1Y74B

Solution structure of mlin-2/mlin-7 l27 domain complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
50
structure length
50
Chain Sequence
AVQRAKEVLEEISCYPENNDAKELKRILTQPHFMALLQTHDVVAHEVYSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A unified assembly mode revealed by the structures of tetrameric L27 domain complexes formed by mLin-2/mLin-7 and Patj/Pals1 scaffold proteins.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
molecule keywords lin 7 homolog b
total genus 16
structure length 50
sequence length 50
chains with identical sequence D
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2004-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.650 Mainly Alpha Orthogonal Bundle Helix Hairpins L27 domain 1y74B00
3B40A 1Y74A 1VF6A 1ZL8A 1Y76B 1RSOB 1Y76A 1VF6C 1ZL8B 1Y74B
chains in the Genus database with same CATH superfamily
3K9AA 4JI5B 2EILB 3L75H 2WPDG 1NH2D 3HKDA 5IYBO 4L8JA 4DV3B 3ABKB 2JS5A 3G67A 3CRMA 3CB2A 1JPXA 2P4VA 4FJCC 4O2AB 1K8AW 4ZOLB 4IYIA 1OZ0A 4I7ZB 5CA3A 4FIPC 3ASOC 3ZMVA 2Q4PA 2YIAA 5B1AB 4ZOLA 5H6RA 4J10A 2WA3A 2R72A 5C93A 1SA0B 4DV6O 4DO2A 3FB5C 1F7YA 1WJZA 4KFMA 1Y76B 1FPOA 3ETQA 3RYFA 5EZYA 1QR9A 2PYLA 2A7WA 4GLXA 2DW4A 4LF8B 4WBNA 1TUEB 3CXHF 3QTCA 4X9QA 3S3WA 4X66O 1QLNA 2QE7G 3WB0A 3BPZA 5BR8B 1MSWD 5TISZ 3ZHUA 3E83A 3C3SA 3LDCA 5B1NA 1YVWA 2BTQB 4J41A 4B08A 1UPGA 1AP5A 2Y0PA 1O9GA 1FYJA 1J5EB 4PDMA 2ETNA 3CC4V 1ROPA 3QG5A 2QWPB 4DV2B 5LP6B 4IL6Z 3OEHG 2ZXWB 2WSSG 4A5UB 3CMEV 1XHXA 3JAMN 1AI5A 1VF6A 4FLUA 3CYOA 3R66A 3E22A 5J9PC 4DK0A 2VWKA 1IVSA 4O4IA 5IY5C 4JI4O 3O9OA 3WB1A 4X88A 3ZHRA 2FB5A 2HFEC 5JH7B 4KP4A 1IDSA 3AG4B 3RFRA 3BHPA 1Z5WA 3ZHVA 1KKDA 4J7ZA 3WFVA 4CS2A 3VQXA 4JZ2A 4LF9O 4J42A 1AVMA 1SS3A 1YDXA 3SGIA 2Z0AA 1XHZA 3WU2Z 1DTOA 2B1IA 3HKBB 5IJ0A 5EIBD 1K7DA 4DR4O 4TV8A 4MVZA 3QF7A 1FXKC 1GMGA 4HZ3A 2L6LA 1RSOA 3IFXA 2D2CB 3K5OA 2DYRC 4LF8O 3FD9A 2N74A 1HNWO 2EJRA 4P2ZA 2X6BA 1TUBB 4DR4B 2Q9LA 2OTJV 4AQYB 1OHHG 1NVPB 4I55A 3LSQA 2R70A 1GM7A 2VQFB 5D5QA 4IYHA 2EIKB 1BCCH 4DK1A 5CBGA 3J7AU 5L3DA 1ZL8A 4DV5O 1JJOA 2PF4E 3VOUA 2JEUA 4I9QA 2NLJC 1KP2A 2P06A 4LR3A 3UQ8A 4FMTA 2N05A 4Z2WA 2YIBD 5LGNA 3R65A 1Q82W 5LGUA 3CC7V 1YTFD 2V4DA 1FXKB 4TV9B 1JJ2U 4MVOA 5KLVH 1BSMA 3OFNG 1H2LA 5BR8O 1ZSPA 3DTUB 1BQ0A 2FTKA 3TETA 1SQBH 1IBKO 4H13B 1WA8B 1GN6A 1WP8A 4UFZA 5J2UA 4QE9A 1XL6A 3F5WC 5EYPA 1KQSU 1G6UA 2JRIA 2Q67A 2IM9A 3LDEA 1AR4A 3IJ4A 3SJAC 1YIJV 5LHGA 3T1YO 1WP7A 4J80A 1FKAO 3RGBA 2VQEB 4GX5A 2RCVA 4LWSA 1XREA 5K1PA 1BE3H 1PNLA 5KHIA 4I9WA 4MVMA 5B3SB 1SQPH 4DR1B 1HWYA 1IBLO 2DMXA 4X64B 4NXNB 5LA6B 2A79B 3K79A 3ZRSA 2WLHA 4K35A 4TV8B 3CCUV 3A0HZ 4X66B 1JVMA 2OIEA 3GVMA 4D7TA 4CC6A 3CCEV 3E89A 4X1KA 5EBLC 4TT3G 4UVCA 3JYCA 2UXDB 2ZQMA 1YSCA 1W59A 2ZM6O 5LMUO 1J5EO 3RT3C 1JX9A 2ZIMA 2QGNA 5LOVA 1D5AA 5L3EA 1OCZC 1M57B 2YEVA 1SQXH 2UUAO 2QTSA 4Z1MG 3RYHB 2CTWA 4X62O 3A8TA 1KECA 2LP7A 2Q73A 4B3TO 1AI7A 2YXLA 4TV9A 2E74B 4X8AA 4J9ZB 1HW7A 4NVPA 2V1DA 2IW5A 3OT7A 3H1HH 5CBHA 1AJQA 1P7GA 1H2NA 1URFA 5IT9N 1MABG 1PKXA 4DYLA 1HNZB 3G4SV 4NXMB 3HKEB 5GONB 4UB6Z 4JYAO 3VBBA 5IJ9B 3FAVB 1M4UA 2KQXA 4X20B 2H8PC 4I50A 2QTOA 1OCCB 4FM0A 4FM1A 2CAZC 4FFBA 2X6AA 3ETEA 1ZUQA 3JSLA 4GYCB 3IAYA 1L1FA 1YTFB 1M5IA 1N4CA 3L74H 4GKKB 1MOFA 4ABMA 5LYJB 3OUFA 1I08A 1OCOC 2HEPA 2IH3C 4F6EA 5A9GA 4HNAB 3SYAA 2HVJC 2JK5C 3HKDB 2MK3A 1Z5VA 2CH7B 1A32A 1N34O 3ZX6A 3B2EE 5FL7G 4DRXA 1NVPD 4B3SB 1H2GA 1MZFA 2ZE7A 5C8YB 5F2VO 1OJHA 3U0ZA 5HFMA 3OEEG 1QNMA 3BEHA 4DR2O 1BS3A 2Y4UA 3TXQA 3U10A 5FPRA 4JI6B 3U11A 3ABMB 3AG2C 4I55B 5EC1C 3CCSV 5B1BB 4FLXA 4RWUA 1KKCA 3AK2A 4FLTA 5IYZB 1QLEB 4J7JA 2IJIA 4ZBMA 2EULA 5H9CA 2ZE6A 4EB6B 2EBOA 3QNEA 3DGEA 5KAFZ 3BVOA 5KX5B 1US6A 2JEXA 3SYPA 2YI9A 5H2FZ 2QSAA 2W6JG 4YJ2B 4K0KO 1JOYA 