1Y76A

Solution structure of patj/pals1 l27 domain complex
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
62
structure length
62
Chain Sequence
NPAAEKMQVLQVLDRLRGKLQEKGDTTQNEKLSAFYETLKSPLFNQILTLQQSIKQLKGQLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords protein associated to tight junctions
publication title A unified assembly mode revealed by the structures of tetrameric L27 domain complexes formed by mLin-2/mLin-7 and Patj/Pals1 scaffold proteins.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein
total genus 23
structure length 62
sequence length 62
chains with identical sequence C
ec nomenclature
pdb deposition date 2004-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09045 L27_2 L27_2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.650 Mainly Alpha Orthogonal Bundle Helix Hairpins L27 domain 1y76A00
1ZL8B 1RSOB 1Y76B 1Y76A 1ZL8A 1VF6A 1Y74B 1Y74A 1VF6C 3B40A
chains in the Genus database with same CATH superfamily
2Q9LA 4FFKA 3E8FA 4WFHA 2JVDA 3D3QA 4P30A 4L87A 4JI5B 4DV0O 2F43G 4J7ZA 2P90A 4NYKA 5H6RA 4JI0B 1MA1A 2Q8VA 3D36A 4RUEA 2VWJA 3ETQA 1HNXO 1GM8A 4JI6O 4B3RO 1P84F 2E5LO 5HFMA 4GYCB 3BFRA 3LDCA 4JTCB 3QO5A 1P4RA 2BOBC 4AQYO 1XMQO 1WB8A 1AB3A 1KP2A 2GTSA 4MS2A 1AI7A 3O65A 5L3EA 2GDSA 1Q43A 2EIKB 1SA0B 1AJQA 4MVQA 4X64O 3U10A 3K08A 1K5SA 4I4TA 3DTUB 5KAIZ 4O4LA 2LGWA 2WPDG 2DW4A 4PI0A 4DR7O 1GKFA 1B6QA 4O4LB 1MSDA 1VF6C 4JTAB 4YJ3A 1K9MW 4JYBA 4UVBA 4B08A 4DW0A 1MNGA 2ZDIA 4YJ3B 2UUAO 4HBNA 3B8MA 2JEUA 1IXMA 3E83A 1ZAUA 3ZN0A 2DYSC 1JVMA 3TXSA 1BT8A 1BMFG 4U7OA 4A5UB 3CRRA 1ZL8A 4QJFB 3A0HZ 1JOYA 2ZNIA 2WWWA 3CMEV 1ZL8B 4CH4A 3LUTB 4YXWG 5GONA 4YHHO 3JD3A 4FIPC 4TV8A 4UCVA 2Q0AA 3B09A 1IDSA 1KB9F 3QO7A 1PL0A 5BR8B 1AP5A 1YEWA 1S76D 1N33B 1XBLA 1XEQA 1LR1A 1I94O 3OGCC 3WU2Z 3QTCA 5LGTA 3BABA 1JA8A 5LHGA 1SQBH 1IXBA 3ZEDA 4NXNO 1BSMA 2XOKG 4PA9A 4TT3G 5BXZA 4U7NA 1N32B 4I9QA 5IE9A 4I55A 3CYOA 4JPRA 2EIMC 1XNRB 1M56B 5KMGB 4I55B 4K8XA 2HP8A 4PDMA 5KX5A 3OR6C 2HLDG 1FXVA 3ZRWA 3VBBA 5KX5B 3T1YB 3ABUA 3ZMTA 2PI4A 1M90W 1Y4MA 1NU1H 3ZRWB 3ZHVA 3HKEA 1Q90D 5KHJA 4J7JA 3W7SA 4DV4B 1YF2A 1S5JA 4OX9B 4FLTA 2ZE5A 3CJHA 2YSUB 3SPGA 4X89A 1NT2B 4DV5O 4IL6Z 1E1QG 4ZBMA 2UXDO 1VQLV 1Q7YW 4DV6B 3CRCA 5KLVH 2PZSA 1Q81W 3HKCA 4MW3A 4X1IA 2QJ1A 1MG1A 3OW2U 3HKCB 4DV3B 3SPIA 2OTLV 2LFRA 4DO2A 4DR3B 1HNZO 4CS3A 1L8DA 1JQ0A 3ZHSA 2JJ1G 2WAMA 3E35A 2CUGA 3UCSC 3FB7C 3HPLC 2YC0A 3ZMUA 4GLXA 2N74A 1EZVH 4JI1O 4HZ3A 3ZHUA 4X88A 4BWAA 2UXBO 3G4SV 1VF6A 4DV0B 5LA6A 5LOVA 2Q6AA 5LL6Y 3K3WA 3HKDA 2NNUA 1L1FA 1Q8IA 4BIZA 1IBKB 4R6ZA 1R3KC 1M57C 1EN4A 4QE7A 4MVMA 4LFAO 2OCCC 2QWRB 3HKDB 4H0LB 5F2VO 3K5MA 3D3IA 2E5LB 1W2BU 2DWEC 1ZLZA 3DXRA 3FAVA 3ETGA 2IBZH 1PNLA 4YIOA 1FPOA 1XMQB 2R9RB 4X62B 1TVKB 3DXRB 1US6A 5GTIZ 1S77D 3FAVB 3OEHG 3BHPA 4LWSA 4O4HA 4JI2B 4QPKA 1VQMV 2PYLA 1ZSPA 2F66C 4LWSB 4O4HB 4GKKO 1Y66A 2Z3YA 1Y76A 3FYEB 2PGGA 4R7CA 2F1MA 3BA9A 2XTAA 3ZHQA 4LBEC 2QE7G 5J9PC 2Q69A 1FFTB 3F7VC 4FMTA 3ZMZA 4JV5O 2O57A 5A9GA 4EEQA 3JD2A 5CBGA 1PPJH 1QR9A 4DR7B 4PA6A 4JI7B 3M99B 1Z5WA 5KA5A 3A8TA 1H2KA 2Q5ZA 2DOSA 2UUAB 1GN2A 4FFBA 2IH1C 1N36O 2ZD9A 5JQGA 2XUMA 3F5WC 4CH3A 4FFBB 2EIMB 1ZWIC 4WFGA 5LBQA 5JQGB 3TCUA 2JDIG 1PP9H 1JPXA 3X2QC 1YJWV 1DGSA 4X20A 2XAGA 5IDJA 4DR2O 4LF8B 2X0LA 3AK2A 5DEDA 4I7ZB 2W6JG 4P9OA 2Y69C 1OCCC 4WBNA 1JMKC 1DF4A 1QQCA 3JAKA 4DUYO 4UFZA 3KZIZ 3OTOB 3KCXA 1FFXA 2WLLA 1BHBA 2ZINA 1B04A 2WLIA 1WNSA 2ZXWC 3SR2C 3CCEV 1FFXB 2QTOA 3E8BA 4G28B 2WLLB 1GM7A 4GCZA 3QNEA 2ZT9B 3N2GB 2JS5A 5H5NA 1PNKA 4PJ0Z 4X65O 2XT9A 1YJNV 4NXNB 2CH7B 4HNAA 3L70H 4NR1A 5K1XA 4MVSA 3RYCB 2M6YA 4JZGA 2BTOA 2EILC 4D7TA 5KHKA 1A32A 4HNAB 2QWOB 1KD1W 5D5QA 1JFFA 4PV1B 3BRCA 1CEZA 4XBFA 2YXYA 1ROPA 5FLXN 1ORQC 3ZJZA 3ZBHA 3T2MA 2FMLA 4I0XB 2GBOA 4J7KA 