRQA 2QM7A 4LNUA 1PNLA 1SQXH 2WAMA 3PN1A 1N33B 5J2TB 3H1KH 3ZRWB 1QVGU 1F51A 1MABG 3U11A 4I0XA 4DV5B 1ZWIC 2IBZH 1PNKA 3AG4B 3T1YO 1XUQA 3Q4HA 3CP1A 4PDLA 3DXRB 3G6EV 5KAFZ 4HAMA 2LFRA 3K9SA 1Q6UA 1PP9H 1ZL8A 4WF9V 3H1JH 2E5LB 4GKKO 1Z2GA 1QR8A 1IBLB 4PELA 3WG7C 2R9RB 3OMNB 3A0BZ 5KHGA 5IYZA 2DE0X 3QNEA 1RFYA 3K59A 1XQ8A 3JCUZ 4JI4O 1PL4A 3RGBA 1AR5A 4DV0B 3ZRWA 4YIOA 1Y6XA 3A0HZ 4MT8A 3CCLV 1IVSA 1QBZA 2OT5A 2LGQA 4UVCA 5FNVA 1NQTA 4ZIBA 4FM1A 1XMQB 2ARHA 2WA3A 3ABKB 4GT1A 5B5EZ 5GTIZ 3E8GA 2UUCB 4DR4O 3ZX6A 1BCCH 2DYSB 4MTFA 1H2NA 4JAVA 1R3KC 4TV9B 3JASA 3JATB 2ADPA 1B04A 5KA6A 3AK2A 3HKEB 4TT3G 1R3LC 2DMXA 1ORQC 4FLZA 1JFFA 4Q6GA 3AG3C 1KBHA 1TVKB 5D5PA 2GHYA 4MTGA 4O4IB 4PA4A 2YICA 1PD3A 2E3CA 2JK5C 2XAQA 1I94B 1Q43A 1R6TA 5IJ9B 5FLXN 3UCSC 1FJGB 2Q5ZA 3JD4A 1SESA 5EIBD 5H9CA 4LFAB 1AI6A 5KA5A 2VWKA 3EHBB 3FB6C 2JRIA 4NR1A 1NTZH 1MA1A 4B7KA 2WWWA 5J2UA 3B2EE 4JTCB 3T1HO 3G4SV 2CK3G 3KZIZ 2QWOB 2MW2B 3FB7C 3OR7C 2ZNIA 2HLDG 2XNDG 4RQFA 3OUFA 4FIPC 5LXTB 1Y67A 3L70H 4WFHA 2XHBA 1QVFU 1K34A 1I5YA 3TETA 3BPZA 3E8HA 2L6LA 4F6EA 3RT3C 3KKYA 5CA1A 1AP6A 2YUAA 3SPHA 3JSNA 3L71H 1R1BA 4O4LB 1VP7A 2ETNA 2EIJB 2KSDA 2GSMB 3HKDA 2Q73A 4X89A 1SC5B 3RYHA 5J2UB 3HKCA 5EBWC 3FYIB 4D7TA 1E79G 2F4VO 3GVMA 1M57C 5LMNB 4FPPA 2ZD9A 3T1YB 1S72V 2Y4UA 4TV8A 1ZSPA 1P4RA 1XHXA 3E86A 2Y69C 3IJ4A 4LFAO 4B3RB 1Q8IA 3WFVA 1QLEB 2ZNJA 4QJFB 3AG1B 4LF9O 2VQEO 3AEIA 2CTWA 2ZIOA 5C93A 5DN6G 1GN3A 1SQQH 2V7QG 2F43G 3D36A 3RBZA 2OCCB 2WPDG 3JALB 3I56V 1YJ9V 4UUJC 2HFEC 4IGGA 3F5WC 2IJIA 2IJHA 2PY5A 3SPJA 4E2LA 3IC9A 2X7RB 3RYIB 5CB4A 1Q6IA 1AP5A 1IBKB 3B40A 3TJTA 4YHHO 2YEVB 1F4MA 1GN6A 1YVWA 3OR6C 1XL6A 4DR6O 1H38A 2IU3A 3OE7G 1NT2B 5IJ0A 4JI5O 2JS5A 3ZHTA 5JJEB 3FB8C 2QWNB 3ASNC 2BSKB 4CS4A 2F1MA 1BHBA 1SQVH 1N36O 4JASA 5B1BC 2VRZA 4NVPA 2EIJC 2Q7GA 4DO2A 1UPGA 4H37A 1KP2A 4PD4F 1SA0A 4JAAA 1HR0B 1R6NA 3T1HB 2DQ3A 1L1FA 2LW1A 3G71V 4IIJB 5BY1A 4BW5A 1EN5A 2UXNA 3OTOB 1SQFA 3VQXA 3CHXA 4MVUA 4ZI7A 4DV2B 3H9VA 2F95B 4BIZA 4L8JA 3DGEA 4I4TB 1E1RG 4J11A 4JI2O 1TGOA 3JARA 5LXTA 1HNWB 1P7GA 4QE9A 2PZSA 2DW4A 1IBMB 4PV1B 3EXAA 2JIZG 3QVNA 3ZHUA 1LR1A 4UCOA 3RYFA 2JS3A 1NI8A 3K04A 4IYIA 2HHHB 3BEHA 5TISZ 4H13B 2P22C 3LDDA 2BOBC 3ZJZA 3VQYA 3JD3A 4AILC 2OCHA 1NBMG 4W4KA 3J7AU 1UJWB 3BRCA 4XDLA 1OJHA 2BTQA 2QWQB 2AXTZ 3ZIAG 1KQSU 4JYBA 2HJDA 3L74H 4LF5B 2LP7A 4PA7A 3J80N 1VQ5V 4KHPB 1THZA 2CTQA 3ABLB 4TUYA 5B3SC 1BHAA 4FFKA 1CXZB 2DOSA 3ETGA 4OGQB 1DGSA 2M7WA 4J7KA 4RO2A 5IE9A 1BMFG 1MMMA 2XOKG 2YIBA 4DUYO 2KG7A 4XDJA 1JQ0A 1N32O 3X2QC 3P32A 2Y48A 2XAHA 1J5EO 4NKGB 1HNZO 2E75B 3BCCH 4JI7B 3M99B 2ZDIC 1Q5OA 1OCZB 1VQLV 1G8MA 3H1IH 3ZMSA 4U3JB 1Z5VA 4YY3O 1RM1B 4LF6O 4NTXA 1IXBA 4PHZA 3ZMZA 3JAKB 2HHHO 1XL4A 3EFFK 5EYPB 2ADQB 3OUSA 1IXMA 5FPOA 1T5EA 4DR4B 1YZBA 2ODMA 1VQKV 3K06A 4OXSA 2E74B 3SYQA 4LFBB 4DR5O 1VQ4V 2JDIG 1DF4A 2UXCO 2A0LA 5L3CA 3NR7A 2X6CA 4MTXA 1EM1A 5IJ0B 3JD2A 4HNAA 3MHHC 4U3FH 4IHJB 1W0KG 1TUBA 3KCXA 4J7JA 4FLXA 4U3JA 1AILA 2XAJA 1Q90D 1WP7A 3ICXA 4BIOA 2Q68A 2QJ1A 2QTOA 1VQMV 2YS8A 3SYCA 1WA8B 4FFBB 5JWPA 3DC5A 3JAWB 3ZMTA 1FPOA 4A5UB 3A0RA 3RYCA 4FFBA 4Q20A 3AG2C 4ZOLB 4X64O 4U7NA 2BSKA 3D8CA 4O4IA 4R7CA 3FD9A 1WNSA 4X62B 3LNMB 4IHJA 4AI8A 3VBBA 1KC8W 4X1IB 4O2BA 2C2AA 5C8YA 1R6KA 1Y66A 2EIKB 1Y76B 4B08A 1V54B 3HPLC 2LFSA 5JH7A 4DV0O 4JI0O 4DV4B 4X65O 4UCSA 3T2MA 3C3TA 5IY5C 1Q82W 5BR8O 1YITV 5CBFA 2IJJA 2UUCO 3OT7A 4O4JB 4KHPO 5F2VO 2F4VB 2P4VA 2PTMA 1OCRC 4DUZB 4X1YB 3CJHB 3SYOA 2HP8A 1VQ7V 4D6TH 4TQFA 1I94O 2WLMA 3KCYA 4WFGA 1AR1B 3ZRXA 4FLYA 2OYQA 1FYJA 3ETEA 