2ZINA 4K8XA 4DV1O 4WFGA 3OW2U 3D8CA 4X89A 1EZVH 3JAKB 3ZCCA 3E2EA 3RYCA 2HJFC 3M99B 1YJ9V 1AJNA 3JD1A 5HFLA 1XI1A 2Q7GA 3T1HB 2WLJA 1FFXB 4HAMA 4WFFA 1VQNV 1EZJA 3L9DA 1XMQO 1DGSA 1L0NH 1L8DA 3IC7A 1I94B 1MSDA 2ARHA 2GTSA 5E79Z 1RM1B 2PI5A 4FK5C 3RYFB 1YI2V 4QJFB 3QO8A 5B1OA 1H8EG 2ZIOA 1Q90D 1WA8A 4FFKA 5D5PA 3JATB 5GONA 4W4KA 3VQVA 2F95B 1XQ8A 1VQKV 3E22B 1NTMH 1X59A 1EN5A 4F4LA 5LMNO 3OTFA 1DF4A 1CEZA 5JJJB 1FD9A 3LUTB 4HBNA 3ETDA 1VARA 2HHHB 1VQ7V 1V55C 2QKCA 2Z3YA 3SYQA 2ITCC 4JI6O 5LXTA 4ASUG 4JI7O 1I0HA 3CRCA 5FNVB 1KP3A 2CGOA 2EIJC 1P49A 4CH4A 3UO3A 3JD2A 3SYCA 1JFFB 5CB4A 1OCCC 4P9OA 1AR5A 4LF4B 1GK9A 4GX0A 4OX9B 2W6IG 1KD1W 1Q6HA 5C8YA 1E1RG 3K5NA 3SJQC 2ZNIA 1FJGO 1RSOB 2BOBC 4GZRB 4IIJB 3TK1A 1MZEA 4CZZA 2EIMC 2JGUA 3OR7C 5JQGB 4JI3O 4K3AA 4JI5O 5KUKA 3JD0A 2NNUA 3OTOB 4C7UA 1ZAUA 4X64O 1ZTEA 4ZKIA 2F43G 5CA0A 4UCTA 3DXRB 1GN4A 4B7KA 1BHBA 3AK3A 2N04A 2Z5UA 4UCRA 2Y0IA 4NTXA 3CPWU 2RN9A 4G28B 4NXMO 4DR6O 5J2TA 1JMKC 1N32O 3HR0A 2WLLA 2YS8A 4U3FH 3STLC 3BFRA 2BE3A 3L70H 1VQPV 4O4LB 2W0XA 1VMGA 5IY5B 1JA8A 4LF5O 1Q6IA 2JDIG 2JJ2G 1U97A 2P7TC 1PPJH 2QWOB 4JV5O 2K9PA 2OIGA 3SPJA 2EINB 4U7OA 2R9AA 1KU9A 2YI8A 2JJ1G 2BCCH 1AB3A 3P3NA 4YJ3B 4UUJC 1IX9A 1BT8A 2EIJB 3RVZA 3CWBH 3HPLC 2WLNA 2IU0A 1U96A 1IBLB 3Q4HA 2P90A 4JI8O 2BSKA 4GX1A 1M56B 4JI2O 4Q6GA 5IYCO 5CB4B 4E4EA 1K4DC 2KG7B 3JARA 1K5SA 1WPXA 3JALB 4FLWA 4IHJA 3CRAA 1QU7A 4TQFA 4ICGA 2VQFO 3MD0A 4CS3A 1PNKA 2YC0A 4WFAV 3K57A 5KAIZ 3AG4C 2DWDC 3E8HA 4JI3B 2C2AA 5L3FA 1J95A 5H5NA 1I7FA 3ZMUA 5LA6A 3T1YB 4QIWF 1AR1B 4PDRA 1VQMV 4I4TA 1SZXA 1BGYH 2DJVA 4IGGA 2V7QG 1GO3F 3ZEDA 2Q68A 4PJ0Z 1M93A 4JI1O 2YEVB 5IE9A 2R9IA 1YF2A 1S3JA 4NXNO 4DR2B 2QM4A 4PA6A 1AI4A 1MA1A 1SZTA 1S5HC 4PI0A 4GX2A 4X65B 5JCOA 3CJHA 4XBFA 4R7CA 3RVYA 3DSQA 1LUWA 1L0LH 3OAAG 1NQTA 3BABA 3ZMTA 1N0NA 2DYSB 2Y48A 3LSSA 2VS0A 3HKEA 2UU9O 5IWAB 3CX5F 3K0DA 1D2DA 3H1KH 4LF6B 3UT5A 4K0KB 3MAQA 1HR0B 4JZGA 2ITDC 1ZWIC 2O57A 1RPRA 4DW0A 4JTAB 4NKGB 3JD3A 2UUAB 3JCZA 1NR1A 2UXNA 3EXAA 2ADQB 3ZS8C 2BSKB 4R6ZA 2B5UA 2QWQB 1K73W 4CH3A 2ZE5A 4GCZA 1MNGA 1RP3B 4F6RA 2IJHA 2ZKOA 2FYUH 5EK0A 1P7BA 2LGQA 5LHIA 2XT9A 4EFEA 1NBMG 2QJ1A 5LP6A 3F7YC 2OCHA 1YXBA 1VF7A 2ZR3A 1GM8A 3P3PA 2HP8A 4PI2A 1XMOB 2QWNB 2YIDA 4I50B 4I5SA 1T5EA 4X20A 4DR5O 1VF6C 4O4JA 2KG7A 4I4TB 1KYOF 1F51A 3L72H 3ZRWB 4XDJA 1SQFA 1B04A 3LSUA 3TJTA 3I56V 2HHHO 2YSUB 3K06A 3H9VA 4NTYA 3N27A 3A2FA 1YZBA 2P22C 1WPBA 3BAAA 3OMAB 3H1LH 3H1JH 1NR7A 1TAEA 1R73A 4JTDB 4YIOA 5CA1A 5BZBA 3B8MA 5EBWC 4X1YB 4E2LA 1XBLA 5B1BC 1ZL8B 5CA1B 4DRXB 4B3SO 4DR7O 4GUNA 4UV8A 1OCRC 3AG7A 2FL4A 2A06H 4ZHQA 4DXWA 2YDEA 3DC6A 4LF4O 5CBFA 2ZNJA 1VIBA 5LOVB 3P30A 4DV3O 3HB3B 3OD4A 5KX5A 4B3RO 2VRZA 4BW5A 2IBZH 4JPRA 4LFCB 1IZ3A 4UCSA 3B40A 3L73H 3ML0A 1VEWA 1H2SB 5K1XA 2XHBA 1H2KA 3K04A 4FLYA 1IBKB 1XNRB 1W0JG 2UXBO 1RFYA 4B3MB 1Q5OA 3APOA 3K0GA 1WN7A 4LC1A 3OMNB 1KBHA 3CXCU 1Y4MA 3M8AA 4U3JB 2PTMA 2RJZA 2WLIB 4UCUA 2CUGA 3AG3C 4W4LA 1IBMB 5GW7A 4DV6B 4KHPB 3CHXA 3I5DA 1AI6A 4QGPA 2Q7EA 2WLIA 3FYIB 3KCYA 3D36C 3ZN1A 2CGNA 4MVRA 5KMGA 1N32B 4N21A 2CH7A 4TQDA 4YXWG 1UJWB 4H44B 3FB8C 3I55V 4TOIA 1F4NA 1R3KC 1XNQB 2DE0X 1XL4A 4PA4A 2NR5A 2Q0AA 5B5EZ 3JAWA 2B9ZA 3AG2B 3EVKA 3CCQV 4JTCB 2OTLV 1SERA 1Y74B 4G2KA 2E5LO 4RQFA 2E76B 2Q7HA 2ODMA 3T4DA 3W7XA 3ABTA 2UXDO 5FNVA 1M57C 4LNUB 1OCZB 1HNXB 2GBOA 1OV9A 1F23A 3ZHQA 1CP9A 1VQ6V 3CC2V 4QPKA 5KHJA 3JCUZ 2VWJA 1QVGU 4QPJA 5EZYB 2WLMA 4JYYA 1KMIZ 1S77D 4ZI7A 4X62B 4AHCA 1EM1A 2YXYA 4LF7O 1EN4A 2H94A 1BQZA 1MMMA 2XAFA 4ZHQB 1TUBA 2RMKB 1FXVA 3QVNA 2XAHA 1K33A 4DV7O 4TWKA 1JCHA 1Q3EA 1WAZA 3KZIZ 2E75B 1GM9A 1S5JA 5IYDO 1KUQA 2LW1A 2ILMA 1Q6UA 2P4KA 1H38A 1Y76A 2XNDG 3BCCH 5CA0B 2ZDIC 1THZA 4O4LA 4H0LB 3E8FA 1SQVH 3MHSC 4GKJB 4FPPA 5IJ9A 3ABMC 5J2TB 2XAJA 1CPYA 