3T1CA 2YEVA 3CSXA 2LGQA 1VEWA 2RN9A 4J9ZB 4WFAV 3CD6V 1M57B 5JH7A 3OUSA 3CCLV 4DV5B 2OCCB 3I5DA 1BS3A 1Y67A 2EBOA 3CPWU 3K03A 4PA4A 5JH7B 2FYUH 3ZRSA 2WLMA 5JVDA 2P5OA 3CMAV 1DLBA 1QU7A 3TJTA 2YICA 2LJ2A 1R1BA 2AGAA 4DR5O 2D3OW 4TUYA 4UCUA 5JVDB 4F6EA 1HNZB 1F4MA 1WB7A 3SPJA 4ZIBA 4TUYB 4JI4B 1M5IA 4FM2A 1FKAO 1SZXA 3JSNA 3N2KA 3SYPA 1FXKC 4J9YB 1TGOA 4DK1A 1GN6A 1WAZA 4G27B 4EFBA 2ZE7A 3BVOA 3BAAA 5LYJB 1UJWB 2ATKC 2QKCA 2F23A 1NBMG 4X9QA 2CGNA 3C90A 4LFAB 5BR8O 2XAJA 2VQEO 4RQFA 2XAQA 2HHHB 1NJIW 4PHZA 2BTQB 1QR8A 4J80A 3J80N 3ICXA 1N33O 1ENVA 1S3JA 1KUQA 1BZKA 3JSLA 4YY3O 1JJ2U 1QBZA 4KHPB 4B7KA 4IIJA 5CB4A 3ABTA 2R70A 3WB2A 4TOIA 3X2QB 4PA3A 4GKKB 3H1LH 3SPCA 1FJGO 1N32O 3JATA 1O9GA 4JYCA 4CH6A 2WLHA 5CA1A 3VQWA 4ZHQB 4O2BA 2Y69B 3JATB 2WSSG 2EX3A 2XAHA 3LSUA 2ILMA 3H1HH 4O2BB 3CCJV 2CTRA 1K7DA 5EZYB 4PDLA 2ZXWB 3KCYA 3T1YO 4UCRA 3HKBA 3K59A 4LNUB 1G1XB 2H94A 2RMKB 3H1KH 4UCOA 1EN5A 2YDEA 4X1KB 4JYYA 4OX9O 4PI2A 5JJJB 2EILB 4FLUA 4DV6O 3ABKB 5E1AC 1YTFB 2ZIMA 1H8EG 3H1JH 4TWKA 2JGDA 4X66B 5IWAO 5B1AC 1URFA 2QWNB 4P9PA 4DV3O 4DR2B 5D5PA 2JGDB 4CZZA 3RGBA 1Q3EA 3OUFA 2ADPA 4NXMB 1SQXH 1DF5A 4DUYB 3CP1A 1F4NA 4GX0A 3SYAA 1NKDA 5KHHA 3E2EA 3O9OA 2B1IA 3T4DA 2OTJV 3QF7A 2PTMA 4X65B 3TETA 1IBKO 2XASA 1V9PA 4DR4B 2JEXA 4KL1A 2JGUA 1HW7A 3L75H 2GV9A 2ZR2A 4LC1A 3S3XA 3G6BA 1MOFA 4X62O 4B3SB 1VF7A 1FXKA 2CK3G 4BR6A 5BZBA 4G2KA 4BIUA 3BA8A 3RT3C 2ZM6O 1SS3A 2FKXA 4JI2O 5CN0A 3QVNA 4LFCO 4GX1A 1SA0A 1FXKB 4KFMA 2WLKA 1AROP 1H8HG 3G67A 2P7TC 3CCMV 4PDVA 4I5SA 2RQ6A 2HJDA 3EHBB 1SESA 1HP8A 3A0RA 3T1HB 1YXBA 4FLXA 1PL4A 1I08A 4PELA 1KU9A 3L73H 3IC9A 3ZRXA 4CH5A 1WPBA 3OMIB 4J42A 4LF5O 4ICGA 4JI7O 5KAFZ 1H2SB 1X59A 2X7RB 4DK0A 1RPRA 4DR5B 2L35A 5FNVA 5IYBO 4CS4A 2A9HA 5B1OA 5FNVB 4EFEA 2V7QG 1KP3A 4X1YA 1VQ9V 1BQZA 5BMVB 1NZ6A 2IJHA 3K9AA 3JCZA 5J2UB 4X1YB 4LF8O 1WN7A 3OT7A 3FB8C 3ZN1A 1G4YB 2KKWA 1SC5B 4BW5A 5KUMA 5CA3A 3C3SA 1FYJA 3ML0A 3ZHRA 2VQEB 3OTOO 2EZPA 1SQVH 4Q6GA 5EC1C 2AHYA 1GMGA 4B3TB 1H2NA 4UB6Z 3JD1A 3K06A 5CMUA 4YY3B 4UCTA 1J5EO 1PKXA 3CC4V 2CTWA 1Q6UA 4IT5A 1VMGA 5LP6C 2AXTZ 2IJIA 2VS0A 5JJNB 2Y0PA 4LFBB 1AR1B 5B1AB 3S3WA 1FJGB 2DYRC 1NTMH 5KMGA 4FK5C 3RYFA 4U3JB 1Y74B 1MABG 2OIEA 3GWKC 5J2TB 1I5YA 2UUBB 3RYFB 3AG1C 2OYQA 3EVKA 4H44B 5AG2A 2KB1A 4TV9A 1XQ8A 3IJ4A 4BW9A 3CXHF 2MW2B 2A7WA 4TV9B 4JI8B 1XILA 2QKAA 5LMNO 3K5LA 3PN1A 2JJ2G 4Z1VA 5BY1A 3TXQA 2MK3A 2QM7A 3GWOA 3JAWA 5H9CA 5E79Z 2Q73A 2DQ3A 4FJCC 5B5EZ 1XL4A 2Y4TA 3JAWB 1YDXA 2EINB 3OGIB 5IJ0B 4XDLA 2ZR3A 4AHCA 1WA8B 3UM7A 3K5NA 1EFRG 3F7YC 5IWAB 4W4KA 2B5UA 2Q7EA 1M93A 4WF9V 1JCHA 4JI4O 3RFRA 5K1PA 4DRXA 1F23A 3SJCC 1KKCA 2V4DA 5TISZ 5HFLA 4YIPA 4DUZO 4DRXB 1L0LH 3W7UA 1AVMA 5JJEB 2PYJA 1Q86W 3IAYA 1U97A 5EIBC 4KUMA 3UO3A 2EIJC 1BL8A 1QCEA 4MSWC 4JF3A 1O9HA 4OPHA 4LF6O 3E8HA 2QTSA 1SERA 1N34O 2JIZG 2FL4A 1TVKA 1D5AA 2HHHO 3FFQA 2GSMB 2WLJA 3E86A 3ZMVA 3CEIA 4JI3O 3LSSA 2Q7GA 2Y48A 4KHPO 4D6TH 2DMXA 2ZM6B 2BSKA 4GX5A 2LP7A 2A3QA 4LFCB 5LGUA 1QHTA 1IBMB 2BSKB 1QLEB 4MTGA 4JASA 3APQA 1HNWB 4R50A 4MTFA 2RCVA 1R73A 3JARB 3KG2A 4L8JA 4B3MB 3B4SA 1YTFD 3JD4A 5EBMC 2YIBD 3B40A 4H33A 1LUVA 4QGPA 4BAYA 4LF5B 5LP6A 4EB6B 2K9PA 5LP6B 5KHGA 2X6BA 1QVFU 2F95B 2G38A 1VQOV 3WG7C 4MVUA 3K9SA 1WP8A 5H2FZ 2DYRB 1XI1A 1NI8A 2K1EA 4C7UA 1NR1A 4OPAA 5L3GA 1MMMA 3CCUV 5C8YB 1JX9A 2GTAA 3AG1B 2AW9A 2IW5A 1SQFA 2UXNA 3OFNG 2R9IA 4I9WA 3OE7G 4X66O 1M4UA 2QGNA 5IYCO 1NTZH 1Q5OA 2KQXA 5DECA 1TUBA 3CHXA 1Q6IA 4Q20A 3K0GA 3B77A 1R6NA 4NXMO 1TUBB 2LW7A 3VQXA 5KHIA 4F6RA 5KA6A 5JWPA 3LDDA 4YJ2A 3N2GA 1YCIA 4F6RB 3STLC 3AK1A 5LXTB 4YJ2B 1HR0O 1J5EB 2CH7A 1MZFA 1SQGA 4ASUG 1IVSA 4E2LA 4XDKA 3RYCA 4OXSA 3CRMA 1R3LC 4CS2A 4DV2O 4DR6O 2DJVA 2X6CA 2ZNJA 3JAMN 4DR4O 3A2FA 4JTDB 1YSCA 2E3CA 3LNMB 2EJRA 1R3IC 1U96A 1I5XA 4J11A 1W59A 2B9ZA 