1Y76A

Solution structure of patj/pals1 l27 domain complex
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
62
structure length
62
Chain Sequence
b'NPAAEKMQVLQVLDRLRGKLQEKGDTTQNEKLSAFYETLKSPLFNQILTLQQSIKQLKGQLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords protein associated to tight junctions
molecule tags Transport protein
source organism Rattus norvegicus
publication title A unified assembly mode revealed by the structures of tetrameric L27 domain complexes formed by mLin-2/mLin-7 and Patj/Pals1 scaffold proteins.
pubmed doi rcsb
total genus 23
structure length 62
sequence length 62
chains with identical sequence C
ec nomenclature
pdb deposition date 2004-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09045 L27_2 L27_2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.650 Mainly Alpha Orthogonal Bundle Helix Hairpins L27 domain 1y76A00
1Y74A 1VF6C 1ZL8A 1ZL8B 1Y74B 1RSOB 1Y76B 1Y76A 3B40A 1VF6A
chains in the Genus database with same CATH superfamily
2DYRC 5KLVH 1M56C 4Q20A 1VQ4V 4DV7O 2DE0X 4B3SO 2GTSA 1N36B 4J41A 1I7FA 2AZ0A 2A3QA 3Q4HB 1TVKA 3M8AA 3JD3A 4QJFB 4PELA 1P7BA 2CTPA 3CCVV 2WA4A 4I5SA 3G4SV 1SQBH 4GX0A 1I94B 1KKDA 2QWPB 4CC6A 4MW3A 2YICA 1N32O 4GKJB 2YUAA 3CYOA 3E8FA 3TXQA 1YSCA 4EB6A 2YEVA 2DWEC 2EZOA 1ZTEA 2YIBD 4JYBA 4LP8A 1VF5B 1H2LA 4PV1B 1OHHG 1US6A 2O57A 5ITZB 1GTOA 1DLBA 2HJDA 2BTQB 2QWQB 5KX5B 3SR2C 1NT2B 2BTQA 2JGUA 5KHKA 4BWAA 4NVPA 1UJWB 3B8NA 2BTOA 2DQ3A 1RP3B 5KMGB 3APOA 3L72H 3N2KB 2CE4A 2PYJA 1LR1A 4QPJA 4GUNA 3E22B 3G6BA 3LNMB 3ZHTA 5FNVA 4I0XA 4MT8A 4JTDB 2UUCO 3CSXA 2WLNA 2Q9LA 4X20B 3FAVB 1MZEA 5BR8B 1O9HA 2ZE8A 2WLKA 5KUMA 5C8YA 3C3TA 3PN1A 4MVSA 1VQNV 5K1XA 1R3KC 3I5DA 3JSNA 4PI0A 4CH5A 3D8CA 3ML0A 2L6LA 2ZQMA 2AHZA 4OPAA 1GM7A 4I55A 5FPRA 4GKKO 3RVYA 2LGQA 4UUJC 4JI6B 4W4LA 2Y0IA 4CS2A 4K8ZA 1Q6UA 4BAYA 2Q6AA 4WFAV 1H2SB 2WA3A 3ETDA 1SS3A 1JQ0A 4HBNA 5LA6B 3RYCA 2CGOA 1K34A 5LA6A 4I50A 4JYCA 2GSMB 5CA0A 1N8RW 3OUFA 3ZMTA 3IC9A 2ADQB 3IJ4A 4FMTA 2EZPA 1DF4A 3K9AA 1HW7A 4FZ1A 3L75H 1FKAO 4LF9O 4ZOLA 4PHZA 2IH3C 2LP7A 2E5LO 1QCEA 1SA0A 2OT5A 1K5QA 2XOKG 4JI4B 4LF8O 4KHPB 3HKCA 4MVZA 3ZEDA 2CUGA 2Y0PA 3OMAB 3LDDA 2LGWA 3GVMA 4DUZB 1Q6IA 4GX1A 5JCOA 5EIBD 2YI8A 1B3QA 1SQQH 4BW9A 1BS3A 4OX9B 1YJ9V 3JARB 4X1IA 2VQFB 1S5JA 4LF4O 2H8PC 4X62O 4K35A 2YI9A 3ZHVA 3DXRA 4PDMA 2A0LA 1EFRG 4WFHA 1QR9A 5DM6V 1VQLV 2EIMB 5LL6Y 4PD4F 3G71V 4AILC 3T1YO 4N21A 1HP8A 3ASNC 3CCLV 2HFEC 4DV0B 2QTOA 2QWRB 1F4MA 3TK1A 3RN4A 3BEHA 1WP8A 1WA8B 2QTSA 4DV4O 4X89A 1J5EO 5KUKA 3K0DA 3K08A 3JD4A 1XQ8A 3Q4HA 3OUSA 3N2GB 1AI6A 3JASB 3F5TA 4J7JA 1XBLA 1COWG 1MOFA 4X9QA 1EBOA 2UXBO 4MTXA 3CMAV 2PI4A 5FPOA 3ZHQA 4DR4B 3OTOB 4LR3A 5IJ0B 2Q7EA 1FXKB 1I5YA 2BOCC 4KL1A 3B09A 2F4VB 3SYAA 4LWSB 2PI5A 4J11A 2KG7B 2HG5C 2CK3G 3H1IH 1NR7A 4GKJO 1OCZB 1HNXB 1RPRA 2B9ZA 4FFKA 5HFMA 5B1NA 5IWAB 2P5OA 4FK5C 3EFFK 3E22A 4YIPA 1W0KG 4UCRA 2DJVA 5CA0B 5B1AC 1BGYH 2JIZG 2ZE7A 3AG4B 1KBHA 4I9QA 3WB2A 3P3NA 4DV1O 3QO8A 4R7CA 3D36C 3CB2A 4TV8A 2UUCB 2EIJB 1OCCB 2FTKA 4OPHA 3CRCA 1S5LZ 1SZXA 4LWSA 3OTFA 5CMUA 2IBZH 5JWPA 4RAIA 2Q7GA 2ZXWB 3IGAC 3E83A 5K1PA 4QGPA 1M56B 3HKEB 1Y76B 1GN4A 4XBFA 3ASNB 4X88A 2UUBB 2X7RB 1Y4MA 1K73W 2W6IG 5JQGA 2BE3A 3H01A 4FM0A 1IBLB 4ZIBA 3N2GA 2JGDB 3E86A 4PA3A 3CC4V 3BABA 1JA8A 3J7AU 4AQYO 4DR1B 1YZBA 4A5UB 1Q81W 2GBOA 2W0FC 2VS0A 4JV5B 1SF9A 2CTRA 3OM3B 4H37A 4DR2O 1IBKB 4P9OA 2ZR2A 4X1KB 1VQOV 3D3QA 5BMVB 1R6TA 4MTOA 1DF5A 2E75B 5L3CA 1SQXH 3JCUZ 1XMQB 1N4CA 2IW5A 3K5NA 3JALB 2P67A 1M9NA 1Y76A 4NTWA 4D7TA 5KHIA 1TUBB 1E1QG 4K0KO 4CH6A 1L1FA 2FB5A 1P7GA 4LNUA 5LHHA 4WFBV 2DYSB 4KHPO 1IBMO 2LW1A 2W6JG 2LQTA 1YCIA 4DUYO 2XAHA 5LGNA 2VWKA 4J42A 2V4DA 1I0HA 3FD9A 4U3JB 5LP6A 3UM7A 3L71H 2RNBA 3SJBC 3K59A 5DN6G 2X6AA 1KUQA 3ZHUA 1G8MA 