4DW1A 3ZN0A 3JASA 1M1KW 3L71H 1M56C 5JVDB 1YCIA 1G8MA 2HLDG 2ZCEA 3PN1A 1K3EA 1NH2B 1M9NA 1RM1C 2HKOA 3BA8A 3N2GA 3A0RA 4U3JA 1SF9A 4O2BB 1Z2GA 4XDKA 4NR1A 2MW2B 4MTXA 4TSFG 2UXBB 4MVUA 1N36O 4J7KA 4O2BA 2QWRB 3K59A 5EYPB 4Q20A 1O9HA 2QKAA 4TUYB 1AROP 4LBEC 1QR8A 2PI4A 4QE7A 3Q4HB 4KUMA 3UKMA 3CCVV 4FZ1A 5GTIZ 3JD4A 2DQ3A 4JF3A 4OXSA 3JALA 4YY3B 1COWG 1TA8A 1N8RW 3E86A 3UO2A 3SJCC 4IIJA 2Y69B 4BR6A 3HKCA 4MW8A 1SETA 4O4HA 4OGQB 2A0LA 2IU3A 2F1MA 3O65A 5B66Z 2YIBA 4WBNB 2CE4A 3E35A 3HKCB 4JI8B 5JJNB 4MVSA 3W7SA 2KB1A 3STZC 5KA6A 4B3TB 3CE2A 5KA5A 5JQGA 3RYCB 4P9PA 1XOUA 2GUZB 1WB8A 2JS3A 1YHQV 2Q69A 3B09A 4FLVA 1HNZO 4BW9A 2CDYA 1X4TA 1QHTA 4U7NA 2E3CA 5DM6V 1D5NA 4RUFA 2Q0OC 2UUCB 5JVDA 2RQ6A 4X1KB 1PV0A 1NTKH 1R3JC 4WF9V 2QKSA 4CH5A 1P4RA 2F4VO 2P5OA 4HYOA 3PJSK 1QQCA 3AK1A 4QNHB 3K5LA 4CS4A 1S0VA 1Y6XA 2EJ7A 3LNMB 3T4ZA 3SJBC 1R6TA 3RBZA 4JGSA 1GTOA 1N33B 5L3BA 4YJ3A 3G80A 2UUCO 4JI7B 4UXNA 3F5TA 1Q7YW 1AJPA 3SPCA 2OYQA 4LF9B 3CCMV 3ABKC 3SPGA 1Y74A 3N2GB 3SPHA 5LXTB 3TCUA 3RW0A 3C3TA 1VQ4V 1W0KG 4OX9O 2UXCO 4LF5B 3F7VC 4NTWA 5LL6Y 3ZIAG 5J2UB 3N2KB 3CRQA 1XDCA 4XDLA 2XAGA 3B8NA 4LF6O 4NB5A 3CSXA 4FM2A 2A9HA 2JGDB 1JFFA 5EIBC 1PM9A 4R50A 1FS0G 3TXSA 4RQEA 3OM3B 1B06A 4JI1B 4B7EA 4O4IB 4LF7B 2CTPA 3K03A 3E8BA 3OTOO 4ZI7B 3H01A 4DUZB 1VQ9V 2AHYA 1VQ8V 4I0XA 1XNQO 3FKSG 4JYBA 2PZSA 3ZBHA 1R6NA 4O4HB 1LUVA 2Y4TA 2QDOA 2JIZG 4JI2B 1NTZH 2EINC 2F93B 2LGWA 5IJ0B 1G4YB 4LCUC 2ZD9A 2GUZA 4LH6A 1OCOB 4PDVA 1JR9A 1K4CC 2Q6AA 1MG1A 1N34B 2WA4A 2WLKA 2XUMA 3G6EV 4DV4O 5LHHA 4BAYA 2ZT9B 3FB6C 2YUAA 5E1AC 3C90A 4YJ2A 3THOA 1V54C 2LO1A 4J9YB 2HR3A 4MTOA 5CN0A 3CP1A 4MVQA 4DR3B 1V55B 4J11A 3J80N 1QLEC 1WB7A 2LQTA 1DF5A 1ENVA 1F4MA 2QR4A 4D7SA 3FAVA 1HDJA 3RYHA 2EZPA 1SQQH 2QM7A 3CRRA 4JAVA 4PV1B 3A0BZ 1V9PA 3OUSA 3S3XA 2L35A 3EHBB 1R1BA 2PGGA 4YHHO 3CCLV 3DXRA 3FB7C 3D3IA 4HNAA 3OGIB 1NJIW 4BWAA 4DR6B 2K1EA 3TGUH 5KHHA 3W7WA 3JATA 1XNRO 4GKJO 3KG2A 5KMGB 2FMLA 1TVKA 3RWRD 3ASOB 1CXZB 2DYSC 2G38A 5BMVA 2X7RB 2CTQA 1XEQA 4WCEV 1VQLV 1IBMO 5LYJA 3CEIA 1G1XB 1UFIA 1SKVA 1NKDA 3JSNA 1N33O 1Q43A 1ZLZA 2AHZA 2PYJA 1BHAA 1Y66A 3AG3B 3ASNC 2ZR2A 4JI0B 1S72V 1PD3A 4UB8Z 4WFHA 4K8ZA 2M7WA 1NU1H 4PDLA 3CMAV 1GN3A 5H6QA 4UV9A 3QO5A 4EFBA 3T2MA 2P6JA 2HVKC 1ORQC 3KKYA 5L3CA 4LWSB 2GV9A 5JJEB 4DV5B 3IC9A 4LFBO 3ICXA 4X1YA 1XMOO 2OCCB 5DEDA 1YEWA 4YY3O 2BTQA 1OCRB 2JVDA 1GN2A 4IHJB 1VQOV 3OMIB 1K34A 1SQGA 2EIMB 1I94O 4DR5B 5IYZA 3LNNA 1H8HG 1R3LC 2WAMA 4AI8A 4L87A 2QM8A 4WFBV 1SESA 5LBQA 3BA9A 3JASB 3ZJZA 3NXSA 4PA7A 3H1IH 4KL1A 2NN4A 4X1IB 2AXTZ 1V54B 2XASA 3MDSA 1NT2B 4LFAB 3X2QC 4DV0B 4FFBB 2DQ0A 2RDCA 1QCEA 4FZ0A 1N36B 3G71V 2X0LA 1VP7A 4JASA 3IGAC 2EILC 2Q5ZA 4B3RB 5BY1A 2F23A 2YXHA 2F66C 2A3QA 2LFRA 3SPIA 3W7UA 4LFAO 2IJKA 4EEQA 4DV1B 5JCOC 5EBMC 2ZE8A 4B3MO 2JGDA 5IWAO 5JWPA 2ZXWC 3ABLC 4DV2O 3D3QA 1S5LZ 4KXRA 3J81N 5JH7A 4KHPO 1GAXA 4YHHB 1PNMA 1PL0A 3RYIB 3RN4A 1K5QA 2Y69C 1IURA 4DV7B 2WWWA 4YIPA 2H3OA 4AQYO 1HNWB 2B1GA 1K92A 3ABLB 4PA9A 2DN9A 4PD4F 1PP9H 2XOKG 3K08A 1GKFA 3WB2A 3WG7B 4MSWC 4CC5A 3OR6C 3FX7A 2E5LB 4IT5A 2OT5A 4PHZA 1VF5B 2LFSA 5IDJA 3B77A 1FFTB 3CD6V 1R3IC 2M6YA 1FFXA 4JAAA 5B3SC 2GHYA 3ASNB 2VQEO 1B3QA 2WLLB 1NZ6A 2XTAA 3OGCC 3K58A 1WLEA 2EZOA 4H33A 4DUZO 2BOCC 1YJWV 5LGTA 1HR0O 4JV5B 2ATKC 3AG1B 3VQWA 5DECA 1LR1A 1EN6A 4JYAB 1SC5B 5KHKA 3ZHSA 4PA3A 3GWOA 1SA0A 1DLBA 2DYRB 5DN6G 2FKXA 2AZ0A 3ZRVA 4JI4B 3VQYA 2UUBB 5CMUA 5A2QN 2XAQA 3SR2C 5AG2A 4UVAA 2AW9A 2UXCB 1BL8A 1M90W 2ZM6B 5LMUB 1K9MW 3E8GA 4RAIA 3SYOA 3NR7A 1Q86W 3KCXA 3ZMZA 3FFQA 4BIOA 3QO7A 1LNQA 1TVKB 2GTAA 3LDDA 4UCOA 4MS2A 1P84F 2ADPA 2P67A 4CBCA 2QEXV 3M7MX 3JARB 2IJJA 2UUBO 1NI8A 2GSMB 1FAFA 2UXXA 1IXBA 3RYIA 4AILC 1XMQB 2BTOA 5L3GA 2UU9B 3K5MA 4MTFA 2AGAA 1YJNV 2EIKC 2DWEC 3WG7C 3X2QB 1BMFG 