1Y76A

Solution structure of patj/pals1 l27 domain complex
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
62
structure length
62
Chain Sequence
NPAAEKMQVLQVLDRLRGKLQEKGDTTQNEKLSAFYETLKSPLFNQILTLQQSIKQLKGQLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A unified assembly mode revealed by the structures of tetrameric L27 domain complexes formed by mLin-2/mLin-7 and Patj/Pals1 scaffold proteins.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein
molecule keywords protein associated to tight junctions
total genus 23
structure length 62
sequence length 62
chains with identical sequence C
ec nomenclature
pdb deposition date 2004-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09045 L27_2 L27_2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.650 Mainly Alpha Orthogonal Bundle Helix Hairpins L27 domain 1y76A00
1VF6C 1Y74A 1Y76B 1ZL8B 1ZL8A 1RSOB 1Y74B 3B40A 1VF6A 1Y76A
chains in the Genus database with same CATH superfamily
4GZRB 4PD4F 1F4MA 3CWBH 4BR6A 2JGDA 4UB6Z 4LR3A 3AG3C 4O4JA 3B8MA 4WCEV 2EZPA 1GM8A 4RUEA 1FXVA 1VQ6V 4QPJA 4MVUA 3HKEB 3L72H 2PYJA 4DK0A 2A06H 1KD1W 1TUBA 3C3TA 1I94O 2B5UA 3STLC 3T1CA 1SC5B 1KYOF 4UV8A 4PHZA 4RUFA 4JYAB 2XASA 3LNNA 4FLUA 2YICA 2AZ0A 2YXHA 5LOVA 3OUSA 4JI7O 2GSMB 1YTFB 4MS2A 4QE7A 4X62O 3K9AA 1AI6A 4MSWC 1VF6C 4J80A 2Z3YA 1HWYA 3OTOB 1M90W 1YJWV 1ENVA 2PUSA 3SJCC 4DR5O 3SYAA 1VQKV 2B9ZA 3AG3B 3CRMA 4PA9A 4YJ2B 2ZNIA 1NH2B 4B3SB 2OIEA 3JAWB 5LL6Y 4LF9B 3CCUV 2F66C 2XAHA 3W7UA 3ZN0A 4J7JA 1SRYA 4NKGB 1WJZA 1NS1A 3CS5A 1UJWB 1AR5A 3RGBA 2A7WA 3ZRSA 1K4DC 2RN9A 3RYIB 3AG7A 1BQZA 5E1AC 2R9AA 1Y74A 2OTJV 3BEHA 3FX7A 5GONB 3HR0A 1YF2A 3B40A 5K1PA 1QLEB 3RYFA 3QVNA 4JI8B 1DLBA 4JTCB 2NN4A 5H2FZ 4FIPC 3N2GA 3FAVA 1W59A 4DR1O 3RVZA 3WG7C 3M99B 1S3JA 1YEWA 5B3SB 2UXCO 1VQ7V 2IJIA 2OCHA 4RO2A 4UCVA 4GKKB 2EJ7A 2QE7G 4J7ZA 3SGIA 3LSUA 2QTSA 2Q67A 1U96A 4X66B 1XQ8A 1NH2D 2W0FC 3MHSC 2RDCA 5IYZA 5EIBC 4GKKO 3OD4A 3LDCA 1N8RW 4PDLA 1RM1B 4LFCB 3A8TA 2PZSA 2W6JG 1TAEA 3D3IA 3QNEA 4NB5A 1PPJH 3UKMA 3JASB 3ASOB 4LNUA 1FD9A 4GX2A 4FLTA 2BSKA 3ZHQA 3E8BA 1K4CC 3OR6C 2YIBA 1A32A 1VARA 4KXRA 3OTOO 1F23A 4ZI7B 1H2GA 2Q8VA 4I50B 1R3JC 3Q4HB 1JX9A 2GBOA 1PKXA 1N33B 1LR1A 1Z5WA 2R70A 