1Y76A

Solution structure of patj/pals1 l27 domain complex
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
62
structure length
62
Chain Sequence
NPAAEKMQVLQVLDRLRGKLQEKGDTTQNEKLSAFYETLKSPLFNQILTLQQSIKQLKGQLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords protein associated to tight junctions
publication title A unified assembly mode revealed by the structures of tetrameric L27 domain complexes formed by mLin-2/mLin-7 and Patj/Pals1 scaffold proteins.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein
total genus 23
structure length 62
sequence length 62
chains with identical sequence C
ec nomenclature
pdb deposition date 2004-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09045 L27_2 L27_2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.650 Mainly Alpha Orthogonal Bundle Helix Hairpins L27 domain 1y76A00
1RSOB 1Y74B 1Y74A 3B40A 1ZL8B 1ZL8A 1Y76B 1Y76A 1VF6A 1VF6C
chains in the Genus database with same CATH superfamily
2EJ7A 3B09A 3CX5F 4I9WA 3QO7A 4K0KB 1M4UA 3AG4C 3N27A 3FB6C 3SJQC 5GTHZ 3C3SA 1N32B 1GM8A 1K97A 3U0ZA 2P67A 2ETNA 3AG3B 3BVOA 3RYIA 4GX0A 1LUVA 4GUNA 1VF5B 1MSWD 1E79G 3ABLB 3OEHG 3WFVA 4LNUB 1W59A 3SPJA 2P6JA 4LFCO 5B3SC 3D36A 1AI5A 2F93B 1D5NA 3H1HH 4JI5B 3MD0A 3CE2A 3CXCU 1N36B 4U7NA 1WA8B 1ZLZA 2NNUA 5KX5A 1GM7A 2Q4PA 3RW0A 2Z5UA 3JASB 3CCRV 3I56V 1NR7A 1SZTA 2JIZG 4ZHQB 4PA9A 2GUZB 2Q5ZA 1VQPV 2R9AA 1XNQO 1KKDA 5A2QN 2XASA 1I94B 4YJ3B 4ZI7B 5B66Z 3AG1B 4BIOA 1F4NA 3A8TA 1ZX3A 2JGUA 4B3SB 1XL6A 5IJ9B 4DV1O 2ZNJA 3ZHVA 2W0FC 4MVMA 5CN0A 2HHHB 2YSUB 1K9MW 4UCVA 3ZMUA 4LNUA 1BS3A 1VQ4V 2JVDA 2B1GA 3CJHB 4JAVA 4Z1MG 1M57C 1WN7A 3JAWB 3U11A 3TCUA 3S3XA 5LL6Y 1M5IA 1JJOA 4ASUG 2HLDG 1WA8A 2ZINA 2JS5A 3JASA 3ZS8C 1NH2B 4JV5B 4JI4B 2Q7HA 2E74B 2PZSA 1EBOA 4MVOA 5BR8B 4ZHQA 1M1KW 1N34B 2V7QG 4PHZA 4H13B 4O4IA 4YJ3A 3LDEA 4ZI7A 2YXYA 2FB5A 1IDSA 1D2DA 5IJ9A 3FB7C 4KUMA 4TUYB 1FKAO 4FM0A 2AXTZ 4H0LB 4YHHO 2F1MA 1Q8IA 1GN6A 5LHGA 1EN5A 1JCHA 5JVDB 4DK0A 3CCMV 3AK2A 1VQNV 2AGAA 4DYLA 3CJHA 3JAWA 3C90A 2XT9A 3D36C 2HVJC 1HW7A 4FJCC 4HAMA 4WFBV 2NR5A 1KQSU 2KB1A 2CTPA 2BTQB 2ATKC 1GN2A 3OW2U 3ZMZA 3OEEG 4YIOA 2WLMA 4RQEA 3H9VA 1G1XB 1IXMA 1Q81W 1IBLO 1R3IC 2EIJB 3OGIB 4HYOA 1MSDA 2FMLA 3GWKC 4DRXB 1VMGA 4JI8B 4TUYA 4DV6B 4DO2A 3AG3C 5EK0A 1F7YA 4XDLA 2EIKB 2GBOA 4LF9O 4MTOA 5AG2A 5B5EZ 2F4VB 1WLEA 4TOIA 3ABLC 2LP7A 5JVDA 4FIPC 1AJQA 4KP4A 3ZHUA 4UV9A 4B08A 3SR2C 3W7TA 3HKDB 2BTQA 3KZIZ 3LDCA 4LP8A 4DV5O 1Y6XA 3A0BZ 1H2NA 3RYHB 4I4TB 4LFCB 4X64O 4O4LB 3W7XA 4GKJB 1UPGA 1EFRG 1I0HA 3LNMB 1K33A 2Z0AA 1IXBA 3O9OA 4CH5A 4WFFA 4DRXA 3AG1C 4FMTA 4B3RO 4JI0O 1NBMG 4P2ZA 5E79Z 1VQMV 1P49A 3K59A 2P7TC 2P4VA 4O2BB 1IBMO 3B77A 4CZZA 3A2FA 1MOFA 1XNQB 3B8MA 1ZAUA 1OHHG 1ORQC 1FS0G 2OIEA 4IT5A 2QWRB 1P4RA 4DUZO 3RGBA 3OD4A 3HKDA 4AQYO 4J7ZA 1AB3A 2LGWA 4X89A 1DK1A 3FFQA 3AG2B 3K9SA 3RYHA 1N4CA 4I4TA 2HP8A 4DXWA 4O4LA 4X66O 4I7ZB 5JJEB 1WP7A 2UXBB 2R9RB 5B1BB 3JD2A 3TJTA 4QE7A 2IJHA 2A3QA 4PA7A 5J2TB 4LFAB 3AG7A 4GX2A 4O2BA 3QTCA 5FPRA 4H37A 2IM9A 1V54B 4G27B 3DGEA 4BW9A 3JSLA 2Q9LA 2YS8A 4DR7O 3IGAC 1H2MA 2HFEC 4HBNA 3H1IH 3SDLA 4RAIA 2KQXA 5IYCO 2YEVB 3AK3A 4J42A 4ZOLB 2QM8A 2D2CB 3CCVV 5J9PC 3A0HZ 1AR4A 3ABKB 4CC6A 3JD1A 3IJ4A 3X2QC 1QR8A 3W7SA 5ITZB 1PNLA 1KMIZ 3RYFA 3TXSA 4DR1B 4C7UA 3OM3B 5J2TA 1RSOB 5IJ0B 2EIKC 1VQKV 3QG5A 1XMQO 3TK1A 3L9DA 3ZRWB 4IHJB 4F6RB 1Y74A 1JR9A 2PF4E 1PL0A 1XI1A 2ZM6O 1N33O 1BL8A 4CH3A 4FPPA 2QKAA 3LNNA 4DV3O 2CTWA 1IX9A 1VQOV 3OMNB 2JGDB 4LF5O 2LQTA 4LCUC 4F4LA 1FFXB 1AJNA 2YEVA 1OZ0A 4XDKA 3ZHRA 5KA5A 2ZE5A 4LF9B 4ZOLA 3L70H 3BHPA 4FM1A 5JCOA 2RN9A 2QR4A 2DMXA 1PNKA 4X20B 4CS4A 1SETA 4J7JA 2WLIB 3EFFK 4JTCB 1MMMA 2GSMB 2N74A 1RPRA 1GKFA 1SQPH 3OTOO 5ITZA 4UCOA 1W0KG 4DV5B 4TV8A 1R6KA 1XILA 1RSOA 5IJ0A 4JI2O 