3ABKC 4B3SO 3AG2C 2W6IG 5A2QN 4I0XA 1J95A 3STZC 3CRQA 4ZI7A 2WA4A 3B2EE 1ZUQA 3BCCH 4FM0A 2P06A 4GZRB 3DGEA 2GUZB 1UPGA 5LMNB 1WJZA 2QKSA 4ZOLB 2EIJB 4ZI7B 1XMOB 2E76B 4MTOA 3TK1A 4ZKIA 1I7FA 1OJHA 4IHJB 2M7WA 3T1HO 4LCUC 3MD0A 1GM9A 1NS1A 3SYCA 1ZTEA 4B7EA 3LSQA 1NQTA 4RWUA 2E74B 3CC2V 3EXAA 2A06H 2HG5C 1VQ4V 2YXLA 1K5QA 3ZRVA 3CC7V 3D8CA 4FPPA 3W7WA 3H01A 2R72A 4JAVA 2ZIOA 2PF4E 4DUZB 3OM3B 1GRJA 5LYJA 2AZ0A 1V55C 3R65A 3OMAB 2DE0X 3D36C 4Z2WA 3P32A 1H2MA 4GKJO 4LF6B 1XL6A 5B1NA 3CX5F 5H6QA 3ZX6A 2BTQA 3CWBH 3CB2A 2ZE8A 1N34B 3SJQC 3WG7B 2QDOA 2YS8A 5IT9N 4JI3B 4O4IA 4B3TO 4R8CA 2QSAA 2VRZA 5KUKA 1GAXA 4O4IB 4IYIA 3W7XA 1EBOA 3RYIA 4RQEA 1SF9A 4LFBO 4ZHQA 1RM1B 2OIGA 3UQ8A 1VQ7V 2JK5C 3RYIB 1EN6A 1NH2B 2ZKOA 1YHQV 2XAFA 5L3DA 3VOUA 1VQPV 2UUBO 5EZYA 2EJ7A 1MSWD 1V54C 3OD4A 5B66Z 1NVPB 3G80A 1K3EA 1YI2V 4LNUA 2HKOA 4JI8O 2XHBA 1OCZB 1KECA 4X1KA 5JCOC 1OCOC 3E22B 2Z0AA 2N05A 4ABMA 1HWYA 5EYPB 1NTKH 4I50B 1XHXA 2OT5A 3WFVA 3OTFA 1SETA 1IZ3A 2YIBA 3CCRV 2QM8A 1RFYA 2H3OA 2RNBA 4JAUA 4DV1O 3AG2B 4LR3A 2CGOA 1I0HA 3MHSC 1XNQB 3ZIAG 1WP7A 1YITV 4PD4F 5CBHA 1FS0G 3AK3A 4N23A 3U11A 2P4KA 1T5EA 4RUFA 3C3TA 1KKDA 4K8ZA 4MVRA 4LF4B 3K58A 2Q4PA 1CP9A 3RWRD 1HR0B 3DSQA 2HJFC 3NXSA 1DK1A 4DV2B 4DR6B 2W0XA 1K4DC 2IU0A 4UXNA 2ZQMA 3CCSV 2EZOA 2IH3C 5C93A 2AHZA 4AILC 1GO3F 5L3FA 3JYCA 4BIOA 1SQQH 5CA0A 2EINC 4QIWF 3DC5A 3K57A 2Z5UA 4KXRA 4UUJC 2F4VO 2F93B 5DM6V 4JZ2A 1SQPH 5CA0B 1BQ0A 1P7GA 2YIAA 3BY6A 1AR4A 4O2AA 1IBMO 1EM1A 4LP8A 4NVPA 2ADQB 3BEHA 1V55B 2X6AA 2JS3A 2AZ2A 1R6KA 4O2AB 4FLVA 1HNWO 2KG7A 4KP4A 4LH7A 2ZCEA 3T4ZA 2UUCO 4B3MO 1NR7A 2Q0OC 4XDJA 1PNMA 4HAMA 2FB5A 2KG7B 1K97A 3LNNA 5LMUB 1GN4A 3H1IH 4QPJA 3UT5A 2PI5A 3PJSK 3ZMSA 3CCQV 2LW1A 3Q4HA 3UT5B 4WFFA 2BOCC 3L9DA 4I4TB 3Q4HB 4MT8A 4H13B 2W0FC 4FZ1A 5BMVA 1VF5B 4FLWA 5J2UA 3N27A 2CE4A 5B1BC 3QO8A 3RVZA 5EC2C 1V54B 5JCOA 4FLZA 1QLEC 1Q82W 1K33A 1OCOB 4GKJB 2B1GA 3K04A 3J7AU 2QM4A 4U3FH 2GHYA 3AG4C 1AP6A 3ETDA 3CE2A 1OCRC 2P67A 1XHZA 5B3SC 5CBFA 2DN9A 5EIBD 5GONB 4PA7A 4GT1A 1JJOA 4U3JA 1Y74A 4TV8B 4UB8Z 1G8MA 4J41A 5J2TA 1YJ9V 2UXCB 3SJAC 1E79G 1VQ6V 1YIJV 3RBZA 2HVKC 1H2LA 3P30A 3RVYA 1W0KG 3A0BZ 2DWDC 3K0DA 2Q68A 3E89A 4EKWA 2UU9O 1K8AW 1XMOO 1WLEA 1BHAA 3L74H 2YUAA 3P3PA 3NR7A 5IJ0A 3JD0A 4K3AA 4IGGA 1WA8A 3K5OA 4DV1B 3APOA 3ASNC 3ABLC 1K34A 4TQFA 4E4EA 1Z5VA 2YIDA 3ABMC 3HKEB 1VQKV 4DXWA 4LF9B 1IBLB 4LF7O 1EZJA 3CJHB 1DTOA 1HDJA 4WCEV 1VIBA 3CXCU 5IYDO 4MTXA 4K35A 3SYQA 3K79A 3M7MX 1FXHA 1QNMA 1CPYA 1X4TA 4X1IB 1S72V 1AJNA 1L0NH 4H37A 2D2CB 1NH2D 3E8GA 2A0LA 3FD9A 3OAAG 5IYZA 3RW0A 3TGUH 2LFSA 3KKYA 1VARA 2RDCA 4UVAA 5IYZB 1IX9A 1YVWA 2CDYA 2IJJA 1NVPD 3MAQA 2P4VA 3IGAC 2F4VB 3R66A 4UV8A 2CTPA 3VQVA 1AR5A 4FM1A 5GTHZ 4DYLA 2CTQA 5B1BB 4MVZA 3WB1A 5LA6B 5LOVB 5FL7G 2FTKA 2YI9A 1PM9A 4JI6B 1HNXB 4B3RB 1P7BA 4GUNA 2A79B 3JARA 4IYHA 1BCCH 2DYSB 4AQYB 4CC5A 2QWPB 1KMIZ 2YXHA 2UUCB 1KYOF 3ZHTA 1BE3H 3FYIB 2BE3A 4TSFG 1XUQA 1AI6A 3AG4B 4CBCA 3HB3B 1H2GA 4EB6A 4F4LA 3IC7A 2V1DA 3MDSA 2IM9A 2ODMA 1OCRB 3H9VA 3SDLA 4NTYA 1KQSU 4X64B 5B3SB 2KSDA 1N0JA 2VQFO 1AILA 1Y76B 1TAEA 1RPOA 2PY5A 4Z1MG 5LHIA 1GK9A 3GB7C 4DV7O 1TUEB 4J10A 4MW8A 3CRAA 5C8YA 1JR9A 3RN4A 3ETEA 3GVMA 3EFFK 1OZ0A 3THOA 4DW1A 1YZBA 2WA3A 4HYOA 4N21A 1LNQA 2N04A 3SGIA 3G6EV 5IY5C 1RM1C 4RAIA 4FZ0A 1XNQO 5DN6G 3FB5C 3FX7A 4JYAO 4LH6A 2BCCH 1THZA 4UV9A 1GH6A 2DQ0A 5LXTA 2QR4A 4FLYA 2Q67A 1XREA 1N4CA 2C2AA 4LF4O 3LDEA 1OCZC 3ASOC 1SZTA 3I55V 4YHHB 1WPXA 5L3CA 4X20B 4K0KO 4DR1O 3MHHC 3ASNB 3JASA 3ABLB 4X8AA 2OCHA 1B06A 3ABMB 4WBNB 3JASB 5LGNA 3JAKB 3UO2A 1M1KW 4FVMA 1I94B 2QWQB 4CC6A 4JI5O 1BGYH 1P49A 1F51A 1PV0A 2WLIB 3SYOA 3VQYA 3BPZA 4NB5A 2ARHA 5IJ9A 1XOUA 5FPOA 2GUZA 3IFXA 4JI0O 1RSOA 1QVGU 4ZOLA 2HFEC 2WLNA 4IHJA 5IJ9B 4NKGB 2Y0IA 2UU9B 1RSOB 3FKSG 3L72H 