5L3DA 3LDCA 1H8HG 2QKSA 1R3JC 4JI6O 3KG2A 4UB8Z 5DM6V 5KX5A 3ABKC 2ITDC 4O4HB 3CXCU 3ZHSA 4GKKB 1S5LZ 3MD0A 4J42A 3CMAV 1KYOF 4LCUC 1L0NH 5IT9N 3P30A 3TK1A 1AI7A 3F7VC 3E8FA 3T4DA 1FXKC 3QG5A 2K1EA 1JJOA 2Q9LA 5IYZB 1M9NA 2EINB 4CC6A 1JOYA 2FTKA 1XNQB 4MSWC 1S3JA 2QA4V 2VWJA 1S0VA 4JI8B 4UCRA 1UFIA 1OCCC 4U7OA 1O9GA 4DR3B 1VEWA 2RCVA 1NTKH 3UM7A 4CC5A 5EYPA 3RVYA 3BVOA 4TV9A 4QPKA 4X9QA 3HKBB 3OGCC 3STLC 2ZIMA 5KHHA 1D5NA 2JJ1G 4UCTA 4IYHA 2MK3A 3CRRA 4ZI7B 2K9PA 2VQEB 4DRXA 4UB6Z 1NTMH 2XASA 1AJPA 1N4CA 3K03A 4B3SB 2Y69B 1W59A 1EBOA 3ABUA 3CCQV 1JX9A 2LJ2A 3D36C 3OMIB 5L3EA 1XI1A 3OEEG 1K92A 1M5IA 3UKMA 1Y76A 1OCOC 2LW7A 1DF5A 1U96A 2ZQMA 1QU7A 3ETQA 5IY5B 5LOVB 1FAFA 1SKVA 1DLBA 3BAAA 4DRXB 4UXNA 1GM8A 4K8ZA 2V1DA 2CE4A 1A32A 2E76B 3FAVA 3QO5A 1LUWA 4JYAB 2OIEA 2H94A 1GM7A 4X20A 4DR3O 3OMAB 4MS2A 3SJAC 1QLEC 4RAIA 3CCSV 3FAVB 5J9PC 1VF7A 3LSUA 2Z5UA 5B1BB 5CA1B 1N36B 1US6A 2RNBA 3SPIA 2WLIB 4PDRA 4JI5B 2HVJC 4W4LA 1GK9A 1BQZA 1WJZA 1WAZA 1PKXA 5LA6B 2Q4PA 5LYJB 1K9MW 3CSXA 2UXDO 1M4UA 1MSDA 4PDVA 4YJ3B 4PA6A 4FM2A 3OTOO 5CB4B 3OFNG 2UXBB 1YXBA 2BTQB 2Q6AA 3K3WA 5ITZA 2YEVA 5E79Z 2BCCH 4DK1A 4FM0A 1CPYA 4P30A 4UV8A 3E35A 1H2LA 3NXSA 4J7ZA 3RVZA 5LHIA 2PI5A 2KKWA 4PDMA 1KB9F 2FB5A 3P3NA 1TVKA 4IT5A 2Q0OC 2KG7B 3D3IA 4J9ZB 4LP8A 2NN4A 4ASUG 3N2KA 5EZYB 4LFCB 4FLTA 1PM9A 1OHHG 1ZX3A 2HEPA 2ZCEA 2UU9O 3UO2A 1IBMO 2EIMC 1TUBB 4LR3A 1W0JG 1WLEA 5CA0A 1S77D 4ABMA 2D2CB 4X66B 3RW0A 1Y74A 4BR6A 1V55C 2QSAA 4ZKIA 4KFMA 5CA0B 4YJ2A 1JR9A 5KUMA 4ZBMA 3SYAA 2IM9A 3JAWA 2ZINA 1Y74B 4OX9B 1SRYA 5LMUB 1JFFB 3H01A 2ILMA 4YJ2B 2ATKC 3SYPA 4CS3A 2CTRA 1YJWV 4LF5O 1KKCA 5LHHA 1VF6A 2VQFO 2O57A 2DWDC 2ZM6O 4FMTA 4I55B 5KUKA 3CCUV 1AI5A 2IU0A 3K08A 5JJNB 4DK0A 1P7BA 5IJ9A 3M8AA 2P5OA 3BHPA 5B66Z 3P3PA 1N32B 1FFXB 5JH7B 2YI8A 2QDOA 5CMUA 4LWSA 4GUNA 4MVQA 2DYRC 5LP6A 4QIWF 5LBQA 3E89A 4JI7O 3AG3B 5J2TA 1WN7A 4O2AA 4IIJA 3UT5A 1MNGA 2W0FC 3L9DA 4K35A 4BW9A 1ENVA 1MZFA 4DV6B 2W6JG 4BIUA 4O4JA 4DR5B 3CB2A 3FB5C 1MSWD 3TGUH 4JV5B 4UFZA 4JI1O 3STZC 5H6RA 4I9QA 2UUBO 1RPRA 3SPGA 2VS0A 4I50B 4DR2B 4WBNB 2BTOA 1Q6HA 5DEDA 4LWSB 4GX1A 4FLVA 2OIGA 3SJCC 3K58A 4N21A 3AK1A 5H2FZ 2Q7EA 2WLLB 1M1KW 4LH7A 1AJQA 4YJ3A 2ZM6B 2QWPB 3CCVV 3DXRA 2DQ0A 5BZBA 4GX0A 1VQ8V 1B6QA 2HJFC 2P4KA 2QE7G 2Q0AA 2B1GA 1FFTB 1WPXA 1V55B 1IZ3A 3UQ8A 4MVZA 4X8AA 2CUGA 3Q4HB 3B8NA 4CH6A 1SF9A 1GMGA 1R3IC 1ZTEA 3TXQA 1M90W 1V9PA 1WP8A 1V54C 4K3AA 3N2GA 1I0HA 3K57A 4G27B 3MHSC 3N27A 3G80A 1BE3H 3M7MX 5A9GA 1FKAO 5LGNA 1NZ6A 5E1AC 3IAYA 1H2GA 2YIAA 3RN4A 1XNQO 5BXZA 1GH6A 5ITZB 3JAMN 1K7DA 4DR7O 1H8EG 3IFXA 3AG4C 1NH2B 1Q3EA 1QQCA 4HYOA 1SZXA 1Q7YW 4DXWA 3I5DA 4RUEA 4DV1B 2DYRB 4D7SA 2JEUA 3OAAG 2ZR3A 3DTUB 4MVRA 3ZBHA 1KP3A 3JATA 4DW1A 4DYLA 5D5QA 5A2QN 1HDJA 2QTSA 1RSOB 5JVDA 5BMVA 2RN9A 2WLKA 4GCZA 4JI6B 4B3MO 4GZRB 2NLJC 4MVSA 1OV9A 3ASNB 4B3SO 3LSSA 4B7EA 4LF4B 2D3OW 3T4ZA 1BS3A 2HKOA 2YI9A 3SGIA 3B09A 5JJJB 3BA8A 3HB3B 1GN2A 1JPXA 3R66A 4JF3A 4J9YB 4LF8O 5EC2C 5LP6C 4FLWA 4TWKA 1S76D 4DV6O 2B5UA 4I5SA 2X6AA 4X62O 4WFBV 3JD0A 5JQGA 4I9WA 5L3BA 3EVKA 4I4TA 1YCIA 2W6IG 2GUZA 4RQEA 4DV3O 2QWRB 3ML0A 4JYAO 4H33A 4PI0A 1QR9A 4RWUA 2QKAA 3HKCB 1IBKO 1Q81W 1N0NA 1FXKB 5C8YB 1MZEA 1N34O 3ZHQA 4DR6B 5LHGA 1S5HC 2EJ7A 5CBGA 2A3QA 4QNHB 1D2DA 2Q67A 1XILA 4DUZO 3GWOA 3U0ZA 1YSCA 2DYSC 5HFLA 2RDCA 1VQ6V 3CXHF 3ZCCA 4LC1A 1L8DA 1QLNA 3CC4V 5KAIZ 5B1NA 1LNQA 2YC0A 1VARA 4CH4A 4NXMB 1VIBA 4Z1MG 4I50A 1NVPD 2UXBO 2CTPA 2QM8A 3ZN0A 2IJKA 1EZJA 4UVAA 2EULA 1MG1A 2YIDA 3FX7A 3ABLC 4WFAV 5B3SB 3QO8A 2M6YA 1PNMA 2KQXA 1K97A 