4IYHA 3I55V 3SGIA 1URFA 2WLIB 1GKFA 3F7YC 3RBZA 5IYBO 4TQFA 4UB8Z 5LHGA 3RYFB 1SRYA 1E79G 4UCUA 4JASA 4C7UA 4CZZA 4FLTA 2QKAA 1QHTA 4BW5A 5JJJB 1Q90D 4DR6B 4I4TA 1QBZA 4EB6B 1GO3F 3U11A 5A9GA 5LMNB 4NB5A 1Z2GA 3RFRA 4CH3A 3JATB 4JAVA 2RJZA 5JH7A 1YVWA 2LFRA 1XOUA 2ZT9B 1PV0A 1OCRC 1BHBA 4LFCB 1LUWA 3E8HA 1AP5A 1NU1H 1H8EG 2F93B 4HAMA 4O4HA 1UFIA 1YJNV 1OCZC 2B1GA 4R8CA 4NTYA 3JAMN 3OW2U 4MVRA 1NBMG 1LUVA 1O9GA 5L3GA 1Y66A 2CH7A 2EINB 1RPOA 4J9ZB 4OXSA 1K97A 3VOUA 2CTQA 2UXCO 4CH4A 2YIDA 5EBWC 1PM9A 4ZI7B 4Z1MG 1JMKC 3CRQA 3QO7A 1N33B 3EVKA 5EZYB 1NVPD 3S3WA 1HR0O 2JEUA 4UCVA 3UQ8A 4DV2O 3UO3A 2P4KA 4JZGA 3STLC 3AG2B 1YJWV 1YEWA 4JI1O 4F6EA 2F95B 1MSDA 4I9WA 5LMUB 2P90A 4AHCA 4B08A 3E89A 1Q5OA 1AR5A 3K79A 2BOBC 4RQEA 4DYLA 1HNZB 4P2ZA 1K8AW 1VARA 2AGAA 5L3EA 4H13B 1JX9A 4B7EA 3PJSK 4DV5O 3E35A 4ICGA 2N74A 3G6EV 3E8GA 4G2KA 2AZ2A 4FVMA 2UU9B 1Z5VA 1AP6A 3VQYA 3AG1C 1HNWO 1CPYA 1MZFA 3TGUH 2QKSA 4MTFA 2HJFC 1MA1A 2EIJC 1Y67A 1AJQA 2N04A 4UFZA 4O4LB 1BQ0A 3ABUA 3HKDB 2A79B 3WFVA 2G38A 3GWKC 2UUBO 1MSWD 1PNKA 4FM1A 1Q82W 4X1KA 4WFGA 2ZXWC 1R6NA 1BZKA 5LGUA 2RN9A 2YC0A 4RO2A 4PJ0Z 1QQCA 2OCCC 1TAEA 1FJGO 3H9VA 3ASOB 3ABMC 5BY1A 3RYIA 1QR8A 4QNHB 1GN2A 1PNLA 2XAJA 4G27B 1QVGU 2ZDIC 3L70H 3ZJZA 5ITZA 4YHHO 4DV3B 5FL7G 4EFEA 2YXYA 1AR4A 4DR1O 1ROPA 1VP7A 4DR7B 2XAFA 5GONB 2HR3A 3HKDA 1FXHA 3BA8A 3A0BZ 1SQVH 1KC8W 4LF7B 2EIKC 3UCSC 5BZBA 4YJ3A 5LOVB 3HR0A 4RQFA 4B3TO 1THZA 2PUSA 2D2CB 4DRXB 2BSKA 5KHJA 3H1LH 5JVDA 4DR3B 1RFYA 3UKMA 2FKXA 3L9DA 1JFFA 2OIGA 1CEZA 5B3SB 3B4SA 3N27A 5IYDO 2VRZA 1P84F 5GONA 1H2MA 3CD6V 4JI8B 2ZNJA 5C8YB 2PY5A 5JCOC 4JI2B 2LW7A 4I4TB 5EC2C 4I55B 4O4IA 5GTHZ 3CCEV 4Z1VA 3HKEA 2YS8A 4JI5B 4LF6O 2R9IA 4X65B 3FYIB 3TCUA 4GZRB 1WB8A 3BFRA 1SESA 4TT3G 3ABLB 2AXTZ 4N23A 2DWDC 5IJ9B 4X1YB 3GWOA 2IH1C 5IJ9A 3C3SA 2WLJA 4X64B 2EULA 3R66A 5EIBC 4NR1A 2PF4E 3ABKC 4YJ2A 2EINC 4OGQB 4JI3B 2OCHA 1HDJA 3CCSV 5FNVB 3B40A 5J9PC 4IHJB 1YF2A 1KECA 2OWOA 1Y6XA 2AHYA 1S5HC 2MW2B 4FLYA 1GM8A 4I50B 1IXBA 3SYQA 2IM9A 4D7SA 1I08A 2L35A 4MSWC 4TV9A 2R9RB 3B2EE 2XTAA 4JPRA 5EBLC 1KMIZ 1XNRO 3IC7A 1RM1B 4JI7O 4LFAB 2A7WA 2HLDG 1XMOO 5LBQA 1NTZH 1D2DA 1XDCA 4FFBA 3K9SA 2UXDO 2QWNB 1N36O 1A32A 5CBFA 4WCEV 1H38A 2PTMA 4IIJA 1L8DA 5JJEB 1XNQB 2RQ6A 1I94O 3K0GA 1Q3EA 1N33O 3KKYA 1SETA 2JDIG 1OV9A 1GRJA 3T4ZA 4DV2B 1ENVA 2JJ1G 3AG1B 3AK2A 4JI1B 3UT5A 3K3WA 1K4CC 5J2UA 4PA7A 2QJ1A 3H1HH 5B3SC 4UVCA 3AG7A 1WA8A 1K4DC 4FPPA 1R1BA 3D3IA 1VF6C 2EIMC 4DV5B 4JYAO 5KAIZ 4P30A 1RSOB 3K5MA 5B1OA 3OT7A 1F23A 3L73H 3ABMB 2NN4A 4TQDA 1HNWB 1QNMA 3A8TA 5BR8O 1R3JC 2XUMA 1TUBA 4I7ZB 5EK0A 1TUEB 4R50A 3MHHC 1M1KW 3CCRV 3CEIA 3SJAC 2EILB 5H6QA 3OGIB 3QF7A 2WLMA 5EBMC 3RT3C 1Z5WA 1V54C 2JVDA 3W7XA 1XI1A 1ZLZA 4QE9A 1K92A 1MABG 1FJGB 3CXCU 1DGSA 1PL0A 5IYZB 4YY3O 4WBNA 2QDOA 2ITCC 4JI6O 4TWKA 3P3PA 2OTJV 1IURA 2IJIA 1ZWIC 1AI7A 2YXLA 4YHHB 4DV3O 1VQ9V 1FXKA 3FB8C 3ASOC 1Y74B 2JK5C 4JGSA 1EM1A 3CCUV 1MNGA 5IT9N 3GB7C 4DV6B 4PI2A 2HVKC 1JFFB 3ZMSA 2WWWA 4TUYB 4ZHQB 4CBCA 3KCYA 2F23A 3ABTA 4LF9B 3FX7A 2E5LB 1B06A 2MK3A 1IZ3A 2ZCEA 1YIJV 4EKWA 4TV8B 4X66B 4EFBA 2ZM6O 3BPZA 3T2MA 4JI4O 4B7KA 3EXAA 1LNQA 4PA6A 2Q67A 2Z5UA 2EJ7A 5IYZA 2C2AA 4MS2A 1BHAA 1Q86W 4F4LA 4PA4A 4JI2O 3O9OA 1SQFA 5CA1B 3SPIA 2VQFO 3WB1A 4LF4B 2IJHA 2NR5A 5FLXN 4PA9A 4E4EA 3RGBA 1NS1A 4H0LB 2WLIA 3HKCB 2FYUH 3OAAG 4GCZA 4TSFG 1XHXA 3CJHA 3RVZA 3F7VC 3JATA 3ZRXA 5LXTA 1F7YA 1PPJH 2OCCB 5J2UB 4MVQA 4MVMA 1RM1C 3AEIA 1NH2D 2N05A 5H9CA 3ZHRA 2CGNA 1GN3A 4X64O 2YIAA 1QU7A 3A0HZ 1YI2V 1V55C 3CRAA 3SPHA 2Y4TA 5H5NA 4DV0O 4JI3O 1KB9F 2GDSA 4UCTA 1AJPA 2ITDC 2EILC 3X2QB 2A9HA 1J5EB 1Q8IA 2RMKB 2Q4PA 1YITV 2R72A 1NTMH 1K5SA 4IIJB 4B3SB 4DW0A 5KA6A 3RYHA 1OJHA 3QTCA 4BIUA 4FLZA 3ZRWB 4P9PA 5EZYA 3SYCA 2IJKA 1WP7A 2UXDB 2ZR3A 1W2BU 4DXWA 1KU9A 3CPWU 