3ZCCA 5FPRA 3OEEG 5EK0A 1KC8W 2QEXV 1R3JC 3DC6A 2XNDG 3AG3C 2ITDC 3CS5A 1VP7A 2HVJC 1JFFB 4D7SA 1XDCA 1F7YA 1MZEA 1D5NA 3JCUZ 2Q7HA 1D2DA 1GTOA 1R6TA 5LMUO 3L71H 2HR3A 1Q6HA 1RP3B 1COWG 2YEVB 4W4LA 1VQ5V 4LF7B 3F5TA 2UXDB 1VQ8V 3QG5A 2LQTA 2LO1A 3OR7C 4WFEA 1PD3A 1E1RG 3CCVV 1H38A 2IU3A 3SPHA 5L3BA 4NTXA 3AG7A 1AJPA 2YI8A 2P22C 4O4JA 1UFIA 4JI1B 2UXBB 4NTWA 4O4JB 3N2KB 2EIKC 4WFBV 2QA4V 2H8PC 3SJBC 5EBLC 3P3NA 5IY5B 1VQNV 2HEPA 2UXCO 3I56V 2CAZC 3RYHA 1K92A 2OWOA 1AI5A 1AI4A 4OGQB 3RYHB 4AI8A 2PUSA 5ITZA 1K4CC 1Y6XA 3E22A 1OV9A 4IIJB 3J81N 5ITZB 1FAFA 5CB4B 3ASOB 4JGSA 2ZDIC 2RJZA 2NR5A 4QE9A 1XNRO 2NN4A 5EYPA 2VQFB 2ZE6A 4I50A 1OCCB 3WB0A 1QLNA 5CA1B 1G6UA 1OHHG 4GX2A 2ITCC 1ZX3A 3B8NA 4JV5B 1KBHA 4DV7B 1LUWA 1FD9A 1CXZB 2P6JA 2E75B 2IJKA 2UXXA 3M8AA 1S0VA 4UVCA 1N8RW 1TA8A 5EBWC 2R9AA 3HKBB 4JAAA 1S5HC 4DV4O 1W0JG 2VWKA 3ZS8C 4LF9O 2JRIA 1IBLO 1N36B 3OMNB 1S5LZ 4MVOA 1IURA 1N0NA 4JYAB 5LHHA 3UKMA 1M9NA 3HR0A 3U0ZA 3AG3B 5GW7A 1Z2GA 2EULA 4TQDA 4UCSA 2Y4UA 3W7TA 4DR3O 1SKVA 1SRYA 2L6LA 4PDRA 4P2ZA 3G71V 4K0KB 3JALA 4DR1B 1M56C 1GN3A 2NLJC 4QNHB 1B3QA 2ETNA 1K73W 3FB6C 4RO2A 3JALB 3AEIA
chains in the Genus database with same CATH topology
1ZL8B 1RSOB 1Y76B 1Y76A 1ZL8A 1VF6A 1Y74B 1Y74A 1VF6C 3B40A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZL8 B;  1RSO B;  1Y76 B;  1Y76 A;  1ZL8 A;  1VF6 A;  1Y74 B;  1Y74 A;  1VF6 C;  3B40 A; 
#chains in the Genus database with same CATH topology
 2Q9L A;  4FFK A;  3E8F A;  4WFH A;  2JVD A;  3D3Q A;  4P30 A;  4L87 A;  4JI5 B;  4DV0 O;  2F43 G;  4J7Z A;  2P90 A;  4NYK A;  5H6R A;  4JI0 B;  1MA1 A;  2Q8V A;  3D36 A;  4RUE A;  2VWJ A;  3ETQ A;  1HNX O;  1GM8 A;  4JI6 O;  4B3R O;  1P84 F;  2E5L O;  5HFM A;  4GYC B;  3BFR A;  3LDC A;  4JTC B;  3QO5 A;  1P4R A;  2BOB C;  4AQY O;  1XMQ O;  1WB8 A;  1AB3 A;  1KP2 A;  2GTS A;  4MS2 A;  1AI7 A;  3O65 A;  5L3E A;  2GDS A;  1Q43 A;  2EIK B;  1SA0 B;  1AJQ A;  4MVQ A;  4X64 O;  3U10 A;  3K08 A;  1K5S A;  4I4T A;  3DTU B;  5KAI Z;  4O4L A;  2LGW A;  2WPD G;  2DW4 A;  4PI0 A;  4DR7 O;  1GKF A;  1B6Q A;  4O4L B;  1MSD A;  1VF6 C;  4JTA B;  4YJ3 A;  1K9M W;  4JYB A;  4UVB A;  4B08 A;  4DW0 A;  1MNG A;  2ZDI A;  4YJ3 B;  2UUA O;  4HBN A;  3B8M A;  2JEU A;  1IXM A;  3E83 A;  1ZAU A;  3ZN0 A;  2DYS C;  1JVM A;  3TXS A;  1BT8 A;  1BMF G;  4U7O A;  4A5U B;  3CRR A;  1ZL8 A;  4QJF B;  3A0H Z;  1JOY A;  2ZNI A;  2WWW A;  3CME V;  1ZL8 B;  4CH4 A;  3LUT B;  4YXW G;  5GON A;  4YHH O;  3JD3 A;  4FIP C;  4TV8 A;  4UCV A;  2Q0A A;  3B09 A;  1IDS A;  1KB9 F;  3QO7 A;  1PL0 A;  5BR8 B;  1AP5 A;  1YEW A;  1S76 D;  1N33 B;  1XBL A;  1XEQ A;  1LR1 A;  1I94 O;  3OGC C;  3WU2 Z;  3QTC A;  5LGT A;  3BAB A;  1JA8 A;  5LHG A;  1SQB H;  1IXB A;  3ZED A;  4NXN O;  1BSM A;  2XOK G;  4PA9 A;  4TT3 G;  5BXZ A;  4U7N A;  1N32 B;  4I9Q A;  5IE9 A;  4I55 A;  3CYO A;  4JPR A;  2EIM C;  1XNR B;  1M56 B;  5KMG B;  4I55 B;  4K8X A;  2HP8 A;  4PDM A;  5KX5 A;  3OR6 C;  2HLD G;  1FXV A;  3ZRW A;  3VBB A;  5KX5 B;  3T1Y B;  3ABU A;  3ZMT A;  2PI4 A;  1M90 W;  1Y4M A;  1NU1 H;  3ZRW B;  3ZHV A;  3HKE A;  1Q90 D;  5KHJ A;  4J7J A;  3W7S A;  4DV4 B;  1YF2 A;  1S5J A;  4OX9 B;  4FLT A;  2ZE5 A;  3CJH A;  2YSU B;  3SPG A;  4X89 A;  1NT2 B;  4DV5 O;  4IL6 Z;  1E1Q G;  4ZBM A;  2UXD O;  1VQL V;  1Q7Y W;  4DV6 B;  3CRC A;  5KLV H;  2PZS A;  1Q81 W;  3HKC A;  4MW3 A;  4X1I A;  2QJ1 A;  1MG1 A;  3OW2 U;  3HKC B;  4DV3 B;  3SPI A;  2OTL V;  2LFR A;  4DO2 A;  4DR3 B;  1HNZ O;  4CS3 A;  1L8D A;  1JQ0 A;  3ZHS A;  2JJ1 G;  2WAM A;  3E35 A;  2CUG A;  3UCS C;  3FB7 C;  3HPL C;  2YC0 A;  3ZMU A;  4GLX A;  2N74 A;  1EZV H;  4JI1 O;  4HZ3 A;  3ZHU A;  4X88 A;  4BWA A;  2UXB O;  3G4S V;  1VF6 A;  4DV0 B;  5LA6 A;  5LOV A;  2Q6A A;  5LL6 Y;  3K3W