2CH7A 3D3QA 4DV7O 5H6QA 5KLVH 1SERA 4QE7A 3R65A 2F66C 2EZOA 1NS1A 5B1OA 1WB7A 1KU9A 3L75H 1ZUQA 1NU1H 2RQ6A 3ZHVA 1XBLA 1XMQO 4BWAA 1N0JA 4KL1A 4JPRA 1HNZB 2FL4A 1KKDA 4JI2B 4EFEA 4P9PA 1OCOB 2A79B 3C90A 1SETA 3LDEA 1OCZC 1SQBH 2JGDA 4X88A 3JAKA 4BAYA 4PA9A 2GTSA 3FFQA 2WLHA 1YTFD 1BSMA 1GKFA 1J95A 4X66O 1H2KA 1AR4A 3SDLA 1GN4A 1GRJA 2OTJV 5EK0A 3HKEA 4G2KA 4EFBA 1KECA 5L3GA 5AG2A 1FD9A 2ZR2A 1FJGO 4J41A 3JSLA 3J81N 1F4NA 2B1IA 1S5JA 3T1CA 4OPHA 5HFMA 3QO7A 4B3TO 2EIKC 1EZVH 1WA8A 2JGDB 1I7FA 4E4EA 3OM3B 2B9ZA 2QEXV 3F5TA 1XNRB 1AROP 4DV7B 3BABA 2IH1C 2UXDB 1HW7A 2PUSA 4TQDA 4CH3A 1I5XA 4EKWA 4NXNO 2CAZC 2Q8VA 3IGAC 1BQ0A 2EX3A 5JCOA 3E8BA 3F7YC 2R9IA 5B1AB 1K5SA 3ABMB 3CYOA 2GTAA 5JQGB 1WB8A 2R9AA 3HR0A 2N05A 1DK1A 4XDKA 4JV5O 4YY3B 4WFEA 1SA0B 4LF6B 2Z3YA 4NTWA 4X1KA 3HKDB 2AZ0A 1AVMA 2ZE8A 3U10A 1E1QG 4K0KB 4F6RA 3ZN1A 3CCRV 4FVMA 5LMNO 4FZ0A 1WPBA 4AQYO 3CCJV 3JD1A 4DV4O 4JI0B 4X65B 2X0LA 3W7TA 3I55V 4LFBO 2IW5A 3DC6A 1B06A 2R70A 2YXLA 2P90A 4NXMO 2GUZB 4R8CA 1K3EA 1DTOA 4Z2WA 4JGSA 2P67A 4LF9B 4JI3O 1IURA 5B1AC 5K1PA 1G1XB 1EN4A 5CN0A 3G67A 2OCCC 1FXKA 1ZLZA 1BL8A 1X59A 4GKJO 1N8RW 4TUYB 2CH7B 4JTAB 4WFFA 1RP3B 1FS0G 1FXHA 4L87A 4O4HA 4MVMA 2V4DA 2YXHA 5LA6A 4KUMA 3JALA 3UO3A 1XMOB 4HNAB 1HNWO 5LYJA 1TAEA 4CH5A 4X64B 2HG5C 3OGIB 4YIPA 4YXWG 4I0XB 1AJNA 1PV0A 4KP4A 3O9OA 3W7UA 1GM9A 5GTHZ 4FLUA 1ZL8B 4XBFA 2DWEC 2H3OA 3AG2B 5LGTA 4DR2O 3RYCB 2X6BA 5JVDB 3ABMC 3RWRD 2H8PC 1G4YB 4I55A 1COWG 2WLNA 4JI1B 2A9HA 3OW2U 1NVPB 3CE2A 1BT8A 2UUBB 2QGNA 5DECA 2EINC 1IDSA 2AHZA 2BE3A 2JGUA 4JI3B 1NR7A 2Y4TA 3RYIA 5KHJA 1XHZA 1HR0O 4JI8O 4OX9O 4X1IA 3ASOC 1CP9A 3QTCA 3JCZA 4GKJB 4QPJA 1B3QA 1MOFA 4G28B 4ZHQB 1J5EB 2XUMA 2P7TC 1IBLO 3S3XA 1ZAUA 5EIBC 1L0LH 1XMOO 2GDSA 3L73H 2PGGA 4MVOA 4CZZA 3VQWA 2AZ2A 5KHKA 1YTFB 2W0XA 4ZOLA 1NR1A 2HVKC 4O4LA 5GONB 1Z5WA 2QKCA 3ZRVA 4J80A 4JTDB 5LOVA 2P6JA 3OTFA 1R73A 4K0KO 4H0LB 4DV3B 1IX9A 1FFXA 3OD4A 2RMKB 5L3FA 2ZE6A 3CRAA 3ASOB 2WLLA 2WSSG 3WB1A 2G38A 4F4LA 2ZXWC 3ZEDA 5KMGA 1GTOA 1O9HA 4F6RB 4TV8B 3K0GA 4X1YA 2XAGA 3CJHA 5KMGB 4C7UA 1K4DC 3H1LH 1SZTA 3CC7V 3W7XA 1RM1C 1YJNV 3ETDA 5EC1C 1HWYA 3CCEV 5IYDO 4TOIA 1D5AA 4DUYB 2F93B 4B3RO 3N2GB 1YIJV 2LO1A 3AG7A 4P2ZA 3VQVA 3K9AA 4EB6B 4LF7O 4DR1O 1YF2A 4DV5O 3SR2C 1K33A 2WA4A 4EEQA 2OTLV 2Q7HA 1ROPA 2A06H 2ITCC 5KHIA 3SPCA 1QHTA 2HR3A 2AHYA 1JJ2U 1KMIZ 4P9OA 2NR5A 3JASB 1M57B 2L35A 4NYKA 1SS3A 5KX5B 1H2SB 1QCEA 2EZPA 2PYLA 2GBOA 1GO3F 5IYBO 2UUAB 2WLJA 1YEWA 2Q69A 1M56B 2N74A 3O65A 4JI4B 3B4SA 2EJRA 2UXCB 4FZ1A 1FXVA 5BR8B 2JVDA 2LGWA 3K79A 1VQOV 3AK3A 1JMKC 3E83A 1N34B 2PYJA 3X2QB 3ZS8C 4AHCA 3K5MA 3E2EA 4DR7B 3CWBH 3G6BA 1HNXO 3WB2A 2FKXA 2CGOA 5FNVB 4DV1O 4I7ZB 4NTYA 4MW3A 3CS5A 1H2MA 1XOUA 4GYCB 1TA8A 2CDYA 1QNMA 2PF4E 1BGYH 4LBEC 1VMGA 1VQ9V 2ZE5A 4B3TB 4NB5A 4ZHQA 4CBCA 1JCHA 4ICGA 2ZT9B 1KD1W 3W7WA 1URFA 1XEQA 3LNNA 1PPJH 4B3MB 3MDSA 5JCOC 1P49A 5IDJA 1RSOA 4NXNB 1OCRB 3CMEV 3APOA 1TUEB 4J10A 3AG1C 5FL7G 2EBOA 1GAXA 3RYFB 2UUAO 4LF8B 1EN6A 1NJIW 3IC7A 1K4CC 2EIMB 3ABTA 3FYEB 3PJSK 2ZXWB 2AW9A 3QF7A 2NNUA 4O2BB 3SJQC 4FJCC 1K8AW 4JZ2A 2ZKOA 5GW7A 4DW0A 3K5OA 3CC2V 3SJBC 4UV9A 5K1XA 4HBNA 4PJ0Z 4WCEV 2P06A 4JYYA 4PA3A 3L72H 4QGPA 4AQYB 3WU2Z 1HNXB 4LFCO 4H44B 2KB1A 2EILC 3ZMVA 3ZMUA 1LUVA 4MW8A 3GB7C 1M56C 3TCUA 2Y0IA 2FMLA 4N23A 2Y0PA 4FK5C 1P84F 2RJZA 5FPRA 3MAQA 5IYCO 5CBHA 4LF7B 4DR1B 2QM4A 5LGUA 4R50A 5IWAB 4PI2A 1YHQV 3BFRA 2N04A 4JYCA 1W2BU 1NH2D 3CX5F 2JJ2G 2ZE7A 3GWKC 3CPWU 4EB6A 1EFRG 2A7WA 3ZRSA 1VQPV 5EBLC 1VF5B 4X20B 5CA3A 2VQFB 3B77A 1I08A