5J2TB 4O2BB 3B8MA 5CN0A 1VQ5V 2F4VO 3DGEA 2D3OW 2CAZC 1K9MW 1N34O 1XNQO 4LF5B 2F1MA 1PP9H 3U10A 2Q0AA 5AG2A 3VBBA 1D5NA 3LSQA 2B5UA 4L8JA 1YTFB 3THOA 2M6YA 2E74B 1H8HG 5IWAO 4F6RA 3L74H 1VQ8V 3SPGA 4LC1A 5L3BA 1XL4A 1OCOB 3K04A 1W0JG 2QM4A 2JGDA 2W0XA 2ZIOA 3OFNG 4LH6A 3JAWA 4ZBMA 4YJ3B 5LOVA 2RDCA 4YJ2B 4CS4A 3OEHG 5KAFZ 1AI5A 2XNDG 5B66Z 1W59A 4XDJA 4NXNO 5LYJA 4O2AA 3SJQC 2YIBA 2PYLA 1R73A 2Q7HA 4U3JA 1SKVA 2EJRA 1BT8A 2V7QG 1QLEC 2QKCA 1GK9A 4RUEA 1B6QA 2IJJA 3BA9A 1P49A 3EHBB 1ZAUA 3FFQA 1XILA 2IU3A 4GKKB 4K3AA 3WB0A 4QPKA 1H2NA 2FL4A 1IXMA 2GHYA 5CBHA 3K5LA 3CJHB 4KUMA 3ZS8C 4JTAB 1WAZA 2HHHB 3K03A 4KFMA 1GM9A 5IY5C 1ZL8A 1JOYA 2UUAO 1YHQV 1U97A 3WG7B 3LNNA 2LFSA 2VQEO 3MD0A 1Q43A 1NKDA 4FJCC 1ORQC 3VQWA 2P4VA 1FFXA 5LHIA 4JV5O 1CXZB 4IT5A 1FYJA 4DV6O 2WLHA 4DR2B 4GLXA 3F5WC 3IFXA 2ZIMA 3T1HO 4UB6Z 2ZDIA 3JAKA 3HPLC 1JCHA 1JPXA 1XMQO 1FFTB 1N0NA 4LF8B 3CRMA 2KQXA 4O4JA 1SC5B 4BIOA 2JRIA 5LXTB 3E8BA 4JZ2A 2A06H 4K0KB 2Y69B 2ILMA 3B77A 4BIZA 4F6RB 4FIPC 3STZC 1IBMB 3SPJA 4DUYB 4L87A 3FYEB 4NXMB 1FFXB 3CMEV 2RCVA 2CTWA 4X62B 4J80A 5C93A 1NQTA 5JVDB 2X6CA 4FZ0A 1S77D 2ATKC 1VQKV 3ZCCA 4EEQA 4MTGA 4QIWF 5B1BB 1M57B 2DOSA 3VQVA 3T1YB 3TXSA 1OZ0A 4ZHQA 2JJ2G 2DQ0A 1VQ6V 4LBEC 4H33A 1NTKH 1G6UA 3JSLA 3SPCA 1TGOA 3E2EA 4FLUA 2Q73A 2GUZA 5JJNB 4DV4B 1QLEB 4U3FH 5LMNO 3CE2A 3DC5A 3R65A 5JH7B 4FLWA 2E3CA 2QA4V 1BQZA 3ABLC 3BCCH 3LSUA 4FFBB 2Q0OC 1IDSA 2UXBB 3K58A 3JARA 1KP3A 1SQGA 4ZOLB 3WU2Z 1DTOA 3TJTA 4DR4O 2K9PA 5GW7A 2GV9A 4LFCO 5EC1C 4TUYA 2HP8A 3OTOO 2UXXA 5KHGA 5CA1A 4O4LA 1KYOF 1KD1W 4ABMA 5KA5A 1GMGA 1Q6HA 1AILA 2Q5ZA 4QE7A 1FD9A 4Q6GA 3ZMUA 1H2GA 1EZVH 5L3DA 3W7TA 3OGCC 4PDVA 1FXVA 5B5EZ 2YXHA 1MMMA 1K33A 1HNXO 1NVPB 2KB1A 3LDCA 4D6TH 1N34B 3N2KA 3HKBA 4O2BA 2QEXV 4LF5O 2QM8A 1AJNA 2GTAA 2WSSG 4E2LA 2IU0A 4B3RO 3SDLA 3FB5C 3KZIZ 2M7WA 3G80A 3QO5A 4JAAA 3FAVA 1M93A 2P6JA 2EX3A 1KQSU 4HNAA 4JYYA 5KX5A 2QWOB 2P7TC 2OYQA 1RSOA 1IX9A 5LMUO 2EIKB 2XASA 2P22C 4KXRA 5D5QA 4DV1B 1PL4A 4O2AB 3RYHB 3UT5B 2WLLB 4UV9A 5LP6B 2ARHA 5IE9A 3AG4C 1BL8A 4J7ZA 2WLLA 1NH2B 2JEXA 1AI4A 3G67A 4TV9B 3JASA 3SJCC 1R3IC 3CCQV 5J2TA 5KMGA 3X2QC 4NXNB 3ABKB 3KG2A 3ZMZA 3H1KH 3H1JH 2E76B 3RWRD 3DSQA 1XHZA 2H94A 5DEDA 4IYIA 1VF7A 2XAQA 1EN5A 1ZX3A 2LO1A 4TOIA 2X6BA 3AG3B 2CDYA 4BR6A 1IBLO 1ZUQA 1DK1A 1FS0G 4O4IB 3I56V 4X1IB 5E79Z 4HYOA 1YDXA 3JD2A 3K5OA 3CX5F 3CCJV 4GYCB 3OE7G 3K57A 4FM2A 1F4NA 3A2FA 1S3JA 5E1AC 5CA3A 4AQYB 2HHHO 3ZHSA 1R3LC 2UUAB 1K3EA 2H3OA 5BXZA 1JJOA 3ZX6A 1Y74A 4MVUA 2VQEB 3ZIAG 1IBKO 3JD0A 4O4JB 2ETNA 2EBOA 3ZRVA 2DMXA 5IY5B 5EYPA 3CXHF 4DR7O 3ICXA 5H6RA 4UVBA 2VWJA 2OIEA 3JCZA 4LF7O 4NTXA 1VQPV 5JQGB 1AVMA 2Q69A 4B3TB 4PDRA 3SYPA 3T1HB 1FXKC 5DECA 1BMFG 1IVSA 1OCCC 4LH7A 4X1YA 3OMNB 3BAAA 4KP4A 5B1BC 3QG5A 4IGGA 2BCCH 4JI0O 1QVFU 4HNAB 1S0VA 2DYSC 3U0ZA 5CB4B 1NJIW 3LUTB 1SQPH 3CHXA 1F51A 4NXMO 1WJZA 5KHHA 4DW1A 5H2FZ 4JTCB 4JI8O 5B1AB 4LFBO 2NNUA 2YDEA 4DR5B 1WN7A 1VEWA 1JJ2U 1K7DA 3M7MX 4DR6O 3HB3B 4WFFA 1XL6A 4JI5O 4NYKA 4WBNB 4LF6B 3S3XA 1M90W 3ZN1A 3W7SA 4Z2WA 4AI8A 3OR7C 4O4HB 4YIOA 1GH6A 1M4UA 3JAKB 1XUQA 2K1EA 3C90A 3P32A 3J80N 1V9PA 5CB4A 4B3MB 4GX5A 1V54B 1VF6A 2ZE6A 2QM7A 1WPXA 4UV8A 2ZINA 3OD4A 1SERA 3LSSA 4J9YB 5IJ0A 3TETA 5L3FA 4G28B 3AK1A 3NXSA 3LDEA 2X0LA 4UVAA 4CS3A 1PKXA 4DK0A 3CP1A 2YSUB 3ZRSA 4DV7B 3W7UA 1GN6A 3K06A 5IDJA 3UO2A 3RYIB 2ODMA 3HKBB 1XNRB 1E1RG 1VMGA 4YXWG 5LYJB 4JI7B 4LFAO 1XMOB 2UXCB 2NLJC 4MVOA 1G1XB 2HVJC 3QVNA 3DC6A 1S72V 4K8XA 1N32B 1BCCH 4UCSA 5LP6C 4CC5A 1BSMA 1CP9A 2WAMA 1L0NH 1N0JA 1HR0B 2QGNA 1NI8A 3JYCA 2V1DA 2KSDA 3JALA 2QSAA 3RW0A 1D5AA 2AW9A 1NZ6A 4B3RB 2R9AA 4U7NA 3BRCA 1UPGA 1WLEA 2Y4UA 3JAWB 1FPOA 1VQ7V 2DW4A 3AG2C 3MHSC 3O65A 2LJ2A 1NR1A 2XAGA 1HNZO 1Q7YW 4UXNA 1GAXA 1SA0B 5TISZ 1BE3H 5LGTA 2JS3A 4WFEA 4FLVA 1EN6A 