2E5LB 2K1EA 2IH3C 2YIDA 1F23A 4F6RA 3ZRWA 4IHJA 1R6NA 3L74H 1V9PA 2IBZH 1HNZO 3LSQA 4K3AA 5C93A 2PY5A 4OX9O 4Z2WA 3QO5A 2JGDA 4B3RB 2YC0A 4JI0B 4YY3B 4CH4A 3T1HB 2N05A 4K8ZA 1FFXA 3E35A 2ZT9B 1IBMB 4R7CA 1RFYA 2YIBD 4JI7B 3ZMSA 5KLVH 3AG2C 2F23A 4X20A 4PJ0Z 1KYOF 4B7KA 5F2VO 3IAYA 4CBCA 1WNSA 3OUFA 4O4HA 1GAXA 2B9ZA 2CGNA 5EC1C 4LFBO 3S3WA 2L6LA 4DUZB 4L87A 1HDJA 1PNMA 4DV7B 5CMUA 2H94A 3WB0A 4CS2A 4X1IB 4WFEA 3CCEV 5B1BC 4JPRA 5IWAO 1R3JC 3L71H 4FLYA 4FFKA 2EZOA 4U3FH 3E83A 1XMOB 4LF6O 1Q7YW 1WP8A 1XOUA 3OUSA 2ZE7A 3RBZA 3CCJV 1V54C 4NXNO 1XL4A 1YTFB 2PTMA 3RVZA 2OWOA 4GT1A 4Q20A 1CEZA 3T1CA 4K8XA 3CHXA 1J95A 2JEXA 3UO3A 1JMKC 3SJCC 2XNDG 3VQXA 3CD6V 3ZMVA 1TGOA 1QR9A 4DR7B 5DN6G 3IFXA 1BQZA 1PP9H 3D3QA 1QNMA 2Q69A 3ABKC 1FJGO 1JPXA 3SJAC 2L35A 3H01A 4UCSA 4MSWC 1M93A 4X1IA 2X7RB 3K5MA 3QNEA 3JARA 1QQCA 5IE9A 1PL4A 1N0JA 5H6QA 4Q6GA 1FXHA 1Y76B 1K34A 1AVMA 4DR5O 5FL7G 4J80A 4X65O 2OTJV 4DR4O 3O65A 3GVMA 3F7VC 1SQQH 3TGUH 2XAHA 4B7EA 4I5SA 2LW7A 4GKKB 3HKCA 3JAMN 2EJRA 4CC5A 2EX3A 3VQYA 4ZBMA 4GLXA 1XNRB 3BAAA 1SRYA 2IH1C 5L3GA 4JI1O 2ZM6B 5LOVB 5LXTB 1LNQA 3UM7A 1N33B 5B1NA 2AHYA 2P5OA 1Q6UA 1SA0A 1W0JG 3J80N 4DV3B 3ICXA 2NN4A 1SC5B 1AP5A 4TQDA 3N2GB 4NTYA 1SQFA 4R8CA 4WFHA 2Y48A 1KU9A 4DV0O 2LW1A 1MA1A 1HNWO 4K35A 5HFLA 1Z2GA 4QPJA 1YIJV 4OPAA 5H2FZ 5EIBD 4UCTA 4L8JA 2FL4A 4ZIBA 2EZPA 1N0NA 4QNHB 1GK9A 1H8HG 2DE0X 4PV1B 4WBNB 2WLKA 5LHHA 4A5UB 5CBFA 2EIMB 3FAVB 5IDJA 1XQ8A 3DC5A 5LOVA 2H8PC 1Q5OA 5LXTA 1HNZB 1T5EA 4OX9B 5CBHA 3CB2A 2QJ1A 3FYIB 3T4ZA 2QWNB 1GM9A 3N2GA 1NR1A 1QBZA 2XTAA 2ZDIC 4G2KA 3OMAB 2BSKB 3P3PA 2GUZA 1R3LC 1GTOA 2IU0A 3CS5A 4EFEA 5KHIA 3M7MX 4RUFA 2D3OW 4LFBB 3CWBH 4PDVA 1OV9A 3D8CA 2LFSA 4JTDB 2UXDO 3CMAV 2N04A 2WLJA 3N2KB 3JD0A 4B3MO 1YJWV 4WBNA 2VWKA 2XAQA 3CMEV 1NI8A 5BMVB 3FAVA 5EBLC 3SPHA 3MDSA 4NXNB 3I55V 1JJ2U 3OR7C 3DXRB 3K04A 3UO2A 2RJZA 4LF8O 2UUCO 1KC8W 5H6RA 2JJ2G 5E1AC 3TXQA 2YI8A 4PI0A 2CE4A 1KP3A 1LR1A 4KHPB 2BSKA 4HZ3A 3K06A 1W2BU 2ZD9A 1OJHA 1IBKO 1NVPD 5EBWC 1L1FA 1GRJA 1SS3A 4LR3A 4N23A 2F95B 3E89A 5LMNB 2QTSA 1FJGB 2GV9A 3X2QB 4MW8A 1XREA 1H2SB 2MK3A 1UJWB 4QPKA 1US6A 5L3DA 1G6UA 1N8RW 1FAFA 1KB9F 3JCZA 4X1YB 2PYJA 1K7DA 3QVNA 2DYSB 5BMVA 1HR0O 4JYAO 2ZE8A 4DR5B 4X65B 4NXMO 4DR4B 1JFFB 1H2LA 4FLXA 2BCCH 4FLWA 4UB8Z 1SZXA 3DXRA 2Q67A 4PI2A 5J2UB 1HNXO 2QSAA 3GWOA 3ML0A 1K3EA 4YJ2B 2ZR2A 4FM2A 2HVKC 1YZBA 3R66A 1DLBA 2V1DA 4JI6O 1VP7A 1BZKA 2Q73A 2V4DA 1EM1A 2YICA 4DK1A 2BE3A 2LJ2A 2B1IA 2UUAO 2UU9O 4X1YA 1H8EG 4KFMA 1PM9A 1K5QA 2WSSG 4WF9V 1NT2B 1Z5WA 3ZCCA 1Q6HA 2EIMC 2ADPA 1HNWB 3G71V 1SF9A 3JYCA 3OTFA 2CTQA 3RYCB 3C3TA 2R9IA 3ZBHA 5J2UA 1VARA 1SESA 4TQFA 1IURA 3K57A 4DV1B 4YJ2A 2Z3YA 3FX7A 3K0GA 4MS2A 2CUGA 2EINB 1V55B 5GTIZ 3K5OA 3ZN1A 4ICGA 4LH7A 3I5DA 4J7KA 4DV4O 4X8AA 3BEHA 3NR7A 3BRCA 4JAAA 2JJ1G 2DYRB 1KD1W 2F43G 1WAZA 3CCLV 1KKCA 2XAJA 3PJSK 3BY6A 4PD4F 1B06A 1K4DC 1L0NH 2UXNA 2QTOA 5KHKA 3T2MA 3VBBA 1DGSA 1Q43A 3RYCA 2MW2B 1R1BA 1SERA 1MZFA 3G4SV 1XBLA 1Q6IA 3MHSC 3QF7A 4B3MB 1VQ5V 3IC7A 4J9ZB 5IYZB 4YHHB 2EULA 3TETA 5IT9N 4JTAB 3ZJZA 1E1RG 5JH7B 4IYIA 5BZBA 3OT7A 2IJKA 3RWRD 2Q7GA 2YXHA 4DR2O 4P9OA 4GZRB 1J5EO 1AP6A 2UUCB 4TSFG 3RFRA 1AI6A 4TV9B 5L3EA 1NKDA 1AI4A 3B8NA 5D5PA 4MVZA 1KP2A 4OXSA 4WFAV 2YDEA 1JQ0A 4NB5A 2RQ6A 4CH6A 2DYSC 3HB3B 4G28B 2OTLV 1OCRB 1Q82W 1IBLB 2A79B 2QWOB 3BA9A 4MVUA 3ETQA 4DW1A 1TVKB 1YDXA 4NTXA 3JD3A 4BW5A 5KAIZ 2PI4A 3K5LA 1O9GA 2X6AA 3VQVA 5IYZA 1H2KA 3K5NA 3WG7B 4WFGA 1S77D 5BXZA 3ZHQA 1HR0B 3JAKB 5JH7A 5LP6B 2QDOA 4NXMB 2IJIA 3H1JH 1BSMA 3JATB 4I55B 4JI5O 1N36O 3ZEDA 1HNXB 3UCSC 1NTMH 2QKCA 1FXVA 1K92A 4TV9A 4TT3G 4EEQA 3SYCA 1XHZA 5K1PA 3CRQA 2ZIOA 2CH7B 5DECA 3ABMB 3CYOA 2QA4V 2HKOA 2P06A 4JI6B 2QEXV 2EBOA 4X64B 2WLLB 1ZUQA 2CAZC 4X1KB 1R6TA 4B3SO 4UCRA 1TVKA 2BOCC 2Y4TA 4AI8A 