1ZL8B 2VWKA 3SPGA 2VWJA 1Q7YW 4KP4A 3N2GB 4FM2A 3L70H 4LF8O 3TCUA 1OCCB 2YI8A 4DV4O 4DV7B 4X64B 3BCCH 4JYAO 1AI5A 1BGYH 2Q0OC 4DO2A 2Q7GA 1NU1H 2ETNA 3D36C 3K79A 5IJ9B 1GN2A 1N36B 2P6JA 4U3JA 1YHQV 3CHXA 2BOBC 5B1BC 3E22A 5D5PA 4MTXA 4NVPA 1HR0B 4YXWG 1AB3A 1RSOB 3J7AU 2A9HA 1KC8W 4JI5O 1V54B 4X65O 5H6RA 3LUTB 4B3MB 3H01A 2R72A 3W7SA 3H1KH 2OYQA 3UO2A 3X2QC 3TJTA 4HBNA 2P4KA 1KUQA 1M93A 2CTQA 5EK0A 4TQDA 5L3DA 2PI5A 3BFRA 3ZRWA 3HPLC 2DN9A 3ZHVA 4LF6O 3QO8A 5A9GA 2H3OA 3TK1A 1Y67A 2QSAA 1MZEA 5EC1C 5KAFZ 1JCHA 2YSUB 4LFAB 2OCCC 4JI7B 4JI0B 4XDJA 2DYSB 5FNVB 4NTXA 3JSNA 1QNMA 3JD2A 3IGAC 4RWUA 1YI2V 4WBNB 4X65B 5KUMA 2RJZA 4LF9O 1Y6XA 4UVCA 4GX5A 3J81N 4GX1A 4AHCA 4OX9O 3BRCA 3HB3B 4P2ZA 1M4UA 1BMFG 5DN6G 4DR5B 3WB0A 3JAWA 5JJNB 4DV1B 2E3CA 3D3QA 1S5LZ 5IJ0B 4U3FH 2CGNA 1M57B 3SPIA 1N0JA 2ZE6A 3R66A 1NTKH 4D6TH 5CA1A 1W2BU 4LFBB 3OMIB 3H1HH 5KHJA 4GX0A 4AILC 4QE9A 4LWSA 1NVPB 1Q6IA 2Z5UA 1H2KA 4FM1A 4ZKIA 1MA1A 2LGWA 2UXXA 3MDSA 4LF8B 4K0KO 1BT8A 2ZD9A 2DJVA 1KMIZ 3FYEB 1MMMA 1YCIA 2QKAA 4DUYB 1VMGA 4TUYA 4CZZA 1JOYA 1BS3A 5B1OA 4L8JA 4W4KA 3DXRB 3UQ8A 3FKSG 4LNUB 2E5LB 1EZJA 4JI6O 3CP1A 3G6BA 2WLLA 4LF7O 2BTQA 3JATA 4UCTA 2YXLA 4PDVA 1WP8A 4JI2B 2F93B 4I5SA 4X66O 2ZT9B 3R65A 1GRJA 5KMGA 2ZM6B 1PNMA 1QBZA 4P9OA 2VQFB 4ZOLB 5LGNA 3CYOA 3OTFA 1IVSA 2IH1C 5CBHA 3OGCC 1PM9A 4UCSA 1XBLA 1VQ8V 3BPZA 4HYOA 2QM8A 2Y69C 2EX3A 3QO7A 1DK1A 4JYBA 1VQOV 4CH3A 5GW7A 3UT5A 2BSKB 1NTMH 2EIMB 4DR2O 3IC9A 4JI1B 2QJ1A 3CSXA 4GCZA 2YIDA 4FLXA 2OWOA 1OCRC 5KUKA 1NJIW 5IYCO 1SF9A 2JGUA 1Q82W 4DR3B 2ZE7A 2DW4A 1VF6A 1WPXA 2A0LA 4HAMA 5HFLA 2FYUH 1GM9A 1ZSPA 4TV9B 2UU9B 2WLLB 2ZE8A 5L3GA 2D3OW 4U3JB 3RFRA 2FL4A 2IBZH 3KZIZ 3N27A 2IM9A 2K1EA 1GAXA 4R50A 4JZGA 1OHHG 3FAVB 3ZX6A 1YITV 2YIAA 1K73W 3IC7A 5LHIA 3SR2C 3ASNC 2Q5ZA 4F6EA 1GM7A 3S3XA 4DV2B 1R3IC 4ZHQB 1GN3A 3RVYA 4RQEA 1CP9A 3P32A 4Q20A 2Q9LA 3MAQA 4I55A 1G6UA 1XHZA 2ATKC 2QWQB 2ZXWB 4Z2WA 4G2KA 3RBZA 4J42A 1SQQH 1AP6A 1VQMV 5C93A 3G80A 3ZN1A 1ZAUA 3SYPA 4PI2A 2ZNJA 4EEQA 5LA6B 3CRRA 1P4RA 3N2KB 1D5NA 1W0JG 3KCYA 1IBLB 5A2QN 4H13B 1PL4A 4DR2B 5LHHA 4R8CA 1IZ3A 1AJQA 4B3MO 1JFFA 4E2LA 2EINC 4YJ3B 3RYHA 4IHJB 5LP6B 4RAIA 4B3TB 1Y76A 1N4CA 1Q5OA 2WA4A 3FB5C 2QWNB 4HNAB 2EIKB 3JALA 2ITDC 