3W7WA 3M99B 1X59A 2ZKOA 4WF9V 4X8AA 1EN4A 3NR7A 2UU9O 3FB7C 2JS5A 1JVMA 2Q8VA 4FLXA 2R70A 3JD1A 2Z3YA 1WPBA 5HFLA 4PDLA 4JYAB 3P30A 2F43G 1V55B 3ETQA 1XEQA 1KKCA 1R6KA 1L0LH 2KKWA 4W4KA 3BVOA 1VQMV 3OR6C 3ZBHA 4X20A 2CH7B 1M5IA 3ZMVA 3CWBH 3OMIB 5F2VO 5GTIZ 2DN9A 2DYRB 2HEPA 1X4TA 4IHJA 3VQXA 3RYCB 2Y48A 1G4YB 2Q68A 1KP2A 2B1IA 3MAQA 2ZE5A 4YY3B 1FAFA 3OEEG 2HKOA 3T1CA 1OCRB 3AK3A 1JR9A 4J7KA 3D36A 1TVKB 4XDKA 5CBGA 2YEVB 4MW8A 4GX2A 2F66C 3BY6A 2ZNIA 1PD3A 3APQA 4DK1A 1ZSPA 2OTLV 2GUZB 4DR3O 4H44B 1SZTA 2BSKB 2FMLA 4LNUB 5D5PA 4XDLA 3WG7C 3FB6C 3KCXA 4JAUA 3RYFA 3ZRWA 1EZJA 2QR4A 1PNMA 4JI0B 1T5EA 2UXNA 4X66O 4DUZO 3T4DA 2ZM6B 2Z0AA 2KG7A 3QNEA 3CCMV 1YTFD 3ETEA 1B04A 4OX9O 1P4RA 3MDSA 3IAYA 2QE7G 1AR1B 3DTUB 4X65O 4ZI7A 4I0XB 3AG3C 4LFBB 3ETGA 5IYCO 2Y69C 4HZ3A 4J10A 4DR5O 3CRRA 2P06A 2XHBA 4DRXA 4ASUG 1H2KA 5EYPB 1ZL8B 4R6ZA 2WPDG 2PGGA 4ZKIA 1XREA 1AB3A 4U7OA 3CC2V 1OCOC 5BMVA 4RWUA 1QLNA 1VIBA 3A0RA 4GT1A 4B3MO 1J95A 2XT9A 3ZN0A 1S76D 1I5XA 3CC7V 1U96A 3J81N 3CS5A 5A2QN 1WB7A 1M57C 4RUFA 1WNSA 3FKSG 2PZSA 3BHPA 2ADPA 1YXBA 4IL6Z 4UCOA 1HWYA 3DXRB 4DO2A 1TA8A 3SYOA 4LCUC 2ZD9A 4NKGB 4JF3A 1MG1A 1AROP
chains in the Genus database with same CATH topology
1Y74A 1VF6C 1ZL8A 1ZL8B 1Y74B 1RSOB 1Y76B 1Y76A 3B40A 1VF6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y74 A;  1VF6 C;  1ZL8 A;  1ZL8 B;  1Y74 B;  1RSO B;  1Y76 B;  1Y76 A;  3B40 A;  1VF6 A; 
#chains in the Genus database with same CATH topology
 2DYR C;  5KLV H;  1M56 C;  4Q20 A;  1VQ4 V;  4DV7 O;  2DE0 X;  4B3S O;  2GTS A;  1N36 B;  4J41 A;  1I7F A;  2AZ0 A;  2A3Q A;  3Q4H B;  1TVK A;  3M8A A;  3JD3 A;  4QJF B;  4PEL A;  1P7B A;  2CTP A;  3CCV V;  2WA4 A;  4I5S A;  3G4S V;  1SQB H;  4GX0 A;  1I94 B;  1KKD A;  2QWP B;  4CC6 A;  4MW3 A;  2YIC A;  1N32 O;  4GKJ B;  2YUA A;  3CYO A;  3E8F A;  3TXQ A;  1YSC A;  4EB6 A;  2YEV A;  2DWE C;  2EZO A;  1ZTE A;  2YIB D;  4JYB A;  4LP8 A;  1VF5 B;  1H2L A;  4PV1 B;  1OHH G;  1US6 A;  2O57 A;  5ITZ B;  1GTO A;  1DLB A;  2HJD A;  2BTQ B;  2QWQ B;  5KX5 B;  3SR2 C;  1NT2 B;  2BTQ A;  2JGU A;  5KHK A;  4BWA A;  4NVP A;  1UJW B;  3B8N A;  2BTO A;  2DQ3 A;  1RP3 B;  5KMG B;  3APO A;  3L72 H;  3N2K B;  2CE4 A;  2PYJ A;  1LR1 A;  4QPJ A;  4GUN A;  3E22 B;  3G6B A;  3LNM B;  3ZHT A;  5FNV A;  4I0X A;  4MT8 A;  4JTD B;  2UUC O;  3CSX A;  2WLN A;  2Q9L A;  4X20 B;  3FAV B;  1MZE A;  5BR8 B;  1O9H A;  2ZE8 A;  2WLK A;  5KUM A;  5C8Y A;  3C3T A;  3PN1 A;  4MVS A;  1VQN V;  5K1X A;  1R3K C;  3I5D A;  3JSN A;  4PI0 A;  4CH5 A;  3D8C A;  3ML0 A;  2L6L A;  2ZQM A;  2AHZ A;  4OPA A;  1GM7 A;  4I55 A;  5FPR A;  4GKK O;  3RVY A;  2LGQ A;  4UUJ C;  4JI6 B;  4W4L A;  2Y0I A;  4CS2 A;  4K8Z A;  1Q6U A;  4BAY A;  2Q6A A;  4WFA V;  1H2S B;  2WA3 A;  3ETD A;  1SS3 A;  1JQ0 A;  4HBN A;  5LA6 B;  3RYC A;  2CGO A;  1K34 A;  5LA6 A;  4I50 A;  4JYC A;  2GSM B;  5CA0 A;  1N8R W;  3OUF A;  3ZMT A;  3IC9 A;  2ADQ B;  3IJ4 A;  4FMT A;  2EZP A;  1DF4 A;  3K9A A;  1HW7 A;  4FZ1 A;  3L75 H;  1FKA O;  4LF9 O;  4ZOL A;  4PHZ A;  2IH3 C;  2LP7 A;  2E5L O;  1QCE A;  1SA0 A;  2OT5 A;  1K5Q A;  2XOK G;  4JI4 B;  4LF8 O;  4KHP B;  3HKC A;  4MVZ A;  3ZED A;  2CUG A;  2Y0P A;  3OMA B;  3LDD A;  2LGW A;  3GVM A;  4DUZ B;  1Q6I A;  4GX1 A;  5JCO A;  5EIB D;  2YI8 A;  1B3Q A;  1SQQ H;  4BW9 A;  1BS3 A;  4OX9 B;  1YJ9 V;  3JAR B;  4X1I A;  2VQF B;  1S5J A;  4LF4 O;  2H8P C;  4X62 O;  4K35 A;  2YI9 A;  3ZHV A;  3DXR A;  4PDM A;  2A0L A;  1EFR G;  4WFH A;  1QR9 A;  5DM6 V;  1VQL V;  2EIM B;  5LL6 Y;  4PD4 F;  3G71 V;  4AIL C;  3T1Y O;  4N21 A;  1HP8 A;  3ASN C;  3CCL V;  2HFE C;  4DV0 B;  2QTO A;  2QWR B;  1F4M A;  3TK1 A;  3RN4 A;  3BEH A;  1WP8 A;  1WA8 B;  2QTS A;  4DV4 O;  4X89 A;  1J5E O;  5KUK A;  3K0D A;  3K08 A;  