A;  3HKD A;  2NNU A;  1L1F A;  1Q8I A;  4BIZ A;  1IBK B;  4R6Z A;  1R3K C;  1M57 C;  1EN4 A;  4QE7 A;  4MVM A;  4LFA O;  2OCC C;  2QWR B;  3HKD B;  4H0L B;  5F2V O;  3K5M A;  3D3I A;  2E5L B;  1W2B U;  2DWE C;  1ZLZ A;  3DXR A;  3FAV A;  3ETG A;  2IBZ H;  1PNL A;  4YIO A;  1FPO A;  1XMQ B;  2R9R B;  4X62 B;  1TVK B;  3DXR B;  1US6 A;  5GTI Z;  1S77 D;  3FAV B;  3OEH G;  3BHP A;  4LWS A;  4O4H A;  4JI2 B;  4QPK A;  1VQM V;  2PYL A;  1ZSP A;  2F66 C;  4LWS B;  4O4H B;  4GKK O;  1Y66 A;  2Z3Y A;  1Y76 A;  3FYE B;  2PGG A;  4R7C A;  2F1M A;  3BA9 A;  2XTA A;  3ZHQ A;  4LBE C;  2QE7 G;  5J9P C;  2Q69 A;  1FFT B;  3F7V C;  4FMT A;  3ZMZ A;  4JV5 O;  2O57 A;  5A9G A;  4EEQ A;  3JD2 A;  5CBG A;  1PPJ H;  1QR9 A;  4DR7 B;  4PA6 A;  4JI7 B;  3M99 B;  1Z5W A;  5KA5 A;  3A8T A;  1H2K A;  2Q5Z A;  2DOS A;  2UUA B;  1GN2 A;  4FFB A;  2IH1 C;  1N36 O;  2ZD9 A;  5JQG A;  2XUM A;  3F5W C;  4CH3 A;  4FFB B;  2EIM B;  1ZWI C;  4WFG A;  5LBQ A;  5JQG B;  3TCU A;  2JDI G;  1PP9 H;  1JPX A;  3X2Q C;  1YJW V;  1DGS A;  4X20 A;  2XAG A;  5IDJ A;  4DR2 O;  4LF8 B;  2X0L A;  3AK2 A;  5DED A;  4I7Z B;  2W6J G;  4P9O A;  2Y69 C;  1OCC C;  4WBN A;  1JMK C;  1DF4 A;  1QQC A;  3JAK A;  4DUY O;  4UFZ A;  3KZI Z;  3OTO B;  3KCX A;  1FFX A;  2WLL A;  1BHB A;  2ZIN A;  1B04 A;  2WLI A;  1WNS A;  2ZXW C;  3SR2 C;  3CCE V;  1FFX B;  2QTO A;  3E8B A;  4G28 B;  2WLL B;  1GM7 A;  4GCZ A;  3QNE A;  2ZT9 B;  3N2G B;  2JS5 A;  5H5N A;  1PNK A;  4PJ0 Z;  4X65 O;  2XT9 A;  1YJN V;  4NXN B;  2CH7 B;  4HNA A;  3L70 H;  4NR1 A;  5K1X A;  4MVS A;  3RYC B;  2M6Y A;  4JZG A;  2BTO A;  2EIL C;  4D7T A;  5KHK A;  1A32 A;  4HNA B;  2QWO B;  1KD1 W;  5D5Q A;  1JFF A;  4PV1 B;  3BRC A;  1CEZ A;  4XBF A;  2YXY A;  1ROP A;  5FLX N;  1ORQ C;  3ZJZ A;  3ZBH A;  3T2M A;  2FML A;  4I0X B;  2GBO A;  4J7K A;  3T1C A;  2YEV A;  3CSX A;  2LGQ A;  1VEW A;  2RN9 A;  4J9Z B;  4WFA V;  3CD6 V;  1M57 B;  5JH7 A;  3OUS A;  3CCL V;  4DV5 B;  2OCC B;  3I5D A;  1BS3 A;  1Y67 A;  2EBO A;  3CPW U;  3K03 A;  4PA4 A;  5JH7 B;  2FYU H;  3ZRS A;  2WLM A;  5JVD A;  2P5O A;  3CMA V;  1DLB A;  1QU7 A;  3TJT A;  2YIC A;  2LJ2 A;  1R1B A;  2AGA A;  4DR5 O;  2D3O W;  4TUY A;  4UCU A;  5JVD B;  4F6E A;  1HNZ B;  1F4M A;  1WB7 A;  3SPJ A;  4ZIB A;  4TUY B;  4JI4 B;  1M5I A;  4FM2 A;  1FKA O;  1SZX A;  3JSN A;  3N2K A;  3SYP A;  1FXK C;  4J9Y B;  1TGO A;  4DK1 A;  1GN6 A;  1WAZ A;  4G27 B;  4EFB A;  2ZE7 A;  3BVO A;  3BAA A;  5LYJ B;  1UJW B;  2ATK C;  2QKC A;  2F23 A;  1NBM G;  4X9Q A;  2CGN A;  3C90 A;  4LFA B;  5BR8 O;  2XAJ A;  2VQE O;  4RQF A;  2XAQ A;  2HHH B;  1NJI W;  4PHZ A;  2BTQ B;  1QR8 A;  4J80 A;  3J80 N;  3ICX A;  1N33 O;  1ENV A;  1S3J A;  1KUQ A;  1BZK A;  3JSL A;  4YY3 O;  1JJ2 U;  1QBZ A;  4KHP B;  4B7K A;  4IIJ A;  5CB4 A;  3ABT A;  2R70 A;  3WB2 A;  4TOI A;  3X2Q B;  4PA3 A;  4GKK B;  3H1L H;  3SPC A;  1FJG O;  1N32 O;  3JAT A;  1O9G A;  4JYC A;  4CH6 A;  2WLH A;  5CA1 A;  3VQW A;  4ZHQ B;  4O2B A;  2Y69 B;  3JAT B;  2WSS G;  2EX3 A;  2XAH A;  3LSU A;  2ILM A;  3H1H H;  4O2B B;  3CCJ V;  2CTR A;  1K7D A;  5EZY B;  4PDL A;  2ZXW B;  3KCY A;  3T1Y O;  4UCR A;  3HKB A;  3K59 A;  4LNU B;  1G1X B;  2H94 A;  2RMK B;  3H1K H;  4UCO A;  1EN5 A;  2YDE A;  4X1K B;  4JYY A;  4OX9 O;  4PI2 A;  5JJJ B;  2EIL B;  4FLU A;  4DV6 O;  3ABK B;  5E1A C;  1YTF B;  2ZIM A;  1H8E G;  3H1J H;  4TWK A;  2JGD A;  4X66 B;  5IWA O;  5B1A C;  1URF A;  2QWN B;  4P9P A;  4DV3 O;  4DR2 B;  5D5P A;  2JGD B;  4CZZ A;  3RGB A;  1Q3E A;  3OUF A;  2ADP A;  4NXM B;  1SQX H;  1DF5 A;  4DUY B;  3CP1 A;  1F4N A;  4GX0 A;  3SYA A;  1NKD A;  5KHH A;  3E2E A;  3O9O A;  2B1I A;  3T4D A;  2OTJ V;  3QF7 A;  2PTM A;  4X65 B;  3TET A;  1IBK O;  2XAS A;  1V9P A;  4DR4 B;  2JEX A;  