chains in the Genus database with same CATH topology
1VF6A 1ZL8A 1Y74B 3B40A 1RSOB 1Y76A 1Y74A 1Y76B 1VF6C 1ZL8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VF6 A;  1ZL8 A;  1Y74 B;  3B40 A;  1RSO B;  1Y76 A;  1Y74 A;  1Y76 B;  1VF6 C;  1ZL8 B; 
#chains in the Genus database with same CATH topology
 1SQG A;  1X4T A;  2XTA A;  2CGN A;  4CS2 A;  2OWO A;  1JVM A;  3CEI A;  3THO A;  4KXR A;  2WLI A;  2IH3 C;  4DV2 O;  1KUQ A;  4UVB A;  3CRM A;  3FKS G;  3WG7 B;  4K8X A;  2UXX A;  4JZG A;  3S3W A;  4UCU A;  2XT9 A;  3BY6 A;  3B8M A;  3CCM V;  4YHH B;  5BMV B;  2ZDI A;  3VOU A;  1Y4M A;  5H5N A;  2LQT A;  4TSF G;  5LL6 Y;  3K5L A;  1Q86 W;  3ZHR A;  1JA8 A;  1BZK A;  2GV9 A;  4GLX A;  1G6U A;  1K5Q A;  3RFR A;  3TXS A;  1XRE A;  1OZ0 A;  3K0D A;  4HZ3 A;  5EBM C;  3E22 A;  2PI4 A;  4RUF A;  2EIL B;  2DJV A;  1RPO A;  3C3S A;  3A8T A;  3N2K B;  5EZY A;  1N33 O;  3K5N A;  3APQ A;  1F23 A;  2F23 A;  3OEH G;  1HP8 A;  2DN9 A;  3LSQ A;  5GON A;  1U97 A;  3LUT B;  1XNR O;  4X1K B;  1OCC B;  1SQP H;  2YDE A;  3WB0 A;  3JYC A;  4R6Z A;  4IL6 Z;  4LF4 O;  1M93 A;  1CEZ A;  3HKB A;  2AGA A;  2E5L O;  1F7Y A;  2FYU H;  4JAU A;  2Z0A A;  3RYH B;  4LNU B;  1AI4 A;  1XDC A;  3CD6 V;  2QR4 A;  2YSU B;  2XAF A;  4GX5 A;  3E22 B;  2UU9 B;  5LP6 B;  4OPA A;  4O2A B;  3UT5 B;  2BOC C;  2JEX A;  1VQN V;  2YIB D;  4MTO A;  1VF6 C;  3A2F A;  1NKD A;  4WBN A;  2YXY A;  3JAR B;  2R72 A;  4LH6 A;  3W7S A;  3CRC A;  1YI2 V;  3DSQ A;  4GX2 A;  5IWA O;  1AB3 A;  1PL0 A;  1K73 W;  5LMU O;  1YDX A;  4UCV A;  3H1H H;  4Z1V A;  3BA9 A;  3CRQ A;  2QM7 A;  4LNU A;  1PNL A;  1SQX H;  2WAM A;  3PN1 A;  1N33 B;  5J2T B;  3H1K H;  3ZRW B;  1QVG U;  1F51 A;  1MAB G;  3U11 A;  4I0X A;  4DV5 B;  1ZWI C;  2IBZ H;  1PNK A;  3AG4 B;  3T1Y O;  1XUQ A;  3Q4H A;  3CP1 A;  4PDL A;  3DXR B;  3G6E V;  5KAF Z;  4HAM A;  2LFR A;  3K9S A;  1Q6U A;  1PP9 H;  1ZL8 A;  4WF9 V;  3H1J H;  2E5L B;  4GKK O;  1Z2G A;  1QR8 A;  1IBL B;  4PEL A;  3WG7 C;  2R9R B;  3OMN B;  3A0B Z;  5KHG A;  5IYZ A;  2DE0 X;  3QNE A;  1RFY A;  3K59 A;  1XQ8 A;  3JCU Z;  4JI4 O;  1PL4 A;  3RGB A;  1AR5 A;  4DV0 B;  3ZRW A;  4YIO A;  1Y6X A;  3A0H Z;  4MT8 A;  3CCL V;  1IVS A;  1QBZ A;  2OT5 A;  2LGQ A;  4UVC A;  5FNV A;  1NQT A;  4ZIB A;  4FM1 A;  1XMQ B;  2ARH A;  2WA3 A;  3ABK B;  4GT1 A;  5B5E Z;  5GTI Z;  3E8G A;  2UUC B;  4DR4 O;  3ZX6 A;  1BCC H;  2DYS B;  4MTF A;  1H2N A;  4JAV A;  1R3K C;  4TV9 B;  3JAS A;  3JAT B;  2ADP A;  1B04 A;  5KA6 A;  3AK2 A;  3HKE B;  4TT3 G;  1R3L C;  2DMX A;  1ORQ C;  4FLZ A;  1JFF A;  4Q6G A;  3AG3 C;  1KBH A;  1TVK B;  5D5P A;  2GHY A;  4MTG A;  4O4I B;  4PA4 A;  2YIC A;  1PD3 A;  2E3C A;  2JK5 C;  2XAQ A;  1I94 B;  1Q43 A;  1R6T A;  5IJ9 B;  5FLX N;  3UCS C;  1FJG B;  2Q5Z A;  3JD4 A;  1SES A;  5EIB D;  5H9C A;  4LFA B;  1AI6 A;  5KA5 A;  2VWK A;  3EHB B;  3FB6 C;  2JRI A;  4NR1 A;  1NTZ H;  1MA1 A;  4B7K A;  2WWW A;  5J2U A;  3B2E E;  4JTC B;  3T1H O;  3G4S V;  2CK3 G;  3KZI Z;  2QWO B;  2MW2 B;  3FB7 C;  3OR7 C;  2ZNI A;  2HLD G;  2XND G;  4RQF A;  3OUF A;  4FIP C;  5LXT B;  1Y67 A;  3L70 H;  4WFH A;  2XHB A;  1QVF U;  1K34 A;  1I5Y A;  3TET A;  3BPZ A;  3E8H A;  2L6L A;  4F6E A;  3RT3 C;  3KKY A;  5CA1 A;  1AP6 A;  2YUA A;  3SPH A;  3JSN A;  3L71 H;  1R1B A;  4O4L B;  1VP7 A;  2ETN A;  2EIJ B;  2KSD A;  2GSM B;  3HKD A;  2Q73 A;  4X89 A;  1SC5 B;  3RYH A;  5J2U B;  3HKC A;  5EBW C;  3FYI B;  4D7T A;  1E79 G;  2F4V O;  3GVM A;  1M57 C;  5LMN B;  4FPP A;  2ZD9 A;  3T1Y B;  1S72 V;  2Y4U A;  4TV8 