3ZRXA 4LFBB 4MT8A 4JYCA 3UCSC 3DC5A 2OCCC 3G6BA 2IH1C 2CK3G 1AP6A 2PY5A 5LP6C 4O2AA 4F6RB 1KC8W 4LP8A 1EFRG 5LMNB 1TGOA 3GWKC 5FPOA 3N2KA 2KKWA 4ZIBA 2HG5C 1N0JA 1E79G 4MW3A 1PL4A 3AEIA 4JAUA 1XUQA 2D3OW 1Q81W 2CTRA 2HJDA 3OE7G 3SDLA 1IXMA 4JI0O 2F4VB 3ZHTA 3EFFK 3AG1C 3CCJV 4O4JB 1VQ5V 4NYKA 2QA4V 2KSDA 5KHGA 1HNXO 3BRCA 2PUSA 4RUEA 1I5YA 4X1IA 4G27B 4UVBA 1S76D 5ITZB 1NS1A 3FYEB 1YITV 3B4SA 3UT5B 3GB7C 4N23A 5B1AC 1WNSA 1QVFU 5ITZA 4D6TH 1FXHA 4BIUA 1FJGB 1Y67A 3ETGA 5KUMA 2OWOA 3CJHB 4EB6A 3P32A 4RO2A 3JAKA 4DUYB 1GRJA 2LW7A 2AZ2A 4BIZA 1ZX3A 4GKKO 1HP8A 1K97A 4UCVA 1BZKA 2RNBA 4PELA 4TUYA 4GT1A 4LH7A 1DK1A 4H37A 2GDSA 3T1CA 4DR3O 1E1QG 5GTHZ 3CS5A 1QBZA 4DUYO 1Q8IA 2ZDIA 4X65O 4FLZA 4LFCO 1GH6A 4DV0O 1SRYA 3ZMSA 2R9RB 3APQA 5EC2C 3MHHC 4P30A 1W2BU 1FXKA 3T1HO 3CCRV 1I5XA 2YICA 2EX3A 3UM7A 2LJ2A 3K9SA 4DR1O 3JAWB 3K3WA 1RPOA 1JQ0A 2X6CA 3ZRWA 1H2MA 4MTGA 4WFEA 1AILA 3D36A 5BMVB 4R8CA 1R6KA 4I0XB 3W7TA 4OPHA 5BXZA 1XILA 4OPAA 4FVMA 4CH6A 5FLXN 1KB9F 1EBOA 3ABUA 3BY6A 4DR7B 4Z1VA 2Q8VA 3HKBA 4DV4B 2DOSA 4LNUA 2W0FC 1B6QA 4EKWA
chains in the Genus database with same CATH topology
3B40A 1Y74A 1VF6A 1ZL8A 1Y76B 1RSOB 1Y76A 1VF6C 1ZL8B 1Y74B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B40 A;  1Y74 A;  1VF6 A;  1ZL8 A;  1Y76 B;  1RSO B;  1Y76 A;  1VF6 C;  1ZL8 B;  1Y74 B; 
#chains in the Genus database with same CATH topology
 3K9A A;  4JI5 B;  2EIL B;  3L75 H;  2WPD G;  1NH2 D;  3HKD A;  5IYB O;  4L8J A;  4DV3 B;  3ABK B;  2JS5 A;  3G67 A;  3CRM A;  3CB2 A;  1JPX A;  2P4V A;  4FJC C;  4O2A B;  1K8A W;  4ZOL B;  4IYI A;  1OZ0 A;  4I7Z B;  5CA3 A;  4FIP C;  3ASO C;  3ZMV A;  2Q4P A;  2YIA A;  5B1A B;  4ZOL A;  5H6R A;  4J10 A;  2WA3 A;  2R72 A;  5C93 A;  1SA0 B;  4DV6 O;  4DO2 A;  3FB5 C;  1F7Y A;  1WJZ A;  4KFM A;  1Y76 B;  1FPO A;  3ETQ A;  3RYF A;  5EZY A;  1QR9 A;  2PYL A;  2A7W A;  4GLX A;  2DW4 A;  4LF8 B;  4WBN A;  1TUE B;  3CXH F;  3QTC A;  4X9Q A;  3S3W A;  4X66 O;  1QLN A;  2QE7 G;  3WB0 A;  3BPZ A;  5BR8 B;  1MSW D;  5TIS Z;  3ZHU A;  3E83 A;  3C3S A;  3LDC A;  5B1N A;  1YVW A;  2BTQ B;  4J41 A;  4B08 A;  1UPG A;  1AP5 A;  2Y0P A;  1O9G A;  1FYJ A;  1J5E B;  4PDM A;  2ETN A;  3CC4 V;  1ROP A;  3QG5 A;  2QWP B;  4DV2 B;  5LP6 B;  4IL6 Z;  3OEH G;  2ZXW B;  2WSS G;  4A5U B;  3CME V;  1XHX A;  3JAM N;  1AI5 A;  1VF6 A;  4FLU A;  3CYO A;  3R66 A;  3E22 A;  5J9P C;  4DK0 A;  2VWK A;  1IVS A;  4O4I A;  5IY5 C;  4JI4 O;  3O9O A;  3WB1 A;  4X88 A;  3ZHR A;  2FB5 A;  2HFE C;  5JH7 B;  4KP4 A;  1IDS A;  3AG4 B;  3RFR A;  3BHP A;  1Z5W A;  3ZHV A;  1KKD A;  4J7Z A;  3WFV A;  4CS2 A;  3VQX A;  4JZ2 A;  4LF9 O;  4J42 A;  1AVM A;  1SS3 A;  1YDX A;  3SGI A;  2Z0A A;  1XHZ A;  3WU2 Z;  1DTO A;  2B1I A;  3HKB B;  5IJ0 A;  5EIB D;  1K7D A;  4DR4 O;  4TV8 A;  4MVZ A;  3QF7 A;  1FXK C;  1GMG A;  4HZ3 A;  2L6L A;  1RSO A;  3IFX A;  2D2C B;  3K5O A;  2DYR C;  4LF8 O;  3FD9 A;  2N74 A;  1HNW O;  2EJR A;  4P2Z A;  2X6B A;  1TUB B;  4DR4 B;  2Q9L A;  2OTJ V;  4AQY B;  1OHH G;  1NVP B;  4I55 A;  3LSQ A;  2R70 A;  1GM7 A;  2VQF B;  5D5Q A;  4IYH A;  2EIK B;  1BCC H;  4DK1 A;  5CBG A;  3J7A U;  5L3D A;  1ZL8 A;  4DV5 O;  1JJO A;  2PF4 E;  3VOU A;  2JEU A;  4I9Q A;  2NLJ C;  1KP2 A;  2P06 A;  4LR3 A;  3UQ8 A;  4FMT A;  2N05 A;  4Z2W A;  2YIB D;  5LGN A;  3R65 A;  1Q82 W;  5LGU A;  3CC7 V;  1YTF D;  2V4D A;  1FXK B;  4TV9 B;  1JJ2 U;  4MVO A;  5KLV H;  1BSM A;  3OFN G;  1H2L A;  5BR8 O;  1ZSP A;  3DTU B;  1BQ0 A;  2FTK A;  3TET A;  1SQB H;  1IBK O;  4H13 B;  1WA8 B;  1GN6 A;  1WP8 A;  4UFZ A;  5J2U A;  4QE9 A;  1XL6 A;  3F5W C;  5EYP A;  1KQS U;  1G6U A;  2JRI A;  2Q67 A;  2IM9 A;  3LDE A;  1AR4 A;  3IJ4 A;  3SJA C;  1YIJ V;  5LHG A;  3T1Y O;  1WP7 A;  4J80 A;  1FKA O;  