4KL1 A;  2JGU A;  1HW7 A;  3L75 H;  2GV9 A;  2ZR2 A;  4LC1 A;  3S3X A;  3G6B A;  1MOF A;  4X62 O;  4B3S B;  1VF7 A;  1FXK A;  2CK3 G;  4BR6 A;  5BZB A;  4G2K A;  4BIU A;  3BA8 A;  3RT3 C;  2ZM6 O;  1SS3 A;  2FKX A;  4JI2 O;  5CN0 A;  3QVN A;  4LFC O;  4GX1 A;  1SA0 A;  1FXK B;  4KFM A;  2WLK A;  1ARO P;  1H8H G;  3G67 A;  2P7T C;  3CCM V;  4PDV A;  4I5S A;  2RQ6 A;  2HJD A;  3EHB B;  1SES A;  1HP8 A;  3A0R A;  3T1H B;  1YXB A;  4FLX A;  1PL4 A;  1I08 A;  4PEL A;  1KU9 A;  3L73 H;  3IC9 A;  3ZRX A;  4CH5 A;  1WPB A;  3OMI B;  4J42 A;  4LF5 O;  4ICG A;  4JI7 O;  5KAF Z;  1H2S B;  1X59 A;  2X7R B;  4DK0 A;  1RPR A;  4DR5 B;  2L35 A;  5FNV A;  5IYB O;  4CS4 A;  2A9H A;  5B1O A;  5FNV B;  4EFE A;  2V7Q G;  1KP3 A;  4X1Y A;  1VQ9 V;  1BQZ A;  5BMV B;  1NZ6 A;  2IJH A;  3K9A A;  3JCZ A;  5J2U B;  4X1Y B;  4LF8 O;  1WN7 A;  3OT7 A;  3FB8 C;  3ZN1 A;  1G4Y B;  2KKW A;  1SC5 B;  4BW5 A;  5KUM A;  5CA3 A;  3C3S A;  1FYJ A;  3ML0 A;  3ZHR A;  2VQE B;  3OTO O;  2EZP A;  1SQV H;  4Q6G A;  5EC1 C;  2AHY A;  1GMG A;  4B3T B;  1H2N A;  4UB6 Z;  3JD1 A;  3K06 A;  5CMU A;  4YY3 B;  4UCT A;  1J5E O;  1PKX A;  3CC4 V;  2CTW A;  1Q6U A;  4IT5 A;  1VMG A;  5LP6 C;  2AXT Z;  2IJI A;  2VS0 A;  5JJN B;  2Y0P A;  4LFB B;  1AR1 B;  5B1A B;  3S3W A;  1FJG B;  2DYR C;  1NTM H;  5KMG A;  4FK5 C;  3RYF A;  4U3J B;  1Y74 B;  1MAB G;  2OIE A;  3GWK C;  5J2T B;  1I5Y A;  2UUB B;  3RYF B;  3AG1 C;  2OYQ A;  3EVK A;  4H44 B;  5AG2 A;  2KB1 A;  4TV9 A;  1XQ8 A;  3IJ4 A;  4BW9 A;  3CXH F;  2MW2 B;  2A7W A;  4TV9 B;  4JI8 B;  1XIL A;  2QKA A;  5LMN O;  3K5L A;  3PN1 A;  2JJ2 G;  4Z1V A;  5BY1 A;  3TXQ A;  2MK3 A;  2QM7 A;  3GWO A;  3JAW A;  5H9C A;  5E79 Z;  2Q73 A;  2DQ3 A;  4FJC C;  5B5E Z;  1XL4 A;  2Y4T A;  3JAW B;  1YDX A;  2EIN B;  3OGI B;  5IJ0 B;  4XDL A;  2ZR3 A;  4AHC A;  1WA8 B;  3UM7 A;  3K5N A;  1EFR G;  3F7Y C;  5IWA B;  4W4K A;  2B5U A;  2Q7E A;  1M93 A;  4WF9 V;  1JCH A;  4JI4 O;  3RFR A;  5K1P A;  4DRX A;  1F23 A;  3SJC C;  1KKC A;  2V4D A;  5TIS Z;  5HFL A;  4YIP A;  4DUZ O;  4DRX B;  1L0L H;  3W7U A;  1AVM A;  5JJE B;  2PYJ A;  1Q86 W;  3IAY A;  1U97 A;  5EIB C;  4KUM A;  3UO3 A;  2EIJ C;  1BL8 A;  1QCE A;  4MSW C;  4JF3 A;  1O9H A;  4OPH A;  4LF6 O;  3E8H A;  2QTS A;  1SER A;  1N34 O;  2JIZ G;  2FL4 A;  1TVK A;  1D5A A;  2HHH O;  3FFQ A;  2GSM B;  2WLJ A;  3E86 A;  3ZMV A;  3CEI A;  4JI3 O;  3LSS A;  2Q7G A;  2Y48 A;  4KHP O;  4D6T H;  2DMX A;  2ZM6 B;  2BSK A;  4GX5 A;  2LP7 A;  2A3Q A;  4LFC B;  5LGU A;  1QHT A;  1IBM B;  2BSK B;  1QLE B;  4MTG A;  4JAS A;  3APQ A;  1HNW B;  4R50 A;  4MTF A;  2RCV A;  1R73 A;  3JAR B;  3KG2 A;  4L8J A;  4B3M B;  3B4S A;  1YTF D;  3JD4 A;  5EBM C;  2YIB D;  3B40 A;  4H33 A;  1LUV A;  4QGP A;  4BAY A;  4LF5 B;  5LP6 A;  4EB6 B;  2K9P A;  5LP6 B;  5KHG A;  2X6B A;  1QVF U;  2F95 B;  2G38 A;  1VQO V;  3WG7 C;  4MVU A;  3K9S A;  1WP8 A;  5H2F Z;  2DYR B;  1XI1 A;  1NI8 A;  2K1E A;  4C7U A;  1NR1 A;  4OPA A;  5L3G A;  1MMM A;  3CCU V;  5C8Y B;  1JX9 A;  2GTA A;  3AG1 B;  2AW9 A;  2IW5 A;  1SQF A;  2UXN A;  3OFN G;  2R9I A;  4I9W A;  3OE7 G;  4X66 O;  1M4U A;  2QGN A;  5IYC O;  1NTZ H;  1Q5O A;  2KQX A;  5DEC A;  1TUB A;  3CHX A;  1Q6I A;  4Q20 A;  3K0G A;  3B77 A;  1R6N A;  4NXM O;  1TUB B;  2LW7 A;  3VQX A;  5KHI A;  4F6R A;  5KA6 A;  5JWP A;  3LDD A;  4YJ2 A;  3N2G A;  1YCI A;  4F6R B;  3STL C;  3AK1 A;  5LXT B;  4YJ2 B;  1HR0 O;  1J5E B;  2CH7 A;  1MZF A;  1SQG A;  4ASU G;  1IVS A;  4E2L A;  4XDK A;  3RYC A;  4OXS A;  3CRM A;  1R3L C;  4CS2 A;  4DV2 O;  4DR6 O;  2DJV A;  2X6C A;  2ZNJ A;  3JAM N;  4DR4 O;  3A2F A;  4JTD B;  1YSC A;  2E3C A;  3LNM B;  2EJR A;  1R3I C;  1U96 A;  1I5X A;  4J11 A;  1W59 A;  2B9Z A;  3ABK C;  4B3S O;  3AG2 C;  2W6I G;  