A;  1ZSP A;  1P4R A;  1XHX A;  3E86 A;  2Y69 C;  3IJ4 A;  4LFA O;  4B3R B;  1Q8I A;  3WFV A;  1QLE B;  2ZNJ A;  4QJF B;  3AG1 B;  4LF9 O;  2VQE O;  3AEI A;  2CTW A;  2ZIO A;  5C93 A;  5DN6 G;  1GN3 A;  1SQQ H;  2V7Q G;  2F43 G;  3D36 A;  3RBZ A;  2OCC B;  2WPD G;  3JAL B;  3I56 V;  1YJ9 V;  4UUJ C;  2HFE C;  4IGG A;  3F5W C;  2IJI A;  2IJH A;  2PY5 A;  3SPJ A;  4E2L A;  3IC9 A;  2X7R B;  3RYI B;  5CB4 A;  1Q6I A;  1AP5 A;  1IBK B;  3B40 A;  3TJT A;  4YHH O;  2YEV B;  1F4M A;  1GN6 A;  1YVW A;  3OR6 C;  1XL6 A;  4DR6 O;  1H38 A;  2IU3 A;  3OE7 G;  1NT2 B;  5IJ0 A;  4JI5 O;  2JS5 A;  3ZHT A;  5JJE B;  3FB8 C;  2QWN B;  3ASN C;  2BSK B;  4CS4 A;  2F1M A;  1BHB A;  1SQV H;  1N36 O;  4JAS A;  5B1B C;  2VRZ A;  4NVP A;  2EIJ C;  2Q7G A;  4DO2 A;  1UPG A;  4H37 A;  1KP2 A;  4PD4 F;  1SA0 A;  4JAA A;  1HR0 B;  1R6N A;  3T1H B;  2DQ3 A;  1L1F A;  2LW1 A;  3G71 V;  4IIJ B;  5BY1 A;  4BW5 A;  1EN5 A;  2UXN A;  3OTO B;  1SQF A;  3VQX A;  3CHX A;  4MVU A;  4ZI7 A;  4DV2 B;  3H9V A;  2F95 B;  4BIZ A;  4L8J A;  3DGE A;  4I4T B;  1E1R G;  4J11 A;  4JI2 O;  1TGO A;  3JAR A;  5LXT A;  1HNW B;  1P7G A;  4QE9 A;  2PZS A;  2DW4 A;  1IBM B;  4PV1 B;  3EXA A;  2JIZ G;  3QVN A;  3ZHU A;  1LR1 A;  4UCO A;  3RYF A;  2JS3 A;  1NI8 A;  3K04 A;  4IYI A;  2HHH B;  3BEH A;  5TIS Z;  4H13 B;  2P22 C;  3LDD A;  2BOB C;  3ZJZ A;  3VQY A;  3JD3 A;  4AIL C;  2OCH A;  1NBM G;  4W4K A;  3J7A U;  1UJW B;  3BRC A;  4XDL A;  1OJH A;  2BTQ A;  2QWQ B;  2AXT Z;  3ZIA G;  1KQS U;  4JYB A;  2HJD A;  3L74 H;  4LF5 B;  2LP7 A;  4PA7 A;  3J80 N;  1VQ5 V;  4KHP B;  1THZ A;  2CTQ A;  3ABL B;  4TUY A;  5B3S C;  1BHA A;  4FFK A;  1CXZ B;  2DOS A;  3ETG A;  4OGQ B;  1DGS A;  2M7W A;  4J7K A;  4RO2 A;  5IE9 A;  1BMF G;  1MMM A;  2XOK G;  2YIB A;  4DUY O;  2KG7 A;  4XDJ A;  1JQ0 A;  1N32 O;  3X2Q C;  3P32 A;  2Y48 A;  2XAH A;  1J5E O;  4NKG B;  1HNZ O;  2E75 B;  3BCC H;  4JI7 B;  3M99 B;  2ZDI C;  1Q5O A;  1OCZ B;  1VQL V;  1G8M A;  3H1I H;  3ZMS A;  4U3J B;  1Z5V A;  4YY3 O;  1RM1 B;  4LF6 O;  4NTX A;  1IXB A;  4PHZ A;  3ZMZ A;  3JAK B;  2HHH O;  1XL4 A;  3EFF K;  5EYP B;  2ADQ B;  3OUS A;  1IXM A;  5FPO A;  1T5E A;  4DR4 B;  1YZB A;  2ODM A;  1VQK V;  3K06 A;  4OXS A;  2E74 B;  3SYQ A;  4LFB B;  4DR5 O;  1VQ4 V;  2JDI G;  1DF4 A;  2UXC O;  2A0L A;  5L3C A;  3NR7 A;  2X6C A;  4MTX A;  1EM1 A;  5IJ0 B;  3JD2 A;  4HNA A;  3MHH C;  4U3F H;  4IHJ B;  1W0K G;  1TUB A;  3KCX A;  4J7J A;  4FLX A;  4U3J A;  1AIL A;  2XAJ A;  1Q90 D;  1WP7 A;  3ICX A;  4BIO A;  2Q68 A;  2QJ1 A;  2QTO A;  1VQM V;  2YS8 A;  3SYC A;  1WA8 B;  4FFB B;  5JWP A;  3DC5 A;  3JAW B;  3ZMT A;  1FPO A;  4A5U B;  3A0R A;  3RYC A;  4FFB A;  4Q20 A;  3AG2 C;  4ZOL B;  4X64 O;  4U7N A;  2BSK A;  3D8C A;  4O4I A;  4R7C A;  3FD9 A;  1WNS A;  4X62 B;  3LNM B;  4IHJ A;  4AI8 A;  3VBB A;  1KC8 W;  4X1I B;  4O2B A;  2C2A A;  5C8Y A;  1R6K A;  1Y66 A;  2EIK B;  1Y76 B;  4B08 A;  1V54 B;  3HPL C;  2LFS A;  5JH7 A;  4DV0 O;  4JI0 O;  4DV4 B;  4X65 O;  4UCS A;  3T2M A;  3C3T A;  5IY5 C;  1Q82 W;  5BR8 O;  1YIT V;  5CBF A;  2IJJ A;  2UUC O;  3OT7 A;  4O4J B;  4KHP O;  5F2V O;  2F4V B;  2P4V A;  2PTM A;  1OCR C;  4DUZ B;  4X1Y B;  3CJH B;  3SYO A;  2HP8 A;  1VQ7 V;  4D6T H;  4TQF A;  1I94 O;  2WLM A;  3KCY A;  4WFG A;  1AR1 B;  3ZRX A;  4FLY A;  2OYQ A;  1FYJ A;  3ETE A;  5L3D A;  3LDC A;  1H8H G;  2QKS A;  1R3J C;  4JI6 O;  3KG2 A;  4UB8 Z;  5DM6 V;  5KX5 A;  3ABK C;  2ITD C;  4O4H B;  3CXC U;  3ZHS A;  4GKK B;  1S5L Z;  3MD0 A;  4J42 A;  3CMA V;  