3JD4 A;  1XQ8 A;  3Q4H A;  3OUS A;  3N2G B;  1AI6 A;  3JAS B;  3F5T A;  4J7J A;  1XBL A;  1COW G;  1MOF A;  4X9Q A;  1EBO A;  2UXB O;  4MTX A;  3CMA V;  2PI4 A;  5FPO A;  3ZHQ A;  4DR4 B;  3OTO B;  4LR3 A;  5IJ0 B;  2Q7E A;  1FXK B;  1I5Y A;  2BOC C;  4KL1 A;  3B09 A;  2F4V B;  3SYA A;  4LWS B;  2PI5 A;  4J11 A;  2KG7 B;  2HG5 C;  2CK3 G;  3H1I H;  1NR7 A;  4GKJ O;  1OCZ B;  1HNX B;  1RPR A;  2B9Z A;  4FFK A;  5HFM A;  5B1N A;  5IWA B;  2P5O A;  4FK5 C;  3EFF K;  3E22 A;  4YIP A;  1W0K G;  4UCR A;  2DJV A;  5CA0 B;  5B1A C;  1BGY H;  2JIZ G;  2ZE7 A;  3AG4 B;  1KBH A;  4I9Q A;  3WB2 A;  3P3N A;  4DV1 O;  3QO8 A;  4R7C A;  3D36 C;  3CB2 A;  4TV8 A;  2UUC B;  2EIJ B;  1OCC B;  2FTK A;  4OPH A;  3CRC A;  1S5L Z;  1SZX A;  4LWS A;  3OTF A;  5CMU A;  2IBZ H;  5JWP A;  4RAI A;  2Q7G A;  2ZXW B;  3IGA C;  3E83 A;  5K1P A;  4QGP A;  1M56 B;  3HKE B;  1Y76 B;  1GN4 A;  4XBF A;  3ASN B;  4X88 A;  2UUB B;  2X7R B;  1Y4M A;  1K73 W;  2W6I G;  5JQG A;  2BE3 A;  3H01 A;  4FM0 A;  1IBL B;  4ZIB A;  3N2G A;  2JGD B;  3E86 A;  4PA3 A;  3CC4 V;  3BAB A;  1JA8 A;  3J7A U;  4AQY O;  4DR1 B;  1YZB A;  4A5U B;  1Q81 W;  2GBO A;  2W0F C;  2VS0 A;  4JV5 B;  1SF9 A;  2CTR A;  3OM3 B;  4H37 A;  4DR2 O;  1IBK B;  4P9O A;  2ZR2 A;  4X1K B;  1VQO V;  3D3Q A;  5BMV B;  1R6T A;  4MTO A;  1DF5 A;  2E75 B;  5L3C A;  1SQX H;  3JCU Z;  1XMQ B;  1N4C A;  2IW5 A;  3K5N A;  3JAL B;  2P67 A;  1M9N A;  1Y76 A;  4NTW A;  4D7T A;  5KHI A;  1TUB B;  1E1Q G;  4K0K O;  4CH6 A;  1L1F A;  2FB5 A;  1P7G A;  4LNU A;  5LHH A;  4WFB V;  2DYS B;  4KHP O;  1IBM O;  2LW1 A;  2W6J G;  2LQT A;  1YCI A;  4DUY O;  2XAH A;  5LGN A;  2VWK A;  4J42 A;  2V4D A;  1I0H A;  3FD9 A;  4U3J B;  5LP6 A;  3UM7 A;  3L71 H;  2RNB A;  3SJB C;  3K59 A;  5DN6 G;  2X6A A;  1KUQ A;  3ZHU A;  1G8M A;  4IYH A;  3I55 V;  3SGI A;  1URF A;  2WLI B;  1GKF A;  3F7Y C;  3RBZ A;  5IYB O;  4TQF A;  4UB8 Z;  5LHG A;  3RYF B;  1SRY A;  1E79 G;  4UCU A;  4JAS A;  4C7U A;  4CZZ A;  4FLT A;  2QKA A;  1QHT A;  4BW5 A;  5JJJ B;  1Q90 D;  4DR6 B;  4I4T A;  1QBZ A;  4EB6 B;  1GO3 F;  3U11 A;  5A9G A;  5LMN B;  4NB5 A;  1Z2G A;  3RFR A;  4CH3 A;  3JAT B;  4JAV A;  2RJZ A;  5JH7 A;  1YVW A;  2LFR A;  1XOU A;  2ZT9 B;  1PV0 A;  1OCR C;  1BHB A;  4LFC B;  1LUW A;  3E8H A;  1AP5 A;  1NU1 H;  1H8E G;  2F93 B;  4HAM A;  4O4H A;  1UFI A;  1YJN V;  1OCZ C;  2B1G A;  4R8C A;  4NTY A;  3JAM N;  3OW2 U;  4MVR A;  1NBM G;  1LUV A;  1O9G A;  5L3G A;  1Y66 A;  2CH7 A;  2EIN B;  1RPO A;  4J9Z B;  4OXS A;  1K97 A;  3VOU A;  2CTQ A;  2UXC O;  4CH4 A;  2YID A;  5EBW C;  1PM9 A;  4ZI7 B;  4Z1M G;  1JMK C;  3CRQ A;  3QO7 A;  1N33 B;  3EVK A;  5EZY B;  1NVP D;  3S3W A;  1HR0 O;  2JEU A;  4UCV A;  3UQ8 A;  4DV2 O;  3UO3 A;  2P4K A;  4JZG A;  3STL C;  3AG2 B;  1YJW V;  1YEW A;  4JI1 O;  4F6E A;  2F95 B;  1MSD A;  4I9W A;  5LMU B;  2P90 A;  4AHC A;  4B08 A;  3E89 A;  1Q5O A;  1AR5 A;  3K79 A;  2BOB C;  4RQE A;  4DYL A;  1HNZ B;  4P2Z A;  1K8A W;  1VAR A;  2AGA A;  5L3E A;  4H13 B;  1JX9 A;  4B7E A;  3PJS K;  4DV5 O;  3E35 A;  4ICG A;  2N74 A;  3G6E V;  3E8G A;  4G2K A;  2AZ2 A;  4FVM A;  2UU9 B;  1Z5V A;  1AP6 A;  3VQY A;  3AG1 C;  1HNW O;  1CPY A;  1MZF A;  3TGU H;  2QKS A;  4MTF A;  2HJF C;  1MA1 A;  2EIJ C;  1Y67 A;  1AJQ A;  2N04 A;  4UFZ A;  4O4L B;  1BQ0 A;  3ABU A;  3HKD B;  2A79 B;  3WFV A;  2G38 A;  3GWK C;  2UUB O;  1MSW D;  1PNK A;  4FM1 A;  1Q82 W;  4X1K A;  4WFG A;  2ZXW C;  1R6N A;  1BZK A;  5LGU A;  2RN9 A;  2YC0 A;  4RO2 A;  4PJ0 Z;  1QQC A;  2OCC C;  1TAE A;  1FJG O;  3H9V A;  3ASO B;  3ABM C;  5BY1 A;  3RYI A;  1QR8 A;  4QNH B;  1GN2 A;  1PNL A;  2XAJ A;  4G27 B;  1QVG U;  2ZDI C;  3L70 H;  3ZJZ A;  5ITZ A;  4YHH O;  4DV3 B;  5FL7 G;  4EFE A;  2YXY A;  1AR4 A;  4DR1 