3ASOB 1R73A 3SJBC 1I5YA 2UU9B 2CTRA 1KBHA 1FD9A 1ZWIC 2A9HA 1VQ9V 2C2AA 2JS3A 1VIBA 3JAKA 5LP6A 2EINC 1V55C 3ETDA 5KHGA 2QGNA 1VF7A 2NLJC 3CC2V 1MZEA 4FK5C 2HJFC 1GO3F 3JATA 2WLIA 3ETEA 4I55A 1UFIA 4R6ZA 4LF7O 1PD3A 2X6BA 4XDJA 1NH2D 5GONB 3ZRXA 2X6CA 1VF6C 3ZHSA 2WPDG 4AQYB 2QE7G 2DYRC 2CH7A 4JZGA 4PA6A 1N34O 2ZXWB 4E4EA 1NQTA 1BT8A 3WU2Z 1G8MA 1MNGA 5H9CA 2WAMA 1VQ7V 4X66B 2WLLA 5JWPA 4P30A 3SGIA 1ZL8B 4I50B 1G4YB 4X1KA 3JALB 2WA3A 2F66C 3CSXA 3F7YC 3CXHF 3E8FA 2LFRA 5EZYB 3UQ8A 2BOBC 2RMKB 4JASA 2ZE6A 4FFBB 1M9NA 5JQGB 4JZ2A 2Q0OC 4FZ0A 1QVGU 4J10A 5D5QA 1TA8A 1GN4A 1LUWA 3H1KH 3E22B 3AEIA 3LUTB 3SYAA 2IW5A 4IGGA 2H3OA 3DSQA 2XUMA 5TISZ 1XHXA 2FTKA 3OR6C 1O9HA 4NYKA 1TUBB 1K4CC 1OCZB 2ZDIA 4ABMA 4DUYO 4UB6Z 2R72A 2IU3A 4D6TH 3T4DA 3G67A 5L3BA 5L3CA 4DR2B 2JDIG 2QWPB 3P3NA 1OCRC 1ZL8A 2VQFO 1B04A 5KA6A 5KAFZ 3APOA 1YEWA 3JALA 3H1LH 4MTFA 5B1AB 1MABG 4JYBA 4JI8O 5EZYA 1S3JA 3F5TA 3FD9A 3AK1A 3SYPA 2AHZA 3J7AU 2KG7B 3FB5C 4FFBA 3DC6A 2F4VO 3WG7C 2QM4A 3STLC 1XMQB 5LGUA 2GTAA 5LP6C 4FVMA 1AR5A 3E22A 2Y4UA 2CK3G 2Q8VA 1AR1B 2HG5C 1Y4MA 4NTWA 2IJJA 1S5HC 3VOUA 4LF5B 4PELA 1QCEA 1TUBA 3CRCA 5IY5B 3B2EE 4LC1A 2P22C 1X59A 4PDRA 3ABMC 3K3WA 4UVCA 3OAAG 1Y76A 5LHIA 4GKJO 1KUQA 3ZN0A 1DTOA 1P7BA 4PA4A 2CGOA 1VQLV 3E86A 1L0LH 2ZR3A 1R3KC 5C8YB 3W7UA 2UXXA 3OTOB 3ASOC 4BIUA 2KG7A 4OPHA 2YXLA 4OGQB 2W6IG 4FLVA 3OE7G 4JI2B 2DQ0A 2GTSA 1BGYH 4O4IB 5BY1A 4MW3A 3G80A 4JYYA 3JSNA 3CCUV 4H33A 3JCUZ 1S0VA 1WB7A 1AROP 1YF2A 1THZA 1SQGA 4X88A 1VQ6V 5LMUO 1GH6A 2UUBO 2R70A 1WPXA 3T1YO 1URFA 4GX1A 1ROPA 4BIZA 4B3TO 1M56B 2ZXWC 2RCVA 2OCHA 2ZCEA 3ZMTA 4LWSB 2FYUH 4LF7B 3QO8A 4EB6B 2UXBO 2DW4A 4U3JB 3CRRA 5C8YA 3ZRVA 4P9PA 5LGTA 1BHBA 3ZHTA 3HKEB 3KG2A 1OCOC 5IWAB 4LFAO 1S76D 2DQ3A 4RO2A 4LF6B 3RN4A 2DJVA 3BA8A 3CPWU 1SQVH 4NKGB 4MVRA 1JA8A 4X9QA 5KMGB 3FB8C 3SPGA 4J11A 3CEIA 4IL6Z 4DR6O 3FYEB 4D7TA 3CCQV 4J9YB 5CA1B 1NU1H 1B6QA 1L8DA 2UXCO 2OCCB 3KKYA 3U10A 2AW9A 1OCZC 2B5UA 2RNBA 1HP8A 1XEQA 2EILB 4D7SA 1TUEB 1RM1B 5DEDA 4BAYA 2XOKG 4IYHA 4TWKA 3KCXA 4LWSA 2YIBA 3CRAA 5CBGA 4I0XB 4EB6A 4U3JA 2ZKOA 2A06H 2HEPA 2Y0IA 3GB7C 4AILC 5B1AC 2ZQMA 4DR1O 1I7FA 4MVQA 4DUYB 1PKXA 3W7WA 3HKEA 3N2KA 4W4LA 2ILMA 3ZIAG 2ODMA 3Q4HB 1SQBH 1YCIA 5KUKA 2ZNIA 3HR0A 3F5WC 3NXSA 5KMGA 4RWUA 2VQFB 1Z5VA 5CA0B 5LA6B 3ETGA 5CA1A 1IZ3A 5FNVB 1VEWA 2LO1A 4FZ1A 4X62O 1JX9A 2PI5A 3K0DA 2QWQB 3ZRSA 1B3QA 5IY5C 4PA3A 4YXWG 4NR1A 1D5AA 1PV0A 4FLUA 3P30A 4DW0A 5A9GA 4JI1B 2E76B 3P32A 1NJIW 4I0XA 3MAQA 2KSDA 1YXBA 3LDDA 1TAEA 4DR3O 2Y0PA 2E3CA 1BE3H 3L75H 1QVFU 3B40A 3BABA 2OT5A 4QIWF 4UVAA 3E2EA 3J81N 2DN9A 1MG1A 1BMFG 1QU7A 3SYOA 4EKWA 2E5LO 3SPCA 1M90W 2VQEO 4WCEV 3Q4HA 4ZKIA 1FYJA 4F6EA 1RPOA 2JEUA 1H2GA 3APQA 4DV0B 2ITDC 3JD4A 3BFRA 1JFFA 1QHTA 3THOA 5LYJB 2JK5C 3STZC 2GHYA 3K08A 2WLNA 5CA0A 5LA6A 2DWEC 1Q90D 3OMIB 4YY3O 4DV2O 3T1HO 5FNVA 1YHQV 1FFTB 4QJFB 3E8GA 3E8HA 3L73H 4LF4O 2OIGA 3VQWA 4JI7O 4EFBA 1HWYA 4JYCA 1I08A 1K8AW 5JJNB 3L72H 4KXRA 3K03A 1M56C 4UXNA 5KUMA 1YVWA 2P90A 2Q6AA 3BPZA 4LH6A 2DOSA 4DV7O 2Y69B 5GW7A 2PYLA 5LMUB 4O4JB 1OCCB 2UUBB 4U7OA 3G6BA 3T1YB 2VRZA 1XMOO 1VQ8V 4B3TB 1YTFD 4MTGA 4RUEA 1BQ0A 4AHCA 3ABTA 3RT3C 2WWWA 5JJJB 3LSSA 4FLTA 2M7WA 1U96A 5LYJA 1F51A 1CPYA 4BWAA 5L3FA 2UXDB 3RYFB 4J41A 2ZIMA 3R65A 2OCCC 1A32A 3EHBB 1E1QG 4MT8A 3ASNB 4XBFA 1YJNV 3WB1A 1Y74B 3CCSV 4HNAB 5H5NA 2EILC 1RM1C 5IYBO 4JI3O 4UFZA 3CC4V 1BHAA 1ENVA 2ARHA 1DF4A 4DR6B 1QLEB 4E2LA 4LF8B 2A7WA 1VF6A 2UXCB 1Q86W 4O4JA 4N21A 1ZSPA 1KECA 1YJ9V 2XHBA 1JOYA 1GMGA 3CRMA 1YITV 3HPLC 3M99B 1AILA 1YSCA 4PDMA 5KHHA 1IBKB 1X4TA 2YIAA 1YI2V 2WA4A 4GYCB 4KL1A 1AI7A 5CB4B 2CDYA 4K0KO 2EIJC 3RVYA 2HR3A 1FXKB 5KHJA 4GKKO 1NVPB 1N32O 2X0LA 3M8AA 4TV8B 3BCCH 4R50A 3FKSG 2GDSA 1NTKH 3IC9A 1XNRO 5EC2C 2K9PA 4UUJC 4JYAB 4HNAA 3AG4B 3OFNG 