3RGB A;  2VQE B;  4GX5 A;  2RCV A;  4LWS A;  1XRE A;  5K1P A;  1BE3 H;  1PNL A;  5KHI A;  4I9W A;  4MVM A;  5B3S B;  1SQP H;  4DR1 B;  1HWY A;  1IBL O;  2DMX A;  4X64 B;  4NXN B;  5LA6 B;  2A79 B;  3K79 A;  3ZRS A;  2WLH A;  4K35 A;  4TV8 B;  3CCU V;  3A0H Z;  4X66 B;  1JVM A;  2OIE A;  3GVM A;  4D7T A;  4CC6 A;  3CCE V;  3E89 A;  4X1K A;  5EBL C;  4TT3 G;  4UVC A;  3JYC A;  2UXD B;  2ZQM A;  1YSC A;  1W59 A;  2ZM6 O;  5LMU O;  1J5E O;  3RT3 C;  1JX9 A;  2ZIM A;  2QGN A;  5LOV A;  1D5A A;  5L3E A;  1OCZ C;  1M57 B;  2YEV A;  1SQX H;  2UUA O;  2QTS A;  4Z1M G;  3RYH B;  2CTW A;  4X62 O;  3A8T A;  1KEC A;  2LP7 A;  2Q73 A;  4B3T O;  1AI7 A;  2YXL A;  4TV9 A;  2E74 B;  4X8A A;  4J9Z B;  1HW7 A;  4NVP A;  2V1D A;  2IW5 A;  3OT7 A;  3H1H H;  5CBH A;  1AJQ A;  1P7G A;  1H2N A;  1URF A;  5IT9 N;  1MAB G;  1PKX A;  4DYL A;  1HNZ B;  3G4S V;  4NXM B;  3HKE B;  5GON B;  4UB6 Z;  4JYA O;  3VBB A;  5IJ9 B;  3FAV B;  1M4U A;  2KQX A;  4X20 B;  2H8P C;  4I50 A;  2QTO A;  1OCC B;  4FM0 A;  4FM1 A;  2CAZ C;  4FFB A;  2X6A A;  3ETE A;  1ZUQ A;  3JSL A;  4GYC B;  3IAY A;  1L1F A;  1YTF B;  1M5I A;  1N4C A;  3L74 H;  4GKK B;  1MOF A;  4ABM A;  5LYJ B;  3OUF A;  1I08 A;  1OCO C;  2HEP A;  2IH3 C;  4F6E A;  5A9G A;  4HNA B;  3SYA A;  2HVJ C;  2JK5 C;  3HKD B;  2MK3 A;  1Z5V A;  2CH7 B;  1A32 A;  1N34 O;  3ZX6 A;  3B2E E;  5FL7 G;  4DRX A;  1NVP D;  4B3S B;  1H2G A;  1MZF A;  2ZE7 A;  5C8Y B;  5F2V O;  1OJH A;  3U0Z A;  5HFM A;  3OEE G;  1QNM A;  3BEH A;  4DR2 O;  1BS3 A;  2Y4U A;  3TXQ A;  3U10 A;  5FPR A;  4JI6 B;  3U11 A;  3ABM B;  3AG2 C;  4I55 B;  5EC1 C;  3CCS V;  5B1B B;  4FLX A;  4RWU A;  1KKC A;  3AK2 A;  4FLT A;  5IYZ B;  1QLE B;  4J7J A;  2IJI A;  4ZBM A;  2EUL A;  5H9C A;  2ZE6 A;  4EB6 B;  2EBO A;  3QNE A;  3DGE A;  5KAF Z;  3BVO A;  5KX5 B;  1US6 A;  2JEX A;  3SYP A;  2YI9 A;  5H2F Z;  2QSA A;  2W6J G;  4YJ2 B;  4K0K O;  1JOY A;  2ZIN A;  4K8X A;  4DV1 O;  4WFG A;  3OW2 U;  3D8C A;  4X89 A;  1EZV H;  3JAK B;  3ZCC A;  3E2E A;  3RYC A;  2HJF C;  3M99 B;  1YJ9 V;  1AJN A;  3JD1 A;  5HFL A;  1XI1 A;  2Q7G A;  3T1H B;  2WLJ A;  1FFX B;  4HAM A;  4WFF A;  1VQN V;  1EZJ A;  3L9D A;  1XMQ O;  1DGS A;  1L0N H;  1L8D A;  3IC7 A;  1I94 B;  1MSD A;  2ARH A;  2GTS A;  5E79 Z;  1RM1 B;  2PI5 A;  4FK5 C;  3RYF B;  1YI2 V;  4QJF B;  3QO8 A;  5B1O A;  1H8E G;  2ZIO A;  1Q90 D;  1WA8 A;  4FFK A;  5D5P A;  3JAT B;  5GON A;  4W4K A;  3VQV A;  2F95 B;  1XQ8 A;  1VQK V;  3E22 B;  1NTM H;  1X59 A;  1EN5 A;  4F4L A;  5LMN O;  3OTF A;  1DF4 A;  1CEZ A;  5JJJ B;  1FD9 A;  3LUT B;  4HBN A;  3ETD A;  1VAR A;  2HHH B;  1VQ7 V;  1V55 C;  2QKC A;  2Z3Y A;  3SYQ A;  2ITC C;  4JI6 O;  5LXT A;  4ASU G;  4JI7 O;  1I0H A;  3CRC A;  5FNV B;  1KP3 A;  2CGO A;  2EIJ C;  1P49 A;  4CH4 A;  3UO3 A;  3JD2 A;  3SYC A;  1JFF B;  5CB4 A;  1OCC C;  4P9O A;  1AR5 A;  4LF4 B;  1GK9 A;  4GX0 A;  4OX9 B;  2W6I G;  1KD1 W;  1Q6H A;  5C8Y A;  1E1R G;  3K5N A;  3SJQ C;  2ZNI A;  1FJG O;  1RSO B;  2BOB C;  4GZR B;  4IIJ B;  3TK1 A;  1MZE A;  4CZZ A;  2EIM C;  2JGU A;  3OR7 C;  5JQG B;  4JI3 O;  4K3A A;  4JI5 O;  5KUK A;  3JD0 A;  2NNU A;  3OTO B;  4C7U A;  1ZAU A;  4X64 O;  1ZTE A;  4ZKI A;  2F43 G;  5CA0 A;  4UCT A;  3DXR B;  1GN4 A;  4B7K A;  1BHB A;  3AK3 A;  2N04 A;  2Z5U A;  4UCR A;  2Y0I A;  4NTX A;  3CPW U;  2RN9 A;  4G28 B;  4NXM O;  4DR6 O;  5J2T A;  1JMK C;  1N32 O;  3HR0 A;  2WLL A;  2YS8 A;  4U3F H;  3STL C;  3BFR A;  2BE3 A;  3L70 H;  1VQP V;  4O4L B;  2W0X A;  1VMG A;  5IY5 B;  1JA8 A;  4LF5 O;  1Q6I A;  2JDI G;  2JJ2 G;  1U97 A;  2P7T C;  1PPJ H;  2QWO B;  4JV5 O;  2K9P A;  2OIG A;  3SPJ A;  2EIN B;  4U7O A;  2R9A A;  1KU9 A;  2YI8 A;  2JJ1 G;  2BCC H;  1AB3 A;  3P3N A;  4YJ3 B;  4UUJ C;  1IX9 A;  