1KYO F;  4LCU C;  1L0N H;  5IT9 N;  3P30 A;  3TK1 A;  1AI7 A;  3F7V C;  3E8F A;  3T4D A;  1FXK C;  3QG5 A;  2K1E A;  1JJO A;  2Q9L A;  5IYZ B;  1M9N A;  2EIN B;  4CC6 A;  1JOY A;  2FTK A;  1XNQ B;  4MSW C;  1S3J A;  2QA4 V;  2VWJ A;  1S0V A;  4JI8 B;  4UCR A;  1UFI A;  1OCC C;  4U7O A;  1O9G A;  4DR3 B;  1VEW A;  2RCV A;  1NTK H;  3UM7 A;  4CC5 A;  5EYP A;  3RVY A;  3BVO A;  4TV9 A;  4QPK A;  4X9Q A;  3HKB B;  3OGC C;  3STL C;  2ZIM A;  5KHH A;  1D5N A;  2JJ1 G;  4UCT A;  4IYH A;  2MK3 A;  3CRR A;  4ZI7 B;  2K9P A;  2VQE B;  4DRX A;  4UB6 Z;  1NTM H;  2XAS A;  1AJP A;  1N4C A;  3K03 A;  4B3S B;  2Y69 B;  1W59 A;  1EBO A;  3ABU A;  3CCQ V;  1JX9 A;  2LJ2 A;  3D36 C;  3OMI B;  5L3E A;  1XI1 A;  3OEE G;  1K92 A;  1M5I A;  3UKM A;  1Y76 A;  1OCO C;  2LW7 A;  1DF5 A;  1U96 A;  2ZQM A;  1QU7 A;  3ETQ A;  5IY5 B;  5LOV B;  1FAF A;  1SKV A;  1DLB A;  3BAA A;  4DRX B;  4UXN A;  1GM8 A;  4K8Z A;  2V1D A;  2CE4 A;  1A32 A;  2E76 B;  3FAV A;  3QO5 A;  1LUW A;  4JYA B;  2OIE A;  2H94 A;  1GM7 A;  4X20 A;  4DR3 O;  3OMA B;  4MS2 A;  3SJA C;  1QLE C;  4RAI A;  3CCS V;  3FAV B;  5J9P C;  1VF7 A;  3LSU A;  2Z5U A;  5B1B B;  5CA1 B;  1N36 B;  1US6 A;  2RNB A;  3SPI A;  2WLI B;  4PDR A;  4JI5 B;  2HVJ C;  4W4L A;  1GK9 A;  1BQZ A;  1WJZ A;  1WAZ A;  1PKX A;  5LA6 B;  2Q4P A;  5LYJ B;  1K9M W;  3CSX A;  2UXD O;  1M4U A;  1MSD A;  4PDV A;  4YJ3 B;  4PA6 A;  4FM2 A;  3OTO O;  5CB4 B;  3OFN G;  2UXB B;  1YXB A;  2BTQ B;  2Q6A A;  3K3W A;  5ITZ A;  2YEV A;  5E79 Z;  2BCC H;  4DK1 A;  4FM0 A;  1CPY A;  4P30 A;  4UV8 A;  3E35 A;  1H2L A;  3NXS A;  4J7Z A;  3RVZ A;  5LHI A;  2PI5 A;  2KKW A;  4PDM A;  1KB9 F;  2FB5 A;  3P3N A;  1TVK A;  4IT5 A;  2Q0O C;  2KG7 B;  3D3I A;  4J9Z B;  4LP8 A;  2NN4 A;  4ASU G;  3N2K A;  5EZY B;  4LFC B;  4FLT A;  1PM9 A;  1OHH G;  1ZX3 A;  2HEP A;  2ZCE A;  2UU9 O;  3UO2 A;  1IBM O;  2EIM C;  1TUB B;  4LR3 A;  1W0J G;  1WLE A;  5CA0 A;  1S77 D;  4ABM A;  2D2C B;  4X66 B;  3RW0 A;  1Y74 A;  4BR6 A;  1V55 C;  2QSA A;  4ZKI A;  4KFM A;  5CA0 B;  4YJ2 A;  1JR9 A;  5KUM A;  4ZBM A;  3SYA A;  2IM9 A;  3JAW A;  2ZIN A;  1Y74 B;  4OX9 B;  1SRY A;  5LMU B;  1JFF B;  3H01 A;  2ILM A;  4YJ2 B;  2ATK C;  3SYP A;  4CS3 A;  2CTR A;  1YJW V;  4LF5 O;  1KKC A;  5LHH A;  1VF6 A;  2VQF O;  2O57 A;  2DWD C;  2ZM6 O;  4FMT A;  4I55 B;  5KUK A;  3CCU V;  1AI5 A;  2IU0 A;  3K08 A;  5JJN B;  4DK0 A;  1P7B A;  5IJ9 A;  3M8A A;  2P5O A;  3BHP A;  5B66 Z;  3P3P A;  1N32 B;  1FFX B;  5JH7 B;  2YI8 A;  2QDO A;  5CMU A;  4LWS A;  4GUN A;  4MVQ A;  2DYR C;  5LP6 A;  4QIW F;  5LBQ A;  3E89 A;  4JI7 O;  3AG3 B;  5J2T A;  1WN7 A;  4O2A A;  4IIJ A;  3UT5 A;  1MNG A;  2W0F C;  3L9D A;  4K35 A;  4BW9 A;  1ENV A;  1MZF A;  4DV6 B;  2W6J G;  4BIU A;  4O4J A;  4DR5 B;  3CB2 A;  3FB5 C;  1MSW D;  3TGU H;  4JV5 B;  4UFZ A;  4JI1 O;  3STZ C;  5H6R A;  4I9Q A;  2UUB O;  1RPR A;  3SPG A;  2VS0 A;  4I50 B;  4DR2 B;  4WBN B;  2BTO A;  1Q6H A;  5DED A;  4LWS B;  4GX1 A;  4FLV A;  2OIG A;  3SJC C;  3K58 A;  4N21 A;  3AK1 A;  5H2F Z;  2Q7E A;  2WLL B;  1M1K W;  4LH7 A;  1AJQ A;  4YJ3 A;  2ZM6 B;  2QWP B;  3CCV V;  3DXR A;  2DQ0 A;  5BZB A;  4GX0 A;  1VQ8 V;  1B6Q A;  2HJF C;  2P4K A;  2QE7 G;  2Q0A A;  2B1G A;  1FFT B;  1WPX A;  1V55 B;  1IZ3 A;  3UQ8 A;  4MVZ A;  4X8A A;  2CUG A;  3Q4H B;  3B8N A;  4CH6 A;  1SF9 A;  1GMG A;  1R3I C;  1ZTE A;  3TXQ A;  1M90 W;  1V9P A;  1WP8 A;  1V54 C;  4K3A A;  3N2G A;  1I0H A;  3K57 A;  4G27 B;  3MHS C;  3N27 A;  3G80 A;  1BE3 H;  3M7M X;  5A9G A;  1FKA