5HFMA 3A0RA 4YIPA 4Z1VA 2LGQA 3SPIA 1GN3A 4I9QA 1K73W 1ZTEA 2ITCC 2VS0A 1Y67A 1WPBA 3ABUA 4X62B 1SKVA 1SQXH 1CP9A 2W6JG 1IVSA 4UCUA 1PPJH 1WJZA 2PGGA 5B3SB 2W0XA 4O4HB 1JVMA 1I94O 3PN1A 5EBMC 5CB4A 2XAFA 3OGCC 2PUSA 5CA3A 4DR3B 1FXKA 3MHHC 1EN4A 2UUAB 2FKXA 4LBEC 4UV8A 4UVBA 2HHHO 2VQEB 5EIBC 4BR6A 5K1XA 1DF5A 1EZJA 4MTXA 3G6EV 4NVPA 1AJPA 2A0LA 3LSUA 2Q68A 3K79A 4PDLA 4DV2B 1COWG 2WLHA 3EXAA 3E8BA 2Y69C 3UT5B 4JAUA 2XAGA 1OCCC 4RQFA 2QKSA 5DM6V 4LF4B 4JI4O 4JV5O 2M6YA 5BR8O 4GX5A 3UKMA 1P84F 3HKBB 5FLXN 1M57B 4JGSA 4QGPA 1S72V 1XDCA 4O2AB 4DV4B 2HJDA 1FPOA 3ZX6A 2AZ2A 4IIJB 3K58A 2QM7A 2DWDC 1NS1A 2YI9A 5LBQA 4QE9A 4MVSA 1OCOB 2RDCA 1F4MA 2OYQA 3JARB 2E75B 2VWJA 1BCCH 1EZVH 3K9AA 3B4SA 3ASNC 2BTOA 5EYPB 2JRIA 1S5LZ 2P4KA 3KCYA 4FLZA 4W4KA 3HKCB 3WB2A 1QLEC 1Y66A 5B1OA 1NZ6A 5GONA 3RYIB 3UT5A 2YUAA 1U97A 3EVKA 4CS3A 1I5XA 2G38A 1P7GA 3SYQA 1H38A 2O57A 4KHPO 4H44B 5IYDO 3HKBA 4JF3A 5JCOC 4O2AA 4JI3B 1EN6A 5LGNA 3D3IA 2Q7EA 5LMNO 1SA0B 2Q0AA 4IIJA 1J5EB 1K5SA 1CXZB 1Q3EA 4I50A 4GCZA 1QLNA 1RP3B 1FXKC 5KX5B 5FPOA 4DV6O 1WB8A 2ADQB 3CP1A 2KKWA 1XUQA 1NTZH 5JQGA 2AZ0A 3CC7V 1S5JA 5EYPA 3DTUB
chains in the Genus database with same CATH topology
1RSOB 1Y74B 1Y74A 3B40A 1ZL8B 1ZL8A 1Y76B 1Y76A 1VF6A 1VF6C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RSO B;  1Y74 B;  1Y74 A;  3B40 A;  1ZL8 B;  1ZL8 A;  1Y76 B;  1Y76 A;  1VF6 A;  1VF6 C; 
#chains in the Genus database with same CATH topology
 2EJ7 A;  3B09 A;  3CX5 F;  4I9W A;  3QO7 A;  4K0K B;  1M4U A;  3AG4 C;  3N27 A;  3FB6 C;  3SJQ C;  5GTH Z;  3C3S A;  1N32 B;  1GM8 A;  1K97 A;  3U0Z A;  2P67 A;  2ETN A;  3AG3 B;  3BVO A;  3RYI A;  4GX0 A;  1LUV A;  4GUN A;  1VF5 B;  1MSW D;  1E79 G;  3ABL B;  3OEH G;  3WFV A;  4LNU B;  1W59 A;  3SPJ A;  2P6J A;  4LFC O;  5B3S C;  3D36 A;  1AI5 A;  2F93 B;  1D5N A;  3H1H H;  4JI5 B;  3MD0 A;  3CE2 A;  3CXC U;  1N36 B;  4U7N A;  1WA8 B;  1ZLZ A;  2NNU A;  5KX5 A;  1GM7 A;  2Q4P A;  3RW0 A;  2Z5U A;  3JAS B;  3CCR V;  3I56 V;  1NR7 A;  1SZT A;  2JIZ G;  4ZHQ B;  4PA9 A;  2GUZ B;  2Q5Z A;  1VQP V;  2R9A A;  1XNQ O;  1KKD A;  5A2Q N;  2XAS A;  1I94 B;  4YJ3 B;  4ZI7 B;  5B66 Z;  3AG1 B;  4BIO A;  1F4N A;  3A8T A;  1ZX3 A;  2JGU A;  4B3S B;  1XL6 A;  5IJ9 B;  4DV1 O;  2ZNJ A;  3ZHV A;  2W0F C;  4MVM A;  5CN0 A;  2HHH B;  2YSU B;  1K9M W;  4UCV A;  3ZMU A;  4LNU A;  1BS3 A;  1VQ4 V;  2JVD A;  2B1G A;  3CJH B;  4JAV A;  4Z1M G;  1M57 C;  1WN7 A;  3JAW B;  3U11 A;  3TCU A;  3S3X A;  5LL6 Y;  1M5I A;  1JJO A;  4ASU G;  2HLD G;  1WA8 A;  2ZIN A;  2JS5 A;  3JAS A;  3ZS8 C;  1NH2 B;  4JV5 B;  4JI4 B;  2Q7H A;  2E74 B;  2PZS A;  1EBO A;  4MVO A;  5BR8 B;  4ZHQ A;  1M1K W;  1N34 B;  2V7Q G;  4PHZ A;  4H13 B;  4O4I A;  4YJ3 A;  3LDE A;  4ZI7 A;  2YXY A;  2FB5 A;  1IDS A;  1D2D A;  5IJ9 A;  3FB7 C;  4KUM A;  4TUY B;  1FKA O;  4FM0 A;  2AXT Z;  4H0L B;  4YHH O;  2F1M A;  1Q8I A;  1GN6 A;  5LHG A;  1EN5 A;  1JCH A;  5JVD B;  4DK0 A;  3CCM V;  3AK2 A;  1VQN V;  2AGA A;  4DYL A;  3CJH A;  3JAW A;  3C90 A;  2XT9 A;  3D36 C;  2HVJ C;  1HW7 A;  4FJC C;  4HAM A;  4WFB V;  2NR5 A;  1KQS U;  2KB1 A;  2CTP A;  2BTQ B;  2ATK C;  1GN2 A;  3OW2 U;  3ZMZ A;  3OEE G;  4YIO A;  2WLM A;  4RQE A;  3H9V A;  1G1X B;  1IXM A;  1Q81 W;  1IBL O;  1R3I C;  2EIJ B;  3OGI B;  4HYO A;  1MSD A;  2FML A;  3GWK C;  4DRX B;  1VMG A;  4JI8 B;  4TUY A;  4DV6 B;  4DO2 A;  3AG3 C;  5EK0 A;  1F7Y A;  4XDL A;  2EIK B;  2GBO A;  4LF9 O;  4MTO A;  5AG2 A;  5B5E Z;  2F4V B;  1WLE A;  4TOI A;  3ABL C;  2LP7 A;  5JVD A;  4FIP C;  1AJQ A;  4KP4 A;  3ZHU A;  4UV9 A;  4B08 A;  3SR2 C;  3W7T A;  3HKD B;  2BTQ A;  3KZI Z;  3LDC A;  4LP8 A;  4DV5 O;  1Y6X A;  3A0B Z;  1H2N A;  3RYH B;  4I4T B;  4LFC B;  4X64 O;  4O4L B;  3W7X A;  4GKJ B;  1UPG