5A2Q N;  4I0X A;  1J95 A;  3STZ C;  3CRQ A;  4ZI7 A;  2WA4 A;  3B2E E;  1ZUQ A;  3BCC H;  4FM0 A;  2P06 A;  4GZR B;  3DGE A;  2GUZ B;  1UPG A;  5LMN B;  1WJZ A;  2QKS A;  4ZOL B;  2EIJ B;  4ZI7 B;  1XMO B;  2E76 B;  4MTO A;  3TK1 A;  4ZKI A;  1I7F A;  1OJH A;  4IHJ B;  2M7W A;  3T1H O;  4LCU C;  3MD0 A;  1GM9 A;  1NS1 A;  3SYC A;  1ZTE A;  4B7E A;  3LSQ A;  1NQT A;  4RWU A;  2E74 B;  3CC2 V;  3EXA A;  2A06 H;  2HG5 C;  1VQ4 V;  2YXL A;  1K5Q A;  3ZRV A;  3CC7 V;  3D8C A;  4FPP A;  3W7W A;  3H01 A;  2R72 A;  4JAV A;  2ZIO A;  2PF4 E;  4DUZ B;  3OM3 B;  1GRJ A;  5LYJ A;  2AZ0 A;  1V55 C;  3R65 A;  3OMA B;  2DE0 X;  3D36 C;  4Z2W A;  3P32 A;  1H2M A;  4GKJ O;  4LF6 B;  1XL6 A;  5B1N A;  3CX5 F;  5H6Q A;  3ZX6 A;  2BTQ A;  3CWB H;  3CB2 A;  2ZE8 A;  1N34 B;  3SJQ C;  3WG7 B;  2QDO A;  2YS8 A;  5IT9 N;  4JI3 B;  4O4I A;  4B3T O;  4R8C A;  2QSA A;  2VRZ A;  5KUK A;  1GAX A;  4O4I B;  4IYI A;  3W7X A;  1EBO A;  3RYI A;  4RQE A;  1SF9 A;  4LFB O;  4ZHQ A;  1RM1 B;  2OIG A;  3UQ8 A;  1VQ7 V;  2JK5 C;  3RYI B;  1EN6 A;  1NH2 B;  2ZKO A;  1YHQ V;  2XAF A;  5L3D A;  3VOU A;  1VQP V;  2UUB O;  5EZY A;  2EJ7 A;  1MSW D;  1V54 C;  3OD4 A;  5B66 Z;  1NVP B;  3G80 A;  1K3E A;  1YI2 V;  4LNU A;  2HKO A;  4JI8 O;  2XHB A;  1OCZ B;  1KEC A;  4X1K A;  5JCO C;  1OCO C;  3E22 B;  2Z0A A;  2N05 A;  4ABM A;  1HWY A;  5EYP B;  1NTK H;  4I50 B;  1XHX A;  2OT5 A;  3WFV A;  3OTF A;  1SET A;  1IZ3 A;  2YIB A;  3CCR V;  2QM8 A;  1RFY A;  2H3O A;  2RNB A;  4JAU A;  4DV1 O;  3AG2 B;  4LR3 A;  2CGO A;  1I0H A;  3MHS C;  1XNQ B;  3ZIA G;  1WP7 A;  1YIT V;  4PD4 F;  5CBH A;  1FS0 G;  3AK3 A;  4N23 A;  3U11 A;  2P4K A;  1T5E A;  4RUF A;  3C3T A;  1KKD A;  4K8Z A;  4MVR A;  4LF4 B;  3K58 A;  2Q4P A;  1CP9 A;  3RWR D;  1HR0 B;  3DSQ A;  2HJF C;  3NXS A;  1DK1 A;  4DV2 B;  4DR6 B;  2W0X A;  1K4D C;  2IU0 A;  4UXN A;  2ZQM A;  3CCS V;  2EZO A;  2IH3 C;  5C93 A;  2AHZ A;  4AIL C;  1GO3 F;  5L3F A;  3JYC A;  4BIO A;  1SQQ H;  5CA0 A;  2EIN C;  4QIW F;  3DC5 A;  3K57 A;  2Z5U A;  4KXR A;  4UUJ C;  2F4V O;  2F93 B;  5DM6 V;  4JZ2 A;  1SQP H;  5CA0 B;  1BQ0 A;  1P7G A;  2YIA A;  3BY6 A;  1AR4 A;  4O2A A;  1IBM O;  1EM1 A;  4LP8 A;  4NVP A;  2ADQ B;  3BEH A;  1V55 B;  2X6A A;  2JS3 A;  2AZ2 A;  1R6K A;  4O2A B;  4FLV A;  1HNW O;  2KG7 A;  4KP4 A;  4LH7 A;  2ZCE A;  3T4Z A;  2UUC O;  4B3M O;  1NR7 A;  2Q0O C;  4XDJ A;  1PNM A;  4HAM A;  2FB5 A;  2KG7 B;  1K97 A;  3LNN A;  5LMU B;  1GN4 A;  3H1I H;  4QPJ A;  3UT5 A;  2PI5 A;  3PJS K;  3ZMS A;  3CCQ V;  2LW1 A;  3Q4H A;  3UT5 B;  4WFF A;  2BOC C;  3L9D A;  4I4T B;  3Q4H B;  4MT8 A;  4H13 B;  2W0F C;  4FZ1 A;  5BMV A;  1VF5 B;  4FLW A;  5J2U A;  3N27 A;  2CE4 A;  5B1B C;  3QO8 A;  3RVZ A;  5EC2 C;  1V54 B;  5JCO A;  4FLZ A;  1QLE C;  1Q82 W;  1K33 A;  1OCO B;  4GKJ B;  2B1G A;  3K04 A;  3J7A U;  2QM4 A;  4U3F H;  2GHY A;  3AG4 C;  1AP6 A;  3ETD A;  3CE2 A;  1OCR C;  2P67 A;  1XHZ A;  5B3S C;  5CBF A;  2DN9 A;  5EIB D;  5GON B;  4PA7 A;  4GT1 A;  1JJO A;  4U3J A;  1Y74 A;  4TV8 B;  4UB8 Z;  1G8M A;  4J41 A;  5J2T A;  1YJ9 V;  2UXC B;  3SJA C;  1E79 G;  1VQ6 V;  1YIJ V;  3RBZ A;  2HVK C;  1H2L A;  3P30 A;  3RVY A;  1W0K G;  3A0B Z;  2DWD C;  3K0D A;  2Q68 A;  3E89 A;  4EKW A;  2UU9 O;  1K8A W;  1XMO O;  1WLE A;  1BHA A;  3L74 H;  2YUA A;  3P3P A;  3NR7 A;  5IJ0 A;  3JD0 A;  4K3A A;  4IGG A;  1WA8 A;  3K5O A;  4DV1 B;  3APO A;  3ASN C;  3ABL C;  1K34 A;  4TQF A;  4E4E A;  1Z5V A;  2YID A;  3ABM C;  3HKE B;  1VQK V;  4DXW A;  4LF9 B;  1IBL B;  4LF7 O;  1EZJ A;  3CJH B;  1DTO A;  1HDJ A;  4WCE V;  1VIB A;  3CXC U;  5IYD O;  4MTX A;  4K35 A;  3SYQ A;  3K79 A;  3M7M X;  1FXH A;  1QNM A;  1CPY A;  1X4T A;  4X1I B;  1S72 V;  1AJN A;  1L0N H;  4H37 A;  2D2C B;  1NH2 D;  3E8G