O;  5LGN A;  1NZ6 A;  5E1A C;  3IAY A;  1H2G A;  2YIA A;  3RN4 A;  1XNQ O;  5BXZ A;  1GH6 A;  5ITZ B;  3JAM N;  1K7D A;  4DR7 O;  1H8E G;  3IFX A;  3AG4 C;  1NH2 B;  1Q3E A;  1QQC A;  4HYO A;  1SZX A;  1Q7Y W;  4DXW A;  3I5D A;  4RUE A;  4DV1 B;  2DYR B;  4D7S A;  2JEU A;  3OAA G;  2ZR3 A;  3DTU B;  4MVR A;  3ZBH A;  1KP3 A;  3JAT A;  4DW1 A;  4DYL A;  5D5Q A;  5A2Q N;  1HDJ A;  2QTS A;  1RSO B;  5JVD A;  5BMV A;  2RN9 A;  2WLK A;  4GCZ A;  4JI6 B;  4B3M O;  4GZR B;  2NLJ C;  4MVS A;  1OV9 A;  3ASN B;  4B3S O;  3LSS A;  4B7E A;  4LF4 B;  2D3O W;  3T4Z A;  1BS3 A;  2HKO A;  2YI9 A;  3SGI A;  3B09 A;  5JJJ B;  3BA8 A;  3HB3 B;  1GN2 A;  1JPX A;  3R66 A;  4JF3 A;  4J9Y B;  4LF8 O;  5EC2 C;  5LP6 C;  4FLW A;  4TWK A;  1S76 D;  4DV6 O;  2B5U A;  4I5S A;  2X6A A;  4X62 O;  4WFB V;  3JD0 A;  5JQG A;  4I9W A;  5L3B A;  3EVK A;  4I4T A;  1YCI A;  2W6I G;  2GUZ A;  4RQE A;  4DV3 O;  2QWR B;  3ML0 A;  4JYA O;  4H33 A;  4PI0 A;  1QR9 A;  4RWU A;  2QKA A;  3HKC B;  1IBK O;  1Q81 W;  1N0N A;  1FXK B;  5C8Y B;  1MZE A;  1N34 O;  3ZHQ A;  4DR6 B;  5LHG A;  1S5H C;  2EJ7 A;  5CBG A;  2A3Q A;  4QNH B;  1D2D A;  2Q67 A;  1XIL A;  4DUZ O;  3GWO A;  3U0Z A;  1YSC A;  2DYS C;  5HFL A;  2RDC A;  1VQ6 V;  3CXH F;  3ZCC A;  4LC1 A;  1L8D A;  1QLN A;  3CC4 V;  5KAI Z;  5B1N A;  1LNQ A;  2YC0 A;  1VAR A;  4CH4 A;  4NXM B;  1VIB A;  4Z1M G;  4I50 A;  1NVP D;  2UXB O;  2CTP A;  2QM8 A;  3ZN0 A;  2IJK A;  1EZJ A;  4UVA A;  2EUL A;  1MG1 A;  2YID A;  3FX7 A;  3ABL C;  4WFA V;  5B3S B;  3QO8 A;  2M6Y A;  1PNM A;  2KQX A;  1K97 A;  2CH7 A;  3D3Q A;  4DV7 O;  5H6Q A;  5KLV H;  1SER A;  4QE7 A;  3R65 A;  2F66 C;  2EZO A;  1NS1 A;  5B1O A;  1WB7 A;  1KU9 A;  3L75 H;  1ZUQ A;  1NU1 H;  2RQ6 A;  3ZHV A;  1XBL A;  1XMQ O;  4BWA A;  1N0J A;  4KL1 A;  4JPR A;  1HNZ B;  2FL4 A;  1KKD A;  4JI2 B;  4EFE A;  4P9P A;  1OCO B;  2A79 B;  3C90 A;  1SET A;  3LDE A;  1OCZ C;  1SQB H;  2JGD A;  4X88 A;  3JAK A;  4BAY A;  4PA9 A;  2GTS A;  3FFQ A;  2WLH A;  1YTF D;  1BSM A;  1GKF A;  1J95 A;  4X66 O;  1H2K A;  1AR4 A;  3SDL A;  1GN4 A;  1GRJ A;  2OTJ V;  5EK0 A;  3HKE A;  4G2K A;  4EFB A;  1KEC A;  5L3G A;  5AG2 A;  1FD9 A;  2ZR2 A;  1FJG O;  4J41 A;  3JSL A;  3J81 N;  1F4N A;  2B1I A;  1S5J A;  3T1C A;  4OPH A;  5HFM A;  3QO7 A;  4B3T O;  2EIK C;  1EZV H;  1WA8 A;  2JGD B;  1I7F A;  4E4E A;  3OM3 B;  2B9Z A;  2QEX V;  3F5T A;  1XNR B;  1ARO P;  4DV7 B;  3BAB A;  2IH1 C;  2UXD B;  1HW7 A;  2PUS A;  4TQD A;  4CH3 A;  1I5X A;  4EKW A;  4NXN O;  2CAZ C;  2Q8V A;  3IGA C;  1BQ0 A;  2EX3 A;  5JCO A;  3E8B A;  3F7Y C;  2R9I A;  5B1A B;  1K5S A;  3ABM B;  3CYO A;  2GTA A;  5JQG B;  1WB8 A;  2R9A A;  3HR0 A;  2N05 A;  1DK1 A;  4XDK A;  4JV5 O;  4YY3 B;  4WFE A;  1SA0 B;  4LF6 B;  2Z3Y A;  4NTW A;  4X1K A;  3HKD B;  2AZ0 A;  1AVM A;  2ZE8 A;  3U10 A;  1E1Q G;  4K0K B;  4F6R A;  3ZN1 A;  3CCR V;  4FVM A;  5LMN O;  4FZ0 A;  1WPB A;  4AQY O;  3CCJ V;  3JD1 A;  4DV4 O;  4JI0 B;  4X65 B;  2X0L A;  3W7T A;  3I55 V;  4LFB O;  2IW5 A;  3DC6 A;  1B06 A;  2R70 A;  2YXL A;  2P90 A;  4NXM O;  2GUZ B;  4R8C A;  1K3E A;  1DTO A;  4Z2W A;  4JGS A;  2P67 A;  4LF9 B;  4JI3 O;  1IUR A;  5B1A C;  5K1P A;  1G1X B;  1EN4 A;  5CN0 A;  3G67 A;  2OCC C;  1FXK A;  1ZLZ A;  1BL8 A;  1X59 A;  4GKJ O;  1N8R W;  4TUY B;  2CH7 B;  4JTA B;  4WFF A;  1RP3 B;  1FS0 G;  1FXH A;  4L87 A;  4O4H A;  4MVM A;  2V4D A;  2YXH A;  5LA6 A;  4KUM A;  3JAL A;  3UO3 A;  1XMO B;  4HNA B;  1HNW O;  5LYJ A;  1TAE A;  4CH5 A;  4X64 B;  2HG5 C;  3OGI B;  