O;  1ROP A;  1VP7 A;  4DR7 B;  2XAF A;  5GON B;  2HR3 A;  3HKD A;  1FXH A;  3BA8 A;  3A0B Z;  1SQV H;  1KC8 W;  4LF7 B;  2EIK C;  3UCS C;  5BZB A;  4YJ3 A;  5LOV B;  3HR0 A;  4RQF A;  4B3T O;  1THZ A;  2PUS A;  2D2C B;  4DRX B;  2BSK A;  5KHJ A;  3H1L H;  5JVD A;  4DR3 B;  1RFY A;  3UKM A;  2FKX A;  3L9D A;  1JFF A;  2OIG A;  1CEZ A;  5B3S B;  3B4S A;  3N27 A;  5IYD O;  2VRZ A;  1P84 F;  5GON A;  1H2M A;  3CD6 V;  4JI8 B;  2ZNJ A;  5C8Y B;  2PY5 A;  5JCO C;  4JI2 B;  2LW7 A;  4I4T B;  5EC2 C;  4I55 B;  4O4I A;  5GTH Z;  3CCE V;  4Z1V A;  3HKE A;  2YS8 A;  4JI5 B;  4LF6 O;  2R9I A;  4X65 B;  3FYI B;  3TCU A;  4GZR B;  1WB8 A;  3BFR A;  1SES A;  4TT3 G;  3ABL B;  2AXT Z;  4N23 A;  2DWD C;  5IJ9 B;  4X1Y B;  3GWO A;  2IH1 C;  5IJ9 A;  3C3S A;  2WLJ A;  4X64 B;  2EUL A;  3R66 A;  5EIB C;  4NR1 A;  2PF4 E;  3ABK C;  4YJ2 A;  2EIN C;  4OGQ B;  4JI3 B;  2OCH A;  1HDJ A;  3CCS V;  5FNV B;  3B40 A;  5J9P C;  4IHJ B;  1YF2 A;  1KEC A;  2OWO A;  1Y6X A;  2AHY A;  1S5H C;  2MW2 B;  4FLY A;  1GM8 A;  4I50 B;  1IXB A;  3SYQ A;  2IM9 A;  4D7S A;  1I08 A;  2L35 A;  4MSW C;  4TV9 A;  2R9R B;  3B2E E;  2XTA A;  4JPR A;  5EBL C;  1KMI Z;  1XNR O;  3IC7 A;  1RM1 B;  4JI7 O;  4LFA B;  2A7W A;  2HLD G;  1XMO O;  5LBQ A;  1NTZ H;  1D2D A;  1XDC A;  4FFB A;  3K9S A;  2UXD O;  2QWN B;  1N36 O;  1A32 A;  5CBF A;  4WCE V;  1H38 A;  2PTM A;  4IIJ A;  1L8D A;  5JJE B;  1XNQ B;  2RQ6 A;  1I94 O;  3K0G A;  1Q3E A;  1N33 O;  3KKY A;  1SET A;  2JDI G;  1OV9 A;  1GRJ A;  3T4Z A;  4DV2 B;  1ENV A;  2JJ1 G;  3AG1 B;  3AK2 A;  4JI1 B;  3UT5 A;  3K3W A;  1K4C C;  5J2U A;  4PA7 A;  2QJ1 A;  3H1H H;  5B3S C;  4UVC A;  3AG7 A;  1WA8 A;  1K4D C;  4FPP A;  1R1B A;  3D3I A;  1VF6 C;  2EIM C;  4DV5 B;  4JYA O;  5KAI Z;  4P30 A;  1RSO B;  3K5M A;  5B1O A;  3OT7 A;  1F23 A;  3L73 H;  3ABM B;  2NN4 A;  4TQD A;  1HNW B;  1QNM A;  3A8T A;  5BR8 O;  1R3J C;  2XUM A;  1TUB A;  4I7Z B;  5EK0 A;  1TUE B;  4R50 A;  3MHH C;  1M1K W;  3CCR V;  3CEI A;  3SJA C;  2EIL B;  5H6Q A;  3OGI B;  3QF7 A;  2WLM A;  5EBM C;  3RT3 C;  1Z5W A;  1V54 C;  2JVD A;  3W7X A;  1XI1 A;  1ZLZ A;  4QE9 A;  1K92 A;  1MAB G;  1FJG B;  3CXC U;  1DGS A;  1PL0 A;  5IYZ B;  4YY3 O;  4WBN A;  2QDO A;  2ITC C;  4JI6 O;  4TWK A;  3P3P A;  2OTJ V;  1IUR A;  2IJI A;  1ZWI C;  1AI7 A;  2YXL A;  4YHH B;  4DV3 O;  1VQ9 V;  1FXK A;  3FB8 C;  3ASO C;  1Y74 B;  2JK5 C;  4JGS A;  1EM1 A;  3CCU V;  1MNG A;  5IT9 N;  3GB7 C;  4DV6 B;  4PI2 A;  2HVK C;  1JFF B;  3ZMS A;  2WWW A;  4TUY B;  4ZHQ B;  4CBC A;  3KCY A;  2F23 A;  3ABT A;  4LF9 B;  3FX7 A;  2E5L B;  1B06 A;  2MK3 A;  1IZ3 A;  2ZCE A;  1YIJ V;  4EKW A;  4TV8 B;  4X66 B;  4EFB A;  2ZM6 O;  3BPZ A;  3T2M A;  4JI4 O;  4B7K A;  3EXA A;  1LNQ A;  4PA6 A;  2Q67 A;  2Z5U A;  2EJ7 A;  5IYZ A;  2C2A A;  4MS2 A;  1BHA A;  1Q86 W;  4F4L A;  4PA4 A;  4JI2 O;  3O9O A;  1SQF A;  5CA1 B;  3SPI A;  2VQF O;  3WB1 A;  4LF4 B;  2IJH A;  2NR5 A;  5FLX N;  4PA9 A;  4E4E A;  3RGB A;  1NS1 A;  4H0L B;  2WLI A;  3HKC B;  2FYU H;  3OAA G;  4GCZ A;  4TSF G;  1XHX A;  3CJH A;  3RVZ A;  3F7V C;  3JAT A;  3ZRX A;  5LXT A;  1F7Y A;  1PPJ H;  2OCC B;  5J2U B;  4MVQ A;  4MVM A;  1RM1 C;  3AEI A;  1NH2 D;  2N05 A;  5H9C A;  3ZHR A;  2CGN A;  1GN3 A;  4X64 O;  2YIA A;  1QU7 A;  3A0H Z;  1YI2 V;  1V55 C;  3CRA A;  3SPH A;  2Y4T A;  5H5N A;  4DV0 O;  4JI3 O;  1KB9 F;  2GDS A;  4UCT A;  1AJP A;  2ITD C;  2EIL C;  3X2Q B;  2A9H A;  1J5E B;  1Q8I A;  2RMK B;  2Q4P A;  1YIT V;  2R72 A;  1NTM H;  1K5S A;  4IIJ B;  4B3S B;  4DW0 A;  5KA6 A;  3RYH A;  1OJH A;  3QTC A;  4BIU A;  4FLZ A;  3ZRW B;  4P9P A;  5EZY A;  3SYC A;  2IJK A;  1WP7 A;  2UXD B;  2ZR3 A;  1W2B U;  4DXW A;  1KU9 A;  3CPW U;  5J2T B;  4O2B B;  3B8M A;  5CN0 A;  1VQ5 V;  2F4V O;  3DGE