1BT8 A;  2EIJ B;  3RVZ A;  3CWB H;  3HPL C;  2WLN A;  2IU0 A;  1U96 A;  1IBL B;  3Q4H A;  2P90 A;  4JI8 O;  2BSK A;  4GX1 A;  1M56 B;  4JI2 O;  4Q6G A;  5IYC O;  5CB4 B;  4E4E A;  1K4D C;  2KG7 B;  3JAR A;  1K5S A;  1WPX A;  3JAL B;  4FLW A;  4IHJ A;  3CRA A;  1QU7 A;  4TQF A;  4ICG A;  2VQF O;  3MD0 A;  4CS3 A;  1PNK A;  2YC0 A;  4WFA V;  3K57 A;  5KAI Z;  3AG4 C;  2DWD C;  3E8H A;  4JI3 B;  2C2A A;  5L3F A;  1J95 A;  5H5N A;  1I7F A;  3ZMU A;  5LA6 A;  3T1Y B;  4QIW F;  1AR1 B;  4PDR A;  1VQM V;  4I4T A;  1SZX A;  1BGY H;  2DJV A;  4IGG A;  2V7Q G;  1GO3 F;  3ZED A;  2Q68 A;  4PJ0 Z;  1M93 A;  4JI1 O;  2YEV B;  5IE9 A;  2R9I A;  1YF2 A;  1S3J A;  4NXN O;  4DR2 B;  2QM4 A;  4PA6 A;  1AI4 A;  1MA1 A;  1SZT A;  1S5H C;  4PI0 A;  4GX2 A;  4X65 B;  5JCO A;  3CJH A;  4XBF A;  4R7C A;  3RVY A;  3DSQ A;  1LUW A;  1L0L H;  3OAA G;  1NQT A;  3BAB A;  3ZMT A;  1N0N A;  2DYS B;  2Y48 A;  3LSS A;  2VS0 A;  3HKE A;  2UU9 O;  5IWA B;  3CX5 F;  3K0D A;  1D2D A;  3H1K H;  4LF6 B;  3UT5 A;  4K0K B;  3MAQ A;  1HR0 B;  4JZG A;  2ITD C;  1ZWI C;  2O57 A;  1RPR A;  4DW0 A;  4JTA B;  4NKG B;  3JD3 A;  2UUA B;  3JCZ A;  1NR1 A;  2UXN A;  3EXA A;  2ADQ B;  3ZS8 C;  2BSK B;  4R6Z A;  2B5U A;  2QWQ B;  1K73 W;  4CH3 A;  2ZE5 A;  4GCZ A;  1MNG A;  1RP3 B;  4F6R A;  2IJH A;  2ZKO A;  2FYU H;  5EK0 A;  1P7B A;  2LGQ A;  5LHI A;  2XT9 A;  4EFE A;  1NBM G;  2QJ1 A;  5LP6 A;  3F7Y C;  2OCH A;  1YXB A;  1VF7 A;  2ZR3 A;  1GM8 A;  3P3P A;  2HP8 A;  4PI2 A;  1XMO B;  2QWN B;  2YID A;  4I50 B;  4I5S A;  1T5E A;  4X20 A;  4DR5 O;  1VF6 C;  4O4J A;  2KG7 A;  4I4T B;  1KYO F;  1F51 A;  3L72 H;  3ZRW B;  4XDJ A;  1SQF A;  1B04 A;  3LSU A;  3TJT A;  3I56 V;  2HHH O;  2YSU B;  3K06 A;  3H9V A;  4NTY A;  3N27 A;  3A2F A;  1YZB A;  2P22 C;  1WPB A;  3BAA A;  3OMA B;  3H1L H;  3H1J H;  1NR7 A;  1TAE A;  1R73 A;  4JTD B;  4YIO A;  5CA1 A;  5BZB A;  3B8M A;  5EBW C;  4X1Y B;  4E2L A;  1XBL A;  5B1B C;  1ZL8 B;  5CA1 B;  4DRX B;  4B3S O;  4DR7 O;  4GUN A;  4UV8 A;  1OCR C;  3AG7 A;  2FL4 A;  2A06 H;  4ZHQ A;  4DXW A;  2YDE A;  3DC6 A;  4LF4 O;  5CBF A;  2ZNJ A;  1VIB A;  5LOV B;  3P30 A;  4DV3 O;  3HB3 B;  3OD4 A;  5KX5 A;  4B3R O;  2VRZ A;  4BW5 A;  2IBZ H;  4JPR A;  4LFC B;  1IZ3 A;  4UCS A;  3B40 A;  3L73 H;  3ML0 A;  1VEW A;  1H2S B;  5K1X A;  2XHB A;  1H2K A;  3K04 A;  4FLY A;  1IBK B;  1XNR B;  1W0J G;  2UXB O;  1RFY A;  4B3M B;  1Q5O A;  3APO A;  3K0G A;  1WN7 A;  4LC1 A;  3OMN B;  1KBH A;  3CXC U;  1Y4M A;  3M8A A;  4U3J B;  2PTM A;  2RJZ A;  2WLI B;  4UCU A;  2CUG A;  3AG3 C;  4W4L A;  1IBM B;  5GW7 A;  4DV6 B;  4KHP B;  3CHX A;  3I5D A;  1AI6 A;  4QGP A;  2Q7E A;  2WLI A;  3FYI B;  3KCY A;  3D36 C;  3ZN1 A;  2CGN A;  4MVR A;  5KMG A;  1N32 B;  4N21 A;  2CH7 A;  4TQD A;  4YXW G;  1UJW B;  4H44 B;  3FB8 C;  3I55 V;  4TOI A;  1F4N A;  1R3K C;  1XNQ B;  2DE0 X;  1XL4 A;  4PA4 A;  2NR5 A;  2Q0A A;  5B5E Z;  3JAW A;  2B9Z A;  3AG2 B;  3EVK A;  3CCQ V;  4JTC B;  2OTL V;  1SER A;  1Y74 B;  4G2K A;  2E5L O;  4RQF A;  2E76 B;  2Q7H A;  2ODM A;  3T4D A;  3W7X A;  3ABT A;  2UXD O;  5FNV A;  1M57 C;  4LNU B;  1OCZ B;  1HNX B;  2GBO A;  1OV9 A;  1F23 A;  3ZHQ A;  1CP9 A;  1VQ6 V;  3CC2 V;  4QPK A;  5KHJ A;  3JCU Z;  2VWJ A;  1QVG U;  4QPJ A;  5EZY B;  2WLM A;  4JYY A;  1KMI Z;  1S77 D;  4ZI7 A;  4X62 B;  4AHC A;  1EM1 A;  2YXY A;  4LF7 O;  1EN4 A;  2H94 A;  1BQZ A;  1MMM A;  2XAF A;  4ZHQ B;  1TUB A;  2RMK B;  1FXV A;  3QVN A;  2XAH A;  1K33 A;  4DV7 O;  4TWK A;  1JCH A;  1Q3E A;  1WAZ A;  3KZI Z;  2E75 B;  1GM9 A;  1S5J A;  5IYD O;  1KUQ A;  2LW1 A;  2ILM A;  1Q6U A;  2P4K A;  1H38 A;  1Y76 A;  2XND G;  3BCC H;  5CA0 B;  2ZDI C;  1THZ A;  4O4L A;  4H0L B;  3E8F A;  1SQV H;  3MHS C;  4GKJ B;  4FPP A;  