A;  2A0L A;  3FD9 A;  3OAA G;  5IYZ A;  3RW0 A;  3TGU H;  2LFS A;  3KKY A;  1VAR A;  2RDC A;  4UVA A;  5IYZ B;  1IX9 A;  1YVW A;  2CDY A;  2IJJ A;  1NVP D;  3MAQ A;  2P4V A;  3IGA C;  2F4V B;  3R66 A;  4UV8 A;  2CTP A;  3VQV A;  1AR5 A;  4FM1 A;  5GTH Z;  4DYL A;  2CTQ A;  5B1B B;  4MVZ A;  3WB1 A;  5LA6 B;  5LOV B;  5FL7 G;  2FTK A;  2YI9 A;  1PM9 A;  4JI6 B;  1HNX B;  4B3R B;  1P7B A;  4GUN A;  2A79 B;  3JAR A;  4IYH A;  1BCC H;  2DYS B;  4AQY B;  4CC5 A;  2QWP B;  1KMI Z;  2YXH A;  2UUC B;  1KYO F;  3ZHT A;  1BE3 H;  3FYI B;  2BE3 A;  4TSF G;  1XUQ A;  1AI6 A;  3AG4 B;  4CBC A;  3HB3 B;  1H2G A;  4EB6 A;  4F4L A;  3IC7 A;  2V1D A;  3MDS A;  2IM9 A;  2ODM A;  1OCR B;  3H9V A;  3SDL A;  4NTY A;  1KQS U;  4X64 B;  5B3S B;  2KSD A;  1N0J A;  2VQF O;  1AIL A;  1Y76 B;  1TAE A;  1RPO A;  2PY5 A;  4Z1M G;  5LHI A;  1GK9 A;  3GB7 C;  4DV7 O;  1TUE B;  4J10 A;  4MW8 A;  3CRA A;  5C8Y A;  1JR9 A;  3RN4 A;  3ETE A;  3GVM A;  3EFF K;  1OZ0 A;  3THO A;  4DW1 A;  1YZB A;  2WA3 A;  4HYO A;  4N21 A;  1LNQ A;  2N04 A;  3SGI A;  3G6E V;  5IY5 C;  1RM1 C;  4RAI A;  4FZ0 A;  1XNQ O;  5DN6 G;  3FB5 C;  3FX7 A;  4JYA O;  4LH6 A;  2BCC H;  1THZ A;  4UV9 A;  1GH6 A;  2DQ0 A;  5LXT A;  2QR4 A;  4FLY A;  2Q67 A;  1XRE A;  1N4C A;  2C2A A;  4LF4 O;  3LDE A;  1OCZ C;  3ASO C;  1SZT A;  3I55 V;  4YHH B;  1WPX A;  5L3C A;  4X20 B;  4K0K O;  4DR1 O;  3MHH C;  3ASN B;  3JAS A;  3ABL B;  4X8A A;  2OCH A;  1B06 A;  3ABM B;  4WBN B;  3JAS B;  5LGN A;  3JAK B;  3UO2 A;  1M1K W;  4FVM A;  1I94 B;  2QWQ B;  4CC6 A;  4JI5 O;  1BGY H;  1P49 A;  1F51 A;  1PV0 A;  2WLI B;  3SYO A;  3VQY A;  3BPZ A;  4NB5 A;  2ARH A;  5IJ9 A;  1XOU A;  5FPO A;  2GUZ A;  3IFX A;  4JI0 O;  1RSO A;  1QVG U;  4ZOL A;  2HFE C;  2WLN A;  4IHJ A;  5IJ9 B;  4NKG B;  2Y0I A;  2UU9 B;  1RSO B;  3FKS G;  3L72 H;  3ZCC A;  5FPR A;  3OEE G;  5EK0 A;  1KC8 W;  2QEX V;  1R3J C;  3DC6 A;  2XND G;  3AG3 C;  2ITD C;  3CS5 A;  1VP7 A;  2HVJ C;  1JFF B;  4D7S A;  1XDC A;  1F7Y A;  1MZE A;  1D5N A;  3JCU Z;  2Q7H A;  1D2D A;  1GTO A;  1R6T A;  5LMU O;  3L71 H;  2HR3 A;  1Q6H A;  1RP3 B;  1COW G;  2YEV B;  4W4L A;  1VQ5 V;  4LF7 B;  3F5T A;  2UXD B;  1VQ8 V;  3QG5 A;  2LQT A;  2LO1 A;  3OR7 C;  4WFE A;  1PD3 A;  1E1R G;  3CCV V;  1H38 A;  2IU3 A;  3SPH A;  5L3B A;  4NTX A;  3AG7 A;  1AJP A;  2YI8 A;  2P22 C;  4O4J A;  1UFI A;  4JI1 B;  2UXB B;  4NTW A;  4O4J B;  3N2K B;  2EIK C;  4WFB V;  2QA4 V;  2H8P C;  3SJB C;  5EBL C;  3P3N A;  5IY5 B;  1VQN V;  2HEP A;  2UXC O;  3I56 V;  2CAZ C;  3RYH A;  1K92 A;  2OWO A;  1AI5 A;  1AI4 A;  4OGQ B;  3RYH B;  4AI8 A;  2PUS A;  5ITZ A;  1K4C C;  1Y6X A;  3E22 A;  1OV9 A;  4IIJ B;  3J81 N;  5ITZ B;  1FAF A;  5CB4 B;  3ASO B;  4JGS A;  2ZDI C;  2RJZ A;  2NR5 A;  4QE9 A;  1XNR O;  2NN4 A;  5EYP A;  2VQF B;  2ZE6 A;  4I50 A;  1OCC B;  3WB0 A;  1QLN A;  5CA1 B;  1G6U A;  1OHH G;  4GX2 A;  2ITC C;  1ZX3 A;  3B8N A;  4JV5 B;  1KBH A;  4DV7 B;  1LUW A;  1FD9 A;  1CXZ B;  2P6J A;  2E75 B;  2IJK A;  2UXX A;  3M8A A;  1S0V A;  4UVC A;  1N8R W;  1TA8 A;  5EBW C;  2R9A A;  3HKB B;  4JAA A;  1S5H C;  4DV4 O;  1W0J G;  2VWK A;  3ZS8 C;  4LF9 O;  2JRI A;  1IBL O;  1N36 B;  3OMN B;  1S5L Z;  4MVO A;  1IUR A;  1N0N A;  4JYA B;  5LHH A;  3UKM A;  1M9N A;  3HR0 A;  3U0Z A;  3AG3 B;  5GW7 A;  1Z2G A;  2EUL A;  4TQD A;  4UCS A;  2Y4U A;  3W7T A;  4DR3 O;  1SKV A;  1SRY A;  2L6L A;  4PDR A;  4P2Z A;  3G71 V;  4K0K B;  3JAL A;  4DR1 B;  1M56 C;  1GN3 A;  2NLJ C;  4QNH B;  1B3Q A;  2ETN A;  1K73 W;  3FB6 C;  4RO2 A;  3JAL B;  3AEI A; 
#chains in the Genus database with same CATH homology
 1ZL8 B;  1RSO B;  1Y76 B;  1Y76 A;  1ZL8 A;  1VF6 A;  1Y74 B;  1Y74 A;  1VF6 C;  3B40 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...