A;  1EFR G;  1I0H A;  3LNM B;  1K33 A;  2Z0A A;  1IXB A;  3O9O A;  4CH5 A;  4WFF A;  4DRX A;  3AG1 C;  4FMT A;  4B3R O;  4JI0 O;  1NBM G;  4P2Z A;  5E79 Z;  1VQM V;  1P49 A;  3K59 A;  2P7T C;  2P4V A;  4O2B B;  1IBM O;  3B77 A;  4CZZ A;  3A2F A;  1MOF A;  1XNQ B;  3B8M A;  1ZAU A;  1OHH G;  1ORQ C;  1FS0 G;  2OIE A;  4IT5 A;  2QWR B;  1P4R A;  4DUZ O;  3RGB A;  3OD4 A;  3HKD A;  4AQY O;  4J7Z A;  1AB3 A;  2LGW A;  4X89 A;  1DK1 A;  3FFQ A;  3AG2 B;  3K9S A;  3RYH A;  1N4C A;  4I4T A;  2HP8 A;  4DXW A;  4O4L A;  4X66 O;  4I7Z B;  5JJE B;  1WP7 A;  2UXB B;  2R9R B;  5B1B B;  3JD2 A;  3TJT A;  4QE7 A;  2IJH A;  2A3Q A;  4PA7 A;  5J2T B;  4LFA B;  3AG7 A;  4GX2 A;  4O2B A;  3QTC A;  5FPR A;  4H37 A;  2IM9 A;  1V54 B;  4G27 B;  3DGE A;  4BW9 A;  3JSL A;  2Q9L A;  2YS8 A;  4DR7 O;  3IGA C;  1H2M A;  2HFE C;  4HBN A;  3H1I H;  3SDL A;  4RAI A;  2KQX A;  5IYC O;  2YEV B;  3AK3 A;  4J42 A;  4ZOL B;  2QM8 A;  2D2C B;  3CCV V;  5J9P C;  3A0H Z;  1AR4 A;  3ABK B;  4CC6 A;  3JD1 A;  3IJ4 A;  3X2Q C;  1QR8 A;  3W7S A;  5ITZ B;  1PNL A;  1KMI Z;  3RYF A;  3TXS A;  4DR1 B;  4C7U A;  3OM3 B;  5J2T A;  1RSO B;  5IJ0 B;  2EIK C;  1VQK V;  3QG5 A;  1XMQ O;  3TK1 A;  3L9D A;  3ZRW B;  4IHJ B;  4F6R B;  1Y74 A;  1JR9 A;  2PF4 E;  1PL0 A;  1XI1 A;  2ZM6 O;  1N33 O;  1BL8 A;  4CH3 A;  4FPP A;  2QKA A;  3LNN A;  4DV3 O;  2CTW A;  1IX9 A;  1VQO V;  3OMN B;  2JGD B;  4LF5 O;  2LQT A;  4LCU C;  4F4L A;  1FFX B;  1AJN A;  2YEV A;  1OZ0 A;  4XDK A;  3ZHR A;  5KA5 A;  2ZE5 A;  4LF9 B;  4ZOL A;  3L70 H;  3BHP A;  4FM1 A;  5JCO A;  2RN9 A;  2QR4 A;  2DMX A;  1PNK A;  4X20 B;  4CS4 A;  1SET A;  4J7J A;  2WLI B;  3EFF K;  4JTC B;  1MMM A;  2GSM B;  2N74 A;  1RPR A;  1GKF A;  1SQP H;  3OTO O;  5ITZ A;  4UCO A;  1W0K G;  4DV5 B;  4TV8 A;  1R6K A;  1XIL A;  1RSO A;  5IJ0 A;  4JI2 O;  2E5L B;  2K1E A;  2IH3 C;  2YID A;  1F23 A;  4F6R A;  3ZRW A;  4IHJ A;  1R6N A;  3L74 H;  1V9P A;  2IBZ H;  1HNZ O;  3LSQ A;  4K3A A;  5C93 A;  2PY5 A;  4OX9 O;  4Z2W A;  3QO5 A;  2JGD A;  4B3R B;  2YC0 A;  4JI0 B;  4YY3 B;  4CH4 A;  3T1H B;  2N05 A;  4K8Z A;  1FFX A;  3E35 A;  2ZT9 B;  1IBM B;  4R7C A;  1RFY A;  2YIB D;  4JI7 B;  3ZMS A;  5KLV H;  3AG2 C;  2F23 A;  4X20 A;  4PJ0 Z;  1KYO F;  4B7K A;  5F2V O;  3IAY A;  4CBC A;  1WNS A;  3OUF A;  4O4H A;  1GAX A;  2B9Z A;  2CGN A;  5EC1 C;  4LFB O;  3S3W A;  2L6L A;  4DUZ B;  4L87 A;  1HDJ A;  1PNM A;  4DV7 B;  5CMU A;  2H94 A;  3WB0 A;  4CS2 A;  4X1I B;  4WFE A;  3CCE V;  5B1B C;  4JPR A;  5IWA O;  1R3J C;  3L71 H;  4FLY A;  4FFK A;  2EZO A;  4U3F H;  3E83 A;  1XMO B;  4LF6 O;  1Q7Y W;  1WP8 A;  1XOU A;  3OUS A;  2ZE7 A;  3RBZ A;  3CCJ V;  1V54 C;  4NXN O;  1XL4 A;  1YTF B;  2PTM A;  3RVZ A;  2OWO A;  4GT1 A;  4Q20 A;  1CEZ A;  3T1C A;  4K8X A;  3CHX A;  1J95 A;  2JEX A;  3UO3 A;  1JMK C;  3SJC C;  2XND G;  3VQX A;  3CD6 V;  3ZMV A;  1TGO A;  1QR9 A;  4DR7 B;  5DN6 G;  3IFX A;  1BQZ A;  1PP9 H;  3D3Q A;  1QNM A;  2Q69 A;  3ABK C;  1FJG O;  1JPX A;  3SJA C;  2L35 A;  3H01 A;  4UCS A;  4MSW C;  1M93 A;  4X1I A;  2X7R B;  3K5M A;  3QNE A;  3JAR A;  1QQC A;  5IE9 A;  1PL4 A;  1N0J A;  5H6Q A;  4Q6G A;  1FXH A;  1Y76 B;  1K34 A;  1AVM A;  4DR5 O;  5FL7 G;  4J80 A;  4X65 O;  2OTJ V;  4DR4 O;  3O65 A;  3GVM A;  3F7V C;  1SQQ H;  3TGU H;  2XAH A;  4B7E A;  4I5S A;  2LW7 A;  4GKK B;  3HKC A;  3JAM N;  2EJR A;  4CC5 A;  2EX3 A;  3VQY A;  4ZBM A;  4GLX A;  1XNR B;  3BAA A;  1SRY A;  2IH1 C;  5L3G A;  4JI1 O;  2ZM6 B;  5LOV B;  5LXT B;  1LNQ A;  3UM7 A;  1N33 B;  5B1N A;  2AHY A;  2P5O A;  1Q6U A;  1SA0 A;  1W0J G;  3J80 N;  4DV3 B;  3ICX A;  2NN4 A;  1SC5 B;  1AP5 A;  4TQD A;  3N2G B;  4NTY A;  1SQF A;  4R8C A;  4WFH A;  2Y48 A;  1KU9 A;  4DV0 O;  2LW1 A;  1MA1 A;  1HNW O;  4K35 A;  