4YIP A;  4YXW G;  4I0X B;  1AJN A;  1PV0 A;  4KP4 A;  3O9O A;  3W7U A;  1GM9 A;  5GTH Z;  4FLU A;  1ZL8 B;  4XBF A;  2DWE C;  2H3O A;  3AG2 B;  5LGT A;  4DR2 O;  3RYC B;  2X6B A;  5JVD B;  3ABM C;  3RWR D;  2H8P C;  1G4Y B;  4I55 A;  1COW G;  2WLN A;  4JI1 B;  2A9H A;  3OW2 U;  1NVP B;  3CE2 A;  1BT8 A;  2UUB B;  2QGN A;  5DEC A;  2EIN C;  1IDS A;  2AHZ A;  2BE3 A;  2JGU A;  4JI3 B;  1NR7 A;  2Y4T A;  3RYI A;  5KHJ A;  1XHZ A;  1HR0 O;  4JI8 O;  4OX9 O;  4X1I A;  3ASO C;  1CP9 A;  3QTC A;  3JCZ A;  4GKJ B;  4QPJ A;  1B3Q A;  1MOF A;  4G28 B;  4ZHQ B;  1J5E B;  2XUM A;  2P7T C;  1IBL O;  3S3X A;  1ZAU A;  5EIB C;  1L0L H;  1XMO O;  2GDS A;  3L73 H;  2PGG A;  4MVO A;  4CZZ A;  3VQW A;  2AZ2 A;  5KHK A;  1YTF B;  2W0X A;  4ZOL A;  1NR1 A;  2HVK C;  4O4L A;  5GON B;  1Z5W A;  2QKC A;  3ZRV A;  4J80 A;  4JTD B;  5LOV A;  2P6J A;  3OTF A;  1R73 A;  4K0K O;  4H0L B;  4DV3 B;  1IX9 A;  1FFX A;  3OD4 A;  2RMK B;  5L3F A;  2ZE6 A;  3CRA A;  3ASO B;  2WLL A;  2WSS G;  3WB1 A;  2G38 A;  4F4L A;  2ZXW C;  3ZED A;  5KMG A;  1GTO A;  1O9H A;  4F6R B;  4TV8 B;  3K0G A;  4X1Y A;  2XAG A;  3CJH A;  5KMG B;  4C7U A;  1K4D C;  3H1L H;  1SZT A;  3CC7 V;  3W7X A;  1RM1 C;  1YJN V;  3ETD A;  5EC1 C;  1HWY A;  3CCE V;  5IYD O;  4TOI A;  1D5A A;  4DUY B;  2F93 B;  4B3R O;  3N2G B;  1YIJ V;  2LO1 A;  3AG7 A;  4P2Z A;  3VQV A;  3K9A A;  4EB6 B;  4LF7 O;  4DR1 O;  1YF2 A;  4DV5 O;  3SR2 C;  1K33 A;  2WA4 A;  4EEQ A;  2OTL V;  2Q7H A;  1ROP A;  2A06 H;  2ITC C;  5KHI A;  3SPC A;  1QHT A;  2HR3 A;  2AHY A;  1JJ2 U;  1KMI Z;  4P9O A;  2NR5 A;  3JAS B;  1M57 B;  2L35 A;  4NYK A;  1SS3 A;  5KX5 B;  1H2S B;  1QCE A;  2EZP A;  2PYL A;  2GBO A;  1GO3 F;  5IYB O;  2UUA B;  2WLJ A;  1YEW A;  2Q69 A;  1M56 B;  2N74 A;  3O65 A;  4JI4 B;  3B4S A;  2EJR A;  2UXC B;  4FZ1 A;  1FXV A;  5BR8 B;  2JVD A;  2LGW A;  3K79 A;  1VQO V;  3AK3 A;  1JMK C;  3E83 A;  1N34 B;  2PYJ A;  3X2Q B;  3ZS8 C;  4AHC A;  3K5M A;  3E2E A;  4DR7 B;  3CWB H;  3G6B A;  1HNX O;  3WB2 A;  2FKX A;  2CGO A;  5FNV B;  4DV1 O;  4I7Z B;  4NTY A;  4MW3 A;  3CS5 A;  1H2M A;  1XOU A;  4GYC B;  1TA8 A;  2CDY A;  1QNM A;  2PF4 E;  1BGY H;  4LBE C;  1VMG A;  1VQ9 V;  2ZE5 A;  4B3T B;  4NB5 A;  4ZHQ A;  4CBC A;  1JCH A;  4ICG A;  2ZT9 B;  1KD1 W;  3W7W A;  1URF A;  1XEQ A;  3LNN A;  1PPJ H;  4B3M B;  3MDS A;  5JCO C;  1P49 A;  5IDJ A;  1RSO A;  4NXN B;  1OCR B;  3CME V;  3APO A;  1TUE B;  4J10 A;  3AG1 C;  5FL7 G;  2EBO A;  1GAX A;  3RYF B;  2UUA O;  4LF8 B;  1EN6 A;  1NJI W;  3IC7 A;  1K4C C;  2EIM B;  3ABT A;  3FYE B;  3PJS K;  2ZXW B;  2AW9 A;  3QF7 A;  2NNU A;  4O2B B;  3SJQ C;  4FJC C;  1K8A W;  4JZ2 A;  2ZKO A;  5GW7 A;  4DW0 A;  3K5O A;  3CC2 V;  3SJB C;  4UV9 A;  5K1X A;  4HBN A;  4PJ0 Z;  4WCE V;  2P06 A;  4JYY A;  4PA3 A;  3L72 H;  4QGP A;  4AQY B;  3WU2 Z;  1HNX B;  4LFC O;  4H44 B;  2KB1 A;  2EIL C;  3ZMV A;  3ZMU A;  1LUV A;  4MW8 A;  3GB7 C;  1M56 C;  3TCU A;  2Y0I A;  2FML A;  4N23 A;  2Y0P A;  4FK5 C;  1P84 F;  2RJZ A;  5FPR A;  3MAQ A;  5IYC O;  5CBH A;  4LF7 B;  4DR1 B;  2QM4 A;  5LGU A;  4R50 A;  5IWA B;  4PI2 A;  1YHQ V;  3BFR A;  2N04 A;  4JYC A;  1W2B U;  1NH2 D;  3CX5 F;  2JJ2 G;  2ZE7 A;  3GWK C;  3CPW U;  4EB6 A;  1EFR G;  2A7W A;  3ZRS A;  1VQP V;  5EBL C;  1VF5 B;  4X20 B;  5CA3 A;  2VQF B;  3B77 A;  1I08 A; 
#chains in the Genus database with same CATH homology
 1VF6 A;  1ZL8 A;  1Y74 B;  3B40 A;  1RSO B;  1Y76 A;  1Y74 A;  1Y76 B;  1VF6 C;  1ZL8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...