5IJ9 A;  3ABM C;  5J2T B;  2XAJ A;  1CPY A;  4DW1 A;  3ZN0 A;  3JAS A;  1M1K W;  3L71 H;  1M56 C;  5JVD B;  1YCI A;  1G8M A;  2HLD G;  2ZCE A;  3PN1 A;  1K3E A;  1NH2 B;  1M9N A;  1RM1 C;  2HKO A;  3BA8 A;  3N2G A;  3A0R A;  4U3J A;  1SF9 A;  4O2B B;  1Z2G A;  4XDK A;  4NR1 A;  2MW2 B;  4MTX A;  4TSF G;  2UXB B;  4MVU A;  1N36 O;  4J7K A;  4O2B A;  2QWR B;  3K59 A;  5EYP B;  4Q20 A;  1O9H A;  2QKA A;  4TUY B;  1ARO P;  4LBE C;  1QR8 A;  2PI4 A;  4QE7 A;  3Q4H B;  4KUM A;  3UKM A;  3CCV V;  4FZ1 A;  5GTI Z;  3JD4 A;  2DQ3 A;  4JF3 A;  4OXS A;  3JAL A;  4YY3 B;  1COW G;  1TA8 A;  1N8R W;  3E86 A;  3UO2 A;  3SJC C;  4IIJ A;  2Y69 B;  4BR6 A;  3HKC A;  4MW8 A;  1SET A;  4O4H A;  4OGQ B;  2A0L A;  2IU3 A;  2F1M A;  3O65 A;  5B66 Z;  2YIB A;  4WBN B;  2CE4 A;  3E35 A;  3HKC B;  4JI8 B;  5JJN B;  4MVS A;  3W7S A;  2KB1 A;  3STZ C;  5KA6 A;  4B3T B;  3CE2 A;  5KA5 A;  5JQG A;  3RYC B;  4P9P A;  1XOU A;  2GUZ B;  1WB8 A;  2JS3 A;  1YHQ V;  2Q69 A;  3B09 A;  4FLV A;  1HNZ O;  4BW9 A;  2CDY A;  1X4T A;  1QHT A;  4U7N A;  2E3C A;  5DM6 V;  1D5N A;  4RUF A;  2Q0O C;  2UUC B;  5JVD A;  2RQ6 A;  4X1K B;  1PV0 A;  1NTK H;  1R3J C;  4WF9 V;  2QKS A;  4CH5 A;  1P4R A;  2F4V O;  2P5O A;  4HYO A;  3PJS K;  1QQC A;  3AK1 A;  4QNH B;  3K5L A;  4CS4 A;  1S0V A;  1Y6X A;  2EJ7 A;  3LNM B;  3T4Z A;  3SJB C;  1R6T A;  3RBZ A;  4JGS A;  1GTO A;  1N33 B;  5L3B A;  4YJ3 A;  3G80 A;  2UUC O;  4JI7 B;  4UXN A;  3F5T A;  1Q7Y W;  1AJP A;  3SPC A;  2OYQ A;  4LF9 B;  3CCM V;  3ABK C;  3SPG A;  1Y74 A;  3N2G B;  3SPH A;  5LXT B;  3TCU A;  3RW0 A;  3C3T A;  1VQ4 V;  1W0K G;  4OX9 O;  2UXC O;  4LF5 B;  3F7V C;  4NTW A;  5LL6 Y;  3ZIA G;  5J2U B;  3N2K B;  3CRQ A;  1XDC A;  4XDL A;  2XAG A;  3B8N A;  4LF6 O;  4NB5 A;  3CSX A;  4FM2 A;  2A9H A;  2JGD B;  1JFF A;  5EIB C;  1PM9 A;  4R50 A;  1FS0 G;  3TXS A;  4RQE A;  3OM3 B;  1B06 A;  4JI1 B;  4B7E A;  4O4I B;  4LF7 B;  2CTP A;  3K03 A;  3E8B A;  3OTO O;  4ZI7 B;  3H01 A;  4DUZ B;  1VQ9 V;  2AHY A;  1VQ8 V;  4I0X A;  1XNQ O;  3FKS G;  4JYB A;  2PZS A;  3ZBH A;  1R6N A;  4O4H B;  1LUV A;  2Y4T A;  2QDO A;  2JIZ G;  4JI2 B;  1NTZ H;  2EIN C;  2F93 B;  2LGW A;  5IJ0 B;  1G4Y B;  4LCU C;  2ZD9 A;  2GUZ A;  4LH6 A;  1OCO B;  4PDV A;  1JR9 A;  1K4C C;  2Q6A A;  1MG1 A;  1N34 B;  2WA4 A;  2WLK A;  2XUM A;  3G6E V;  4DV4 O;  5LHH A;  4BAY A;  2ZT9 B;  3FB6 C;  2YUA A;  5E1A C;  3C90 A;  4YJ2 A;  3THO A;  1V54 C;  2LO1 A;  4J9Y B;  2HR3 A;  4MTO A;  5CN0 A;  3CP1 A;  4MVQ A;  4DR3 B;  1V55 B;  4J11 A;  3J80 N;  1QLE C;  1WB7 A;  2LQT A;  1DF5 A;  1ENV A;  1F4M A;  2QR4 A;  4D7S A;  3FAV A;  1HDJ A;  3RYH A;  2EZP A;  1SQQ H;  2QM7 A;  3CRR A;  4JAV A;  4PV1 B;  3A0B Z;  1V9P A;  3OUS A;  3S3X A;  2L35 A;  3EHB B;  1R1B A;  2PGG A;  4YHH O;  3CCL V;  3DXR A;  3FB7 C;  3D3I A;  4HNA A;  3OGI B;  1NJI W;  4BWA A;  4DR6 B;  2K1E A;  3TGU H;  5KHH A;  3W7W A;  3JAT A;  1XNR O;  4GKJ O;  3KG2 A;  5KMG B;  2FML A;  1TVK A;  3RWR D;  3ASO B;  1CXZ B;  2DYS C;  2G38 A;  5BMV A;  2X7R B;  2CTQ A;  1XEQ A;  4WCE V;  1VQL V;  1IBM O;  5LYJ A;  3CEI A;  1G1X B;  1UFI A;  1SKV A;  1NKD A;  3JSN A;  1N33 O;  1Q43 A;  1ZLZ A;  2AHZ A;  2PYJ A;  1BHA A;  1Y66 A;  3AG3 B;  3ASN C;  2ZR2 A;  4JI0 B;  1S72 V;  1PD3 A;  4UB8 Z;  4WFH A;  4K8Z A;  2M7W A;  1NU1 H;  4PDL A;  3CMA V;  1GN3 A;  5H6Q A;  4UV9 A;  3QO5 A;  4EFB A;  3T2M A;  2P6J A;  2HVK C;  1ORQ C;  3KKY A;  5L3C A;  4LWS B;  2GV9 A;  5JJE B;  4DV5 B;  3IC9 A;  4LFB O;  3ICX A;  4X1Y A;  1XMO O;  2OCC B;  5DED A;  1YEW A;  4YY3 O;  2BTQ A;  1OCR B;  2JVD A;  1GN2 A;  4IHJ B;  1VQO V;  3OMI B;  1K34 A;  1SQG A;  2EIM B;  1I94 O;  4DR5 B;  5IYZ A;  3LNN A;  1H8H G;  1R3L C;  2WAM A;  4AI8 A;  4L87 A;  2QM8 A;  