5HFL A;  1Z2G A;  4QPJ A;  1YIJ V;  4OPA A;  5H2F Z;  5EIB D;  4UCT A;  4L8J A;  2FL4 A;  4ZIB A;  2EZP A;  1N0N A;  4QNH B;  1GK9 A;  1H8H G;  2DE0 X;  4PV1 B;  4WBN B;  2WLK A;  5LHH A;  4A5U B;  5CBF A;  2EIM B;  3FAV B;  5IDJ A;  1XQ8 A;  3DC5 A;  5LOV A;  2H8P C;  1Q5O A;  5LXT A;  1HNZ B;  1T5E A;  4OX9 B;  5CBH A;  3CB2 A;  2QJ1 A;  3FYI B;  3T4Z A;  2QWN B;  1GM9 A;  3N2G A;  1NR1 A;  1QBZ A;  2XTA A;  2ZDI C;  4G2K A;  3OMA B;  2BSK B;  3P3P A;  2GUZ A;  1R3L C;  1GTO A;  2IU0 A;  3CS5 A;  4EFE A;  5KHI A;  3M7M X;  4RUF A;  2D3O W;  4LFB B;  3CWB H;  4PDV A;  1OV9 A;  3D8C A;  2LFS A;  4JTD B;  2UXD O;  3CMA V;  2N04 A;  2WLJ A;  3N2K B;  3JD0 A;  4B3M O;  1YJW V;  4WBN A;  2VWK A;  2XAQ A;  3CME V;  1NI8 A;  5BMV B;  3FAV A;  5EBL C;  3SPH A;  3MDS A;  4NXN B;  3I55 V;  1JJ2 U;  3OR7 C;  3DXR B;  3K04 A;  3UO2 A;  2RJZ A;  4LF8 O;  2UUC O;  1KC8 W;  5H6R A;  2JJ2 G;  5E1A C;  3TXQ A;  2YI8 A;  4PI0 A;  2CE4 A;  1KP3 A;  1LR1 A;  4KHP B;  2BSK A;  4HZ3 A;  3K06 A;  1W2B U;  2ZD9 A;  1OJH A;  1IBK O;  1NVP D;  5EBW C;  1L1F A;  1GRJ A;  1SS3 A;  4LR3 A;  4N23 A;  2F95 B;  3E89 A;  5LMN B;  2QTS A;  1FJG B;  2GV9 A;  3X2Q B;  4MW8 A;  1XRE A;  1H2S B;  2MK3 A;  1UJW B;  4QPK A;  1US6 A;  5L3D A;  1G6U A;  1N8R W;  1FAF A;  1KB9 F;  3JCZ A;  4X1Y B;  2PYJ A;  1K7D A;  3QVN A;  2DYS B;  5BMV A;  1HR0 O;  4JYA O;  2ZE8 A;  4DR5 B;  4X65 B;  4NXM O;  4DR4 B;  1JFF B;  1H2L A;  4FLX A;  2BCC H;  4FLW A;  4UB8 Z;  1SZX A;  3DXR A;  2Q67 A;  4PI2 A;  5J2U B;  1HNX O;  2QSA A;  3GWO A;  3ML0 A;  1K3E A;  4YJ2 B;  2ZR2 A;  4FM2 A;  2HVK C;  1YZB A;  3R66 A;  1DLB A;  2V1D A;  4JI6 O;  1VP7 A;  1BZK A;  2Q73 A;  2V4D A;  1EM1 A;  2YIC A;  4DK1 A;  2BE3 A;  2LJ2 A;  2B1I A;  2UUA O;  2UU9 O;  4X1Y A;  1H8E G;  4KFM A;  1PM9 A;  1K5Q A;  2WSS G;  4WF9 V;  1NT2 B;  1Z5W A;  3ZCC A;  1Q6H A;  2EIM C;  2ADP A;  1HNW B;  3G71 V;  1SF9 A;  3JYC A;  3OTF A;  2CTQ A;  3RYC B;  3C3T A;  2R9I A;  3ZBH A;  5J2U A;  1VAR A;  1SES A;  4TQF A;  1IUR A;  3K57 A;  4DV1 B;  4YJ2 A;  2Z3Y A;  3FX7 A;  3K0G A;  4MS2 A;  2CUG A;  2EIN B;  1V55 B;  5GTI Z;  3K5O A;  3ZN1 A;  4ICG A;  4LH7 A;  3I5D A;  4J7K A;  4DV4 O;  4X8A A;  3BEH A;  3NR7 A;  3BRC A;  4JAA A;  2JJ1 G;  2DYR B;  1KD1 W;  2F43 G;  1WAZ A;  3CCL V;  1KKC A;  2XAJ A;  3PJS K;  3BY6 A;  4PD4 F;  1B06 A;  1K4D C;  1L0N H;  2UXN A;  2QTO A;  5KHK A;  3T2M A;  3VBB A;  1DGS A;  1Q43 A;  3RYC A;  2MW2 B;  1R1B A;  1SER A;  1MZF A;  3G4S V;  1XBL A;  1Q6I A;  3MHS C;  3QF7 A;  4B3M B;  1VQ5 V;  3IC7 A;  4J9Z B;  5IYZ B;  4YHH B;  2EUL A;  3TET A;  5IT9 N;  4JTA B;  3ZJZ A;  1E1R G;  5JH7 B;  4IYI A;  5BZB A;  3OT7 A;  2IJK A;  3RWR D;  2Q7G A;  2YXH A;  4DR2 O;  4P9O A;  4GZR B;  1J5E O;  1AP6 A;  2UUC B;  4TSF G;  3RFR A;  1AI6 A;  4TV9 B;  5L3E A;  1NKD A;  1AI4 A;  3B8N A;  5D5P A;  4MVZ A;  1KP2 A;  4OXS A;  4WFA V;  2YDE A;  1JQ0 A;  4NB5 A;  2RQ6 A;  4CH6 A;  2DYS C;  3HB3 B;  4G28 B;  2OTL V;  1OCR B;  1Q82 W;  1IBL B;  2A79 B;  2QWO B;  3BA9 A;  4MVU A;  3ETQ A;  4DW1 A;  1TVK B;  1YDX A;  4NTX A;  3JD3 A;  4BW5 A;  5KAI Z;  2PI4 A;  3K5L A;  1O9G A;  2X6A A;  3VQV A;  5IYZ A;  1H2K A;  3K5N A;  3WG7 B;  4WFG A;  1S77 D;  5BXZ A;  3ZHQ A;  1HR0 B;  3JAK B;  5JH7 A;  5LP6 B;  2QDO A;  4NXM B;  2IJI A;  3H1J H;  1BSM A;  3JAT B;  4I55 B;  4JI5 O;  1N36 O;  3ZED A;  1HNX B;  3UCS C;  1NTM H;  2QKC A;  1FXV A;  1K92 A;  4TV9 A;  4TT3 G;  4EEQ A;  3SYC A;  1XHZ A;  5K1P A;  3CRQ A;  2ZIO A;  2CH7 B;  5DEC A;  3ABM B;  3CYO A;  2QA4 V;  2HKO A;  2P06 A;  4JI6 B;  2QEX V;  2EBO A;  4X64 B;  2WLL B;  1ZUQ A;  2CAZ C;  4X1K B;  1R6T A;  4B3S O;  4UCR A;  1TVK A;  2BOC C;  2Y4T A;  4AI8 A;  3ASO B;  1R73 A;  3SJB C;  1I5Y A;  