A;  2D3O W;  2CAZ C;  1K9M W;  1N34 O;  1XNQ O;  4LF5 B;  2F1M A;  1PP9 H;  3U10 A;  2Q0A A;  5AG2 A;  3VBB A;  1D5N A;  3LSQ A;  2B5U A;  4L8J A;  1YTF B;  3THO A;  2M6Y A;  2E74 B;  1H8H G;  5IWA O;  4F6R A;  3L74 H;  1VQ8 V;  3SPG A;  4LC1 A;  5L3B A;  1XL4 A;  1OCO B;  3K04 A;  1W0J G;  2QM4 A;  2JGD A;  2W0X A;  2ZIO A;  3OFN G;  4LH6 A;  3JAW A;  4ZBM A;  4YJ3 B;  5LOV A;  2RDC A;  4YJ2 B;  4CS4 A;  3OEH G;  5KAF Z;  1AI5 A;  2XND G;  5B66 Z;  1W59 A;  4XDJ A;  4NXN O;  5LYJ A;  4O2A A;  3SJQ C;  2YIB A;  2PYL A;  1R73 A;  2Q7H A;  4U3J A;  1SKV A;  2EJR A;  1BT8 A;  2V7Q G;  1QLE C;  2QKC A;  1GK9 A;  4RUE A;  1B6Q A;  2IJJ A;  3BA9 A;  1P49 A;  3EHB B;  1ZAU A;  3FFQ A;  1XIL A;  2IU3 A;  4GKK B;  4K3A A;  3WB0 A;  4QPK A;  1H2N A;  2FL4 A;  1IXM A;  2GHY A;  5CBH A;  3K5L A;  3CJH B;  4KUM A;  3ZS8 C;  4JTA B;  1WAZ A;  2HHH B;  3K03 A;  4KFM A;  1GM9 A;  5IY5 C;  1ZL8 A;  1JOY A;  2UUA O;  1YHQ V;  1U97 A;  3WG7 B;  3LNN A;  2LFS A;  2VQE O;  3MD0 A;  1Q43 A;  1NKD A;  4FJC C;  1ORQ C;  3VQW A;  2P4V A;  1FFX A;  5LHI A;  4JV5 O;  1CXZ B;  4IT5 A;  1FYJ A;  4DV6 O;  2WLH A;  4DR2 B;  4GLX A;  3F5W C;  3IFX A;  2ZIM A;  3T1H O;  4UB6 Z;  2ZDI A;  3JAK A;  3HPL C;  1JCH A;  1JPX A;  1XMQ O;  1FFT B;  1N0N A;  4LF8 B;  3CRM A;  2KQX A;  4O4J A;  1SC5 B;  4BIO A;  2JRI A;  5LXT B;  3E8B A;  4JZ2 A;  2A06 H;  4K0K B;  2Y69 B;  2ILM A;  3B77 A;  4BIZ A;  4F6R B;  4FIP C;  3STZ C;  1IBM B;  3SPJ A;  4DUY B;  4L87 A;  3FYE B;  4NXM B;  1FFX B;  3CME V;  2RCV A;  2CTW A;  4X62 B;  4J80 A;  5C93 A;  1NQT A;  5JVD B;  2X6C A;  4FZ0 A;  1S77 D;  2ATK C;  1VQK V;  3ZCC A;  4EEQ A;  4MTG A;  4QIW F;  5B1B B;  1M57 B;  2DOS A;  3VQV A;  3T1Y B;  3TXS A;  1OZ0 A;  4ZHQ A;  2JJ2 G;  2DQ0 A;  1VQ6 V;  4LBE C;  4H33 A;  1NTK H;  1G6U A;  3JSL A;  3SPC A;  1TGO A;  3E2E A;  4FLU A;  2Q73 A;  2GUZ A;  5JJN B;  4DV4 B;  1QLE B;  4U3F H;  5LMN O;  3CE2 A;  3DC5 A;  3R65 A;  5JH7 B;  4FLW A;  2E3C A;  2QA4 V;  1BQZ A;  3ABL C;  3BCC H;  3LSU A;  4FFB B;  2Q0O C;  1IDS A;  2UXB B;  3K58 A;  3JAR A;  1KP3 A;  1SQG A;  4ZOL B;  3WU2 Z;  1DTO A;  3TJT A;  4DR4 O;  2K9P A;  5GW7 A;  2GV9 A;  4LFC O;  5EC1 C;  4TUY A;  2HP8 A;  3OTO O;  2UXX A;  5KHG A;  5CA1 A;  4O4L A;  1KYO F;  1KD1 W;  4ABM A;  5KA5 A;  1GMG A;  1Q6H A;  1AIL A;  2Q5Z A;  4QE7 A;  1FD9 A;  4Q6G A;  3ZMU A;  1H2G A;  1EZV H;  5L3D A;  3W7T A;  3OGC C;  4PDV A;  1FXV A;  5B5E Z;  2YXH A;  1MMM A;  1K33 A;  1HNX O;  1NVP B;  2KB1 A;  3LDC A;  4D6T H;  1N34 B;  3N2K A;  3HKB A;  4O2B A;  2QEX V;  4LF5 O;  2QM8 A;  1AJN A;  2GTA A;  2WSS G;  4E2L A;  2IU0 A;  4B3R O;  3SDL A;  3FB5 C;  3KZI Z;  2M7W A;  3G80 A;  3QO5 A;  4JAA A;  3FAV A;  1M93 A;  2P6J A;  2EX3 A;  1KQS U;  4HNA A;  4JYY A;  5KX5 A;  2QWO B;  2P7T C;  2OYQ A;  1RSO A;  1IX9 A;  5LMU O;  2EIK B;  2XAS A;  2P22 C;  4KXR A;  5D5Q A;  4DV1 B;  1PL4 A;  4O2A B;  3RYH B;  3UT5 B;  2WLL B;  4UV9 A;  5LP6 B;  2ARH A;  5IE9 A;  3AG4 C;  1BL8 A;  4J7Z A;  2WLL A;  1NH2 B;  2JEX A;  1AI4 A;  3G67 A;  4TV9 B;  3JAS A;  3SJC C;  1R3I C;  3CCQ V;  5J2T A;  5KMG A;  3X2Q C;  4NXN B;  3ABK B;  3KG2 A;  3ZMZ A;  3H1K H;  3H1J H;  2E76 B;  3RWR D;  3DSQ A;  1XHZ A;  2H94 A;  5DED A;  4IYI A;  1VF7 A;  2XAQ A;  1EN5 A;  1ZX3 A;  2LO1 A;  4TOI A;  2X6B A;  3AG3 B;  2CDY A;  4BR6 A;  1IBL O;  1ZUQ A;  1DK1 A;  1FS0 G;  4O4I B;  3I56 V;  4X1I B;  5E79 Z;  4HYO A;  1YDX A;  3JD2 A;  3K5O A;  3CX5 F;  3CCJ V;  4GYC B;  3OE7 G;  3K57 A;  4FM2 A;  1F4N A;  3A2F A;  1S3J A;  5E1A C;  5CA3 A;  4AQY B;  2HHH O;  3ZHS A;  1R3L C;  2UUA B;  1K3E A;  2H3O A;  5BXZ A;  1JJO A;  3ZX6 A;  1Y74 A;  4MVU A;  2VQE B;  3ZIA G;  1IBK O;  3JD0 A;  4O4J B;  2ETN A;  2EBO A;  3ZRV A;  2DMX A;  