4WFB V;  1SES A;  5LBQ A;  3BA9 A;  3JAS B;  3ZJZ A;  3NXS A;  4PA7 A;  3H1I H;  4KL1 A;  2NN4 A;  4X1I B;  2AXT Z;  1V54 B;  2XAS A;  3MDS A;  1NT2 B;  4LFA B;  3X2Q C;  4DV0 B;  4FFB B;  2DQ0 A;  2RDC A;  1QCE A;  4FZ0 A;  1N36 B;  3G71 V;  2X0L A;  1VP7 A;  4JAS A;  3IGA C;  2EIL C;  2Q5Z A;  4B3R B;  5BY1 A;  2F23 A;  2YXH A;  2F66 C;  2A3Q A;  2LFR A;  3SPI A;  3W7U A;  4LFA O;  2IJK A;  4EEQ A;  4DV1 B;  5JCO C;  5EBM C;  2ZE8 A;  4B3M O;  2JGD A;  5IWA O;  5JWP A;  2ZXW C;  3ABL C;  4DV2 O;  3D3Q A;  1S5L Z;  4KXR A;  3J81 N;  5JH7 A;  4KHP O;  1GAX A;  4YHH B;  1PNM A;  1PL0 A;  3RYI B;  3RN4 A;  1K5Q A;  2Y69 C;  1IUR A;  4DV7 B;  2WWW A;  4YIP A;  2H3O A;  4AQY O;  1HNW B;  2B1G A;  1K92 A;  3ABL B;  4PA9 A;  2DN9 A;  4PD4 F;  1PP9 H;  2XOK G;  3K08 A;  1GKF A;  3WB2 A;  3WG7 B;  4MSW C;  4CC5 A;  3OR6 C;  3FX7 A;  2E5L B;  4IT5 A;  2OT5 A;  4PHZ A;  1VF5 B;  2LFS A;  5IDJ A;  3B77 A;  1FFT B;  3CD6 V;  1R3I C;  2M6Y A;  1FFX A;  4JAA A;  5B3S C;  2GHY A;  3ASN B;  2VQE O;  1B3Q A;  2WLL B;  1NZ6 A;  2XTA A;  3OGC C;  3K58 A;  1WLE A;  2EZO A;  4H33 A;  4DUZ O;  2BOC C;  1YJW V;  5LGT A;  1HR0 O;  4JV5 B;  2ATK C;  3AG1 B;  3VQW A;  5DEC A;  1LR1 A;  1EN6 A;  4JYA B;  1SC5 B;  5KHK A;  3ZHS A;  4PA3 A;  3GWO A;  1SA0 A;  1DLB A;  2DYR B;  5DN6 G;  2FKX A;  2AZ0 A;  3ZRV A;  4JI4 B;  3VQY A;  2UUB B;  5CMU A;  5A2Q N;  2XAQ A;  3SR2 C;  5AG2 A;  4UVA A;  2AW9 A;  2UXC B;  1BL8 A;  1M90 W;  2ZM6 B;  5LMU B;  1K9M W;  3E8G A;  4RAI A;  3SYO A;  3NR7 A;  1Q86 W;  3KCX A;  3ZMZ A;  3FFQ A;  4BIO A;  3QO7 A;  1LNQ A;  1TVK B;  2GTA A;  3LDD A;  4UCO A;  4MS2 A;  1P84 F;  2ADP A;  2P67 A;  4CBC A;  2QEX V;  3M7M X;  3JAR B;  2IJJ A;  2UUB O;  1NI8 A;  2GSM B;  1FAF A;  2UXX A;  1IXB A;  3RYI A;  4AIL C;  1XMQ B;  2BTO A;  5L3G A;  2UU9 B;  3K5M A;  4MTF A;  2AGA A;  1YJN V;  2EIK C;  2DWE C;  3WG7 C;  3X2Q B;  1BMF G;  3ZRX A;  4LFB B;  4MT8 A;  4JYC A;  3UCS C;  3DC5 A;  2OCC C;  3G6B A;  2IH1 C;  2CK3 G;  1AP6 A;  2PY5 A;  5LP6 C;  4O2A A;  4F6R B;  1KC8 W;  4LP8 A;  1EFR G;  5LMN B;  1TGO A;  3GWK C;  5FPO A;  3N2K A;  2KKW A;  4ZIB A;  2HG5 C;  1N0J A;  1E79 G;  4MW3 A;  1PL4 A;  3AEI A;  4JAU A;  1XUQ A;  2D3O W;  1Q81 W;  2CTR A;  2HJD A;  3OE7 G;  3SDL A;  1IXM A;  4JI0 O;  2F4V B;  3ZHT A;  3EFF K;  3AG1 C;  3CCJ V;  4O4J B;  1VQ5 V;  4NYK A;  2QA4 V;  2KSD A;  5KHG A;  1HNX O;  3BRC A;  2PUS A;  4RUE A;  1I5Y A;  4X1I A;  4G27 B;  4UVB A;  1S76 D;  5ITZ B;  1NS1 A;  3FYE B;  1YIT V;  3B4S A;  3UT5 B;  3GB7 C;  4N23 A;  5B1A C;  1WNS A;  1QVF U;  5ITZ A;  4D6T H;  1FXH A;  4BIU A;  1FJG B;  1Y67 A;  3ETG A;  5KUM A;  2OWO A;  3CJH B;  4EB6 A;  3P32 A;  4RO2 A;  3JAK A;  4DUY B;  1GRJ A;  2LW7 A;  2AZ2 A;  4BIZ A;  1ZX3 A;  4GKK O;  1HP8 A;  1K97 A;  4UCV A;  1BZK A;  2RNB A;  4PEL A;  4TUY A;  4GT1 A;  4LH7 A;  1DK1 A;  4H37 A;  2GDS A;  3T1C A;  4DR3 O;  1E1Q G;  5GTH Z;  3CS5 A;  1QBZ A;  4DUY O;  1Q8I A;  2ZDI A;  4X65 O;  4FLZ A;  4LFC O;  1GH6 A;  4DV0 O;  1SRY A;  3ZMS A;  2R9R B;  3APQ A;  5EC2 C;  3MHH C;  4P30 A;  1W2B U;  1FXK A;  3T1H O;  3CCR V;  1I5X A;  2YIC A;  2EX3 A;  3UM7 A;  2LJ2 A;  3K9S A;  4DR1 O;  3JAW B;  3K3W A;  1RPO A;  1JQ0 A;  2X6C A;  3ZRW A;  1H2M A;  4MTG A;  4WFE A;  1AIL A;  3D36 A;  5BMV B;  4R8C A;  1R6K A;  4I0X B;  3W7T A;  4OPH A;  5BXZ A;  1XIL A;  4OPA A;  4FVM A;  4CH6 A;  5FLX N;  1KB9 F;  1EBO A;  3ABU A;  3BY6 A;  4DR7 B;  4Z1V A;  2Q8V A;  3HKB A;  4DV4 B;  2DOS A;  4LNU A;  2W0F C;  1B6Q A;  4EKW A; 
#chains in the Genus database with same CATH homology
 3B40 A;  1Y74 A;  1VF6 A;  1ZL8 A;  1Y76 B;  1RSO B;  1Y76 A;  1VF6 C;  1ZL8 B;  1Y74 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...