2UU9 B;  2CTR A;  1KBH A;  1FD9 A;  1ZWI C;  2A9H A;  1VQ9 V;  2C2A A;  2JS3 A;  1VIB A;  3JAK A;  5LP6 A;  2EIN C;  1V55 C;  3ETD A;  5KHG A;  2QGN A;  1VF7 A;  2NLJ C;  3CC2 V;  1MZE A;  4FK5 C;  2HJF C;  1GO3 F;  3JAT A;  2WLI A;  3ETE A;  4I55 A;  1UFI A;  4R6Z A;  4LF7 O;  1PD3 A;  2X6B A;  4XDJ A;  1NH2 D;  5GON B;  3ZRX A;  2X6C A;  1VF6 C;  3ZHS A;  2WPD G;  4AQY B;  2QE7 G;  2DYR C;  2CH7 A;  4JZG A;  4PA6 A;  1N34 O;  2ZXW B;  4E4E A;  1NQT A;  1BT8 A;  3WU2 Z;  1G8M A;  1MNG A;  5H9C A;  2WAM A;  1VQ7 V;  4X66 B;  2WLL A;  5JWP A;  4P30 A;  3SGI A;  1ZL8 B;  4I50 B;  1G4Y B;  4X1K A;  3JAL B;  2WA3 A;  2F66 C;  3CSX A;  3F7Y C;  3CXH F;  3E8F A;  2LFR A;  5EZY B;  3UQ8 A;  2BOB C;  2RMK B;  4JAS A;  2ZE6 A;  4FFB B;  1M9N A;  5JQG B;  4JZ2 A;  2Q0O C;  4FZ0 A;  1QVG U;  4J10 A;  5D5Q A;  1TA8 A;  1GN4 A;  1LUW A;  3H1K H;  3E22 B;  3AEI A;  3LUT B;  3SYA A;  2IW5 A;  4IGG A;  2H3O A;  3DSQ A;  2XUM A;  5TIS Z;  1XHX A;  2FTK A;  3OR6 C;  1O9H A;  4NYK A;  1TUB B;  1K4C C;  1OCZ B;  2ZDI A;  4ABM A;  4DUY O;  4UB6 Z;  2R72 A;  2IU3 A;  4D6T H;  3T4D A;  3G67 A;  5L3B A;  5L3C A;  4DR2 B;  2JDI G;  2QWP B;  3P3N A;  1OCR C;  1ZL8 A;  2VQF O;  1B04 A;  5KA6 A;  5KAF Z;  3APO A;  1YEW A;  3JAL A;  3H1L H;  4MTF A;  5B1A B;  1MAB G;  4JYB A;  4JI8 O;  5EZY A;  1S3J A;  3F5T A;  3FD9 A;  3AK1 A;  3SYP A;  2AHZ A;  3J7A U;  2KG7 B;  3FB5 C;  4FFB A;  3DC6 A;  2F4V O;  3WG7 C;  2QM4 A;  3STL C;  1XMQ B;  5LGU A;  2GTA A;  5LP6 C;  4FVM A;  1AR5 A;  3E22 A;  2Y4U A;  2CK3 G;  2Q8V A;  1AR1 B;  2HG5 C;  1Y4M A;  4NTW A;  2IJJ A;  1S5H C;  3VOU A;  4LF5 B;  4PEL A;  1QCE A;  1TUB A;  3CRC A;  5IY5 B;  3B2E E;  4LC1 A;  2P22 C;  1X59 A;  4PDR A;  3ABM C;  3K3W A;  4UVC A;  3OAA G;  1Y76 A;  5LHI A;  4GKJ O;  1KUQ A;  3ZN0 A;  1DTO A;  1P7B A;  4PA4 A;  2CGO A;  1VQL V;  3E86 A;  1L0L H;  2ZR3 A;  1R3K C;  5C8Y B;  3W7U A;  2UXX A;  3OTO B;  3ASO C;  4BIU A;  2KG7 A;  4OPH A;  2YXL A;  4OGQ B;  2W6I G;  4FLV A;  3OE7 G;  4JI2 B;  2DQ0 A;  2GTS A;  1BGY H;  4O4I B;  5BY1 A;  4MW3 A;  3G80 A;  4JYY A;  3JSN A;  3CCU V;  4H33 A;  3JCU Z;  1S0V A;  1WB7 A;  1ARO P;  1YF2 A;  1THZ A;  1SQG A;  4X88 A;  1VQ6 V;  5LMU O;  1GH6 A;  2UUB O;  2R70 A;  1WPX A;  3T1Y O;  1URF A;  4GX1 A;  1ROP A;  4BIZ A;  4B3T O;  1M56 B;  2ZXW C;  2RCV A;  2OCH A;  2ZCE A;  3ZMT A;  4LWS B;  2FYU H;  4LF7 B;  3QO8 A;  4EB6 B;  2UXB O;  2DW4 A;  4U3J B;  3CRR A;  5C8Y A;  3ZRV A;  4P9P A;  5LGT A;  1BHB A;  3ZHT A;  3HKE B;  3KG2 A;  1OCO C;  5IWA B;  4LFA O;  1S76 D;  2DQ3 A;  4RO2 A;  4LF6 B;  3RN4 A;  2DJV A;  3BA8 A;  3CPW U;  1SQV H;  4NKG B;  4MVR A;  1JA8 A;  4X9Q A;  5KMG B;  3FB8 C;  3SPG A;  4J11 A;  3CEI A;  4IL6 Z;  4DR6 O;  3FYE B;  4D7T A;  3CCQ V;  4J9Y B;  5CA1 B;  1NU1 H;  1B6Q A;  1L8D A;  2UXC O;  2OCC B;  3KKY A;  3U10 A;  2AW9 A;  1OCZ C;  2B5U A;  2RNB A;  1HP8 A;  1XEQ A;  2EIL B;  4D7S A;  1TUE B;  1RM1 B;  5DED A;  4BAY A;  2XOK G;  4IYH A;  4TWK A;  3KCX A;  4LWS A;  2YIB A;  3CRA A;  5CBG A;  4I0X B;  4EB6 A;  4U3J A;  2ZKO A;  2A06 H;  2HEP A;  2Y0I A;  3GB7 C;  4AIL C;  5B1A C;  2ZQM A;  4DR1 O;  1I7F A;  4MVQ A;  4DUY B;  1PKX A;  3W7W A;  3HKE A;  3N2K A;  4W4L A;  2ILM A;  3ZIA G;  2ODM A;  3Q4H B;  1SQB H;  1YCI A;  5KUK A;  2ZNI A;  3HR0 A;  3F5W C;  3NXS A;  5KMG A;  4RWU A;  2VQF B;  1Z5V A;  5CA0 B;  5LA6 B;  3ETG A;  5CA1 A;  1IZ3 A;  5FNV B;  1VEW A;  2LO1 A;  4FZ1 A;  4X62 O;  1JX9 A;  2PI5 A;  3K0D A;  2QWQ B;  3ZRS A;  1B3Q A;  5IY5 C;  4PA3 A;  4YXW G;  4NR1 A;  1D5A A;  1PV0 A;  4FLU A;  3P30 A;  4DW0 A;  5A9G A;  4JI1 B;  2E76 B;  3P32 A;  1NJI W;  4I0X A;  3MAQ A;  2KSD A;  1YXB A;  3LDD A;  1TAE A;  4DR3 O;  2Y0P A;  2E3C A;  1BE3 H;  3L75 H;  1QVF