5IY5 B;  5EYP A;  3CXH F;  4DR7 O;  3ICX A;  5H6R A;  4UVB A;  2VWJ A;  2OIE A;  3JCZ A;  4LF7 O;  4NTX A;  1VQP V;  5JQG B;  1AVM A;  2Q69 A;  4B3T B;  4PDR A;  3SYP A;  3T1H B;  1FXK C;  5DEC A;  1BMF G;  1IVS A;  1OCC C;  4LH7 A;  4X1Y A;  3OMN B;  3BAA A;  4KP4 A;  5B1B C;  3QG5 A;  4IGG A;  2BCC H;  4JI0 O;  1QVF U;  4HNA B;  1S0V A;  2DYS C;  3U0Z A;  5CB4 B;  1NJI W;  3LUT B;  1SQP H;  3CHX A;  1F51 A;  4NXM O;  1WJZ A;  5KHH A;  4DW1 A;  5H2F Z;  4JTC B;  4JI8 O;  5B1A B;  4LFB O;  2NNU A;  2YDE A;  4DR5 B;  1WN7 A;  1VEW A;  1JJ2 U;  1K7D A;  3M7M X;  4DR6 O;  3HB3 B;  4WFF A;  1XL6 A;  4JI5 O;  4NYK A;  4WBN B;  4LF6 B;  3S3X A;  1M90 W;  3ZN1 A;  3W7S A;  4Z2W A;  4AI8 A;  3OR7 C;  4O4H B;  4YIO A;  1GH6 A;  1M4U A;  3JAK B;  1XUQ A;  2K1E A;  3C90 A;  3P32 A;  3J80 N;  1V9P A;  5CB4 A;  4B3M B;  4GX5 A;  1V54 B;  1VF6 A;  2ZE6 A;  2QM7 A;  1WPX A;  4UV8 A;  2ZIN A;  3OD4 A;  1SER A;  3LSS A;  4J9Y B;  5IJ0 A;  3TET A;  5L3F A;  4G28 B;  3AK1 A;  3NXS A;  3LDE A;  2X0L A;  4UVA A;  4CS3 A;  1PKX A;  4DK0 A;  3CP1 A;  2YSU B;  3ZRS A;  4DV7 B;  3W7U A;  1GN6 A;  3K06 A;  5IDJ A;  3UO2 A;  3RYI B;  2ODM A;  3HKB B;  1XNR B;  1E1R G;  1VMG A;  4YXW G;  5LYJ B;  4JI7 B;  4LFA O;  1XMO B;  2UXC B;  2NLJ C;  4MVO A;  1G1X B;  2HVJ C;  3QVN A;  3DC6 A;  1S72 V;  4K8X A;  1N32 B;  1BCC H;  4UCS A;  5LP6 C;  4CC5 A;  1BSM A;  1CP9 A;  2WAM A;  1L0N H;  1N0J A;  1HR0 B;  2QGN A;  1NI8 A;  3JYC A;  2V1D A;  2KSD A;  3JAL A;  2QSA A;  3RW0 A;  1D5A A;  2AW9 A;  1NZ6 A;  4B3R B;  2R9A A;  4U7N A;  3BRC A;  1UPG A;  1WLE A;  2Y4U A;  3JAW B;  1FPO A;  1VQ7 V;  2DW4 A;  3AG2 C;  3MHS C;  3O65 A;  2LJ2 A;  1NR1 A;  2XAG A;  1HNZ O;  1Q7Y W;  4UXN A;  1GAX A;  1SA0 B;  5TIS Z;  1BE3 H;  5LGT A;  2JS3 A;  4WFE A;  4FLV A;  1EN6 A;  3W7W A;  3M99 B;  1X59 A;  2ZKO A;  4WF9 V;  4X8A A;  1EN4 A;  3NR7 A;  2UU9 O;  3FB7 C;  2JS5 A;  1JVM A;  2Q8V A;  4FLX A;  2R70 A;  3JD1 A;  2Z3Y A;  1WPB A;  5HFL A;  4PDL A;  4JYA B;  3P30 A;  2F43 G;  1V55 B;  3ETQ A;  1XEQ A;  1KKC A;  1R6K A;  1L0L H;  2KKW A;  4W4K A;  3BVO A;  1VQM V;  3OR6 C;  3ZBH A;  4X20 A;  2CH7 B;  1M5I A;  3ZMV A;  3CWB H;  3OMI B;  5F2V O;  5GTI Z;  2DN9 A;  2DYR B;  2HEP A;  1X4T A;  4IHJ A;  3VQX A;  3RYC B;  2Y48 A;  1G4Y B;  2Q68 A;  1KP2 A;  2B1I A;  3MAQ A;  2ZE5 A;  4YY3 B;  1FAF A;  3OEE G;  2HKO A;  3T1C A;  1OCR B;  3AK3 A;  1JR9 A;  4J7K A;  3D36 A;  1TVK B;  4XDK A;  5CBG A;  2YEV B;  4MW8 A;  4GX2 A;  2F66 C;  3BY6 A;  2ZNI A;  1PD3 A;  3APQ A;  4DK1 A;  1ZSP A;  2OTL V;  2GUZ B;  4DR3 O;  4H44 B;  1SZT A;  2BSK B;  2FML A;  4LNU B;  5D5P A;  4XDL A;  3WG7 C;  3FB6 C;  3KCX A;  4JAU A;  3RYF A;  3ZRW A;  1EZJ A;  2QR4 A;  1PNM A;  4JI0 B;  1T5E A;  2UXN A;  4X66 O;  4DUZ O;  3T4D A;  2ZM6 B;  2Z0A A;  2KG7 A;  3QNE A;  3CCM V;  1YTF D;  3ETE A;  1B04 A;  4OX9 O;  1P4R A;  3MDS A;  3IAY A;  2QE7 G;  1AR1 B;  3DTU B;  4X65 O;  4ZI7 A;  4I0X B;  3AG3 C;  4LFB B;  3ETG A;  5IYC O;  2Y69 C;  4HZ3 A;  4J10 A;  4DR5 O;  3CRR A;  2P06 A;  2XHB A;  4DRX A;  4ASU G;  1H2K A;  5EYP B;  1ZL8 B;  4R6Z A;  2WPD G;  2PGG A;  4ZKI A;  1XRE A;  1AB3 A;  4U7O A;  3CC2 V;  1OCO C;  5BMV A;  4RWU A;  1QLN A;  1VIB A;  3A0R A;  4GT1 A;  4B3M O;  1J95 A;  2XT9 A;  3ZN0 A;  1S76 D;  1I5X A;  3CC7 V;  1U96 A;  3J81 N;  3CS5 A;  5A2Q N;  1WB7 A;  1M57 C;  4RUF A;  1WNS A;  3FKS G;  2PZS A;  3BHP A;  2ADP A;  1YXB A;  4IL6 Z;  4UCO A;  1HWY A;  3DXR B;  4DO2 A;  1TA8 A;  3SYO A;  4LCU C;  2ZD9 A;  4NKG B;  4JF3 A;  1MG1 A;  1ARO P; 
#chains in the Genus database with same CATH homology
 1Y74 A;  1VF6 C;  1ZL8 A;  1ZL8 B;  1Y74 B;  1RSO B;  1Y76 B;  1Y76 A;  3B40 A;  1VF6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...