U;  3B40 A;  3BAB A;  2OT5 A;  4QIW F;  4UVA A;  3E2E A;  3J81 N;  2DN9 A;  1MG1 A;  1BMF G;  1QU7 A;  3SYO A;  4EKW A;  2E5L O;  3SPC A;  1M90 W;  2VQE O;  4WCE V;  3Q4H A;  4ZKI A;  1FYJ A;  4F6E A;  1RPO A;  2JEU A;  1H2G A;  3APQ A;  4DV0 B;  2ITD C;  3JD4 A;  3BFR A;  1JFF A;  1QHT A;  3THO A;  5LYJ B;  2JK5 C;  3STZ C;  2GHY A;  3K08 A;  2WLN A;  5CA0 A;  5LA6 A;  2DWE C;  1Q90 D;  3OMI B;  4YY3 O;  4DV2 O;  3T1H O;  5FNV A;  1YHQ V;  1FFT B;  4QJF B;  3E8G A;  3E8H A;  3L73 H;  4LF4 O;  2OIG A;  3VQW A;  4JI7 O;  4EFB A;  1HWY A;  4JYC A;  1I08 A;  1K8A W;  5JJN B;  3L72 H;  4KXR A;  3K03 A;  1M56 C;  4UXN A;  5KUM A;  1YVW A;  2P90 A;  2Q6A A;  3BPZ A;  4LH6 A;  2DOS A;  4DV7 O;  2Y69 B;  5GW7 A;  2PYL A;  5LMU B;  4O4J B;  1OCC B;  2UUB B;  4U7O A;  3G6B A;  3T1Y B;  2VRZ A;  1XMO O;  1VQ8 V;  4B3T B;  1YTF D;  4MTG A;  4RUE A;  1BQ0 A;  4AHC A;  3ABT A;  3RT3 C;  2WWW A;  5JJJ B;  3LSS A;  4FLT A;  2M7W A;  1U96 A;  5LYJ A;  1F51 A;  1CPY A;  4BWA A;  5L3F A;  2UXD B;  3RYF B;  4J41 A;  2ZIM A;  3R65 A;  2OCC C;  1A32 A;  3EHB B;  1E1Q G;  4MT8 A;  3ASN B;  4XBF A;  1YJN V;  3WB1 A;  1Y74 B;  3CCS V;  4HNA B;  5H5N A;  2EIL C;  1RM1 C;  5IYB O;  4JI3 O;  4UFZ A;  3CC4 V;  1BHA A;  1ENV A;  2ARH A;  1DF4 A;  4DR6 B;  1QLE B;  4E2L A;  4LF8 B;  2A7W A;  1VF6 A;  2UXC B;  1Q86 W;  4O4J A;  4N21 A;  1ZSP A;  1KEC A;  1YJ9 V;  2XHB A;  1JOY A;  1GMG A;  3CRM A;  1YIT V;  3HPL C;  3M99 B;  1AIL A;  1YSC A;  4PDM A;  5KHH A;  1IBK B;  1X4T A;  2YIA A;  1YI2 V;  2WA4 A;  4GYC B;  4KL1 A;  1AI7 A;  5CB4 B;  2CDY A;  4K0K O;  2EIJ C;  3RVY A;  2HR3 A;  1FXK B;  5KHJ A;  4GKK O;  1NVP B;  1N32 O;  2X0L A;  3M8A A;  4TV8 B;  3BCC H;  4R50 A;  3FKS G;  2GDS A;  1NTK H;  3IC9 A;  1XNR O;  5EC2 C;  2K9P A;  4UUJ C;  4JYA B;  4HNA A;  3AG4 B;  3OFN G;  5HFM A;  3A0R A;  4YIP A;  4Z1V A;  2LGQ A;  3SPI A;  1GN3 A;  4I9Q A;  1K73 W;  1ZTE A;  2ITC C;  2VS0 A;  1Y67 A;  1WPB A;  3ABU A;  4X62 B;  1SKV A;  1SQX H;  1CP9 A;  2W6J G;  1IVS A;  4UCU A;  1PPJ H;  1WJZ A;  2PGG A;  5B3S B;  2W0X A;  4O4H B;  1JVM A;  1I94 O;  3PN1 A;  5EBM C;  5CB4 A;  2XAF A;  3OGC C;  2PUS A;  5CA3 A;  4DR3 B;  1FXK A;  3MHH C;  1EN4 A;  2UUA B;  2FKX A;  4LBE C;  4UV8 A;  4UVB A;  2HHH O;  2VQE B;  5EIB C;  4BR6 A;  5K1X A;  1DF5 A;  1EZJ A;  4MTX A;  3G6E V;  4NVP A;  1AJP A;  2A0L A;  3LSU A;  2Q68 A;  3K79 A;  4PDL A;  4DV2 B;  1COW G;  2WLH A;  3EXA A;  3E8B A;  2Y69 C;  3UT5 B;  4JAU A;  2XAG A;  1OCC C;  4RQF A;  2QKS A;  5DM6 V;  4LF4 B;  4JI4 O;  4JV5 O;  2M6Y A;  5BR8 O;  4GX5 A;  3UKM A;  1P84 F;  3HKB B;  5FLX N;  1M57 B;  4JGS A;  4QGP A;  1S72 V;  1XDC A;  4O2A B;  4DV4 B;  2HJD A;  1FPO A;  3ZX6 A;  2AZ2 A;  4IIJ B;  3K58 A;  2QM7 A;  2DWD C;  1NS1 A;  2YI9 A;  5LBQ A;  4QE9 A;  4MVS A;  1OCO B;  2RDC A;  1F4M A;  2OYQ A;  3JAR B;  2E75 B;  2VWJ A;  1BCC H;  1EZV H;  3K9A A;  3B4S A;  3ASN C;  2BTO A;  5EYP B;  2JRI A;  1S5L Z;  2P4K A;  3KCY A;  4FLZ A;  4W4K A;  3HKC B;  3WB2 A;  1QLE C;  1Y66 A;  5B1O A;  1NZ6 A;  5GON A;  3RYI B;  3UT5 A;  2YUA A;  1U97 A;  3EVK A;  4CS3 A;  1I5X A;  2G38 A;  1P7G A;  3SYQ A;  1H38 A;  2O57 A;  4KHP O;  4H44 B;  5IYD O;  3HKB A;  4JF3 A;  5JCO C;  4O2A A;  4JI3 B;  1EN6 A;  5LGN A;  3D3I A;  2Q7E A;  5LMN O;  1SA0 B;  2Q0A A;  4IIJ A;  1J5E B;  1K5S A;  1CXZ B;  1Q3E A;  4I50 A;  4GCZ A;  1QLN A;  1RP3 B;  1FXK C;  5KX5 B;  5FPO A;  4DV6 O;  1WB8 A;  2ADQ B;  3CP1 A;  2KKW A;  1XUQ A;  1NTZ H;  5JQG A;  2AZ0 A;  3CC7 V;  1S5J A;  5EYP A;  3DTU B; 
#chains in the Genus database with same CATH homology
 1RSO B;  1Y74 B;  1Y74 A;  3B40 A;  1ZL8 B;  1ZL8 A;  1Y76 B;  1Y76 A;  1VF6 A;  1VF6 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...