2JEXA 4OPHA 4BWAA 1K8AW 1J5EB 1SQPH 1YSCA 1SQVH 4J7KA 2ITCC 1NT2B 2R9IA 4QNHB 3AG4B 2YIBD 5CN0A 5FPOA 5F2VO 3F5WC 5EYPB 1VF5B 2B1GA 4JTDB 1OV9A 3ZRXA 4CH5A 2A3QA 5GTIZ 5BMVB 1I94B 1N33O 5LP6C 3CC2V 1THZA 1S76D 1DF4A 4OPAA 3K08A 4ABMA 5JVDB 4JF3A 1HP8A 3CJHA 1AR4A 3TXQA 1MSWD 4O2BB 3RW0A 1WB8A 3CX5F 1TA8A 3JD1A 3JATB 5JJEB 3FB7C 3H1LH 1M1KW 1Q3EA 2UXNA 1XNRB 1R1BA 3B09A 1AJPA 4BW5A 4G28B 2KG7A 2N05A 4IIJA 2EIKC 1FXKC 4JI2O 3VOUA 2WA3A 1XNRO 2QM4A 3UCSC 3CC7V 4NXMB 5EZYB 5C8YB 3U10A 4MT8A 3SPHA 4MTOA 4X1YB 2AW9A 2OTLV 1L8DA 2KSDA 1T5EA 1UFIA 4B08A 2GTSA 3IFXA 1MABG 5B3SC 3ZHRA 2F95B 3L9DA 4IYHA 2ZR3A 4WF9V 3CC4V 4AQYB 1Y66A 2ARHA 1I5YA 1OCOB 4DW0A 1FXKA 2Q68A 3H1JH 3HKEA 3AK1A 3JSLA 3CB2A 1AR1B 1GK9A 5JWPA 3GB7C 1TUBB 4JYYA 4B7EA 3WB2A 4UFZA 1E79G 3HKCB 4O2BA 5CBGA 3ABMC 4LF4B 3LSQA 1WA8A 1IBMB 3BVOA 5LGUA 2VQEB 4WFBV 4UCOA 5CA0A 5IE9A 3CCEV 3G6EV 3FD9A 1Z2GA 2IJHA 4E4EA 3ZHUA 2BTOA 3T1HB 4MVMA 1DF5A 5EIBD 5EZYA 4JI3B 5CB4A 4MTFA 1QVFU 1HW7A 2H8PC 3X2QB 3AG1C 4TOIA 3T4ZA 4DW1A 4NYKA 1EFRG 2QGNA 2GUZB 2HVJC 2ZIMA 1Y74B 4CS3A 2EIJB 3T1YO 1XMOO 1HNZO 4K0KB 1VQLV 1FFXA 1S5HC 2HLDG 4DYLA 3I55V 1YJ9V 2K9PA 3CPWU 2F1MA 4YY3O 3MD0A 4HNAA 1EM1A 4H0LB 1HNWB 4LF6B 2Q7EA 1ZUQA 1R73A 5IDJA 2QWRB 3JCUZ 5B1NA 2YI9A 1WA8B 3L73H 3ZMZA 4BIOA 1BCCH 1LUVA 1Q43A 1X59A 4DR7O 5EC2C 3RYFB 4MW3A 3WFVA 3CCRV 2YUAA 4P30A 2Y0PA 3JD0A 4GUNA 2WLMA 2IW5A 3E89A 4WFGA 1I0HA 1VF7A 1N32B 1KP2A 5B66Z 5TISZ 1URFA 1L0LH 1ROPA 4TV9A 4LFAO 1JPXA 4DR6B 5IYDO 4FK5C 3E8HA 4JYCA 1JVMA 2QTOA 2FKXA 1QCEA 1ORQC 4DV6B 1CEZA 3K59A 2KQXA 4JI6B 5EYPA 4Z1MG 4JV5O 1K7DA 4I50A 4P9PA 3OT7A 4X20B 2X6CA 4FLVA 2WLNA 5B5EZ 4AQYO 2IU3A 2CDYA 5JVDA 2EILC 2WAMA 4O4LA 4F6RB 1NBMG 1HR0O 3OUFA 1NKDA 2P7TC 4CS2A 4FFBA 1V55C 3AG2B 2X6BA 4X88A 3QO5A 3VBBA 5IJ9A 1IXBA 3T2MA 1F51A 4O4HA 4B7KA 1M57C 4Z1VA 5ITZB 1R3KC 4DR4B 1MZFA 4QGPA 4X64O 2LJ2A 1OCOC 4WFHA 4LBEC 1KU9A 3RYCA 1EN6A 2PY5A 4H37A 2V4DA 2OIGA 4UVAA 2XOKG 1PNLA 2P5OA 1H2MA 2RMKB 3WG7B 3JAKB 2LW1A 2E5LO 1H2LA 5CA0B 4JI1O 1WN7A 1YTFD 3GWKC 1FYJA 4DV3O 4X1KA 4X20A 1LNQA 3E83A 3ZS8C 4H44B 5FNVA 2HJDA 4YHHB 1M9NA 4YY3B 3CE2A 3O9OA 2YC0A 5DM6V 3CRAA 4IT5A 5AG2A 3AG1B 4ICGA 3E86A 2HJFC 2UUBO 2UUCO 4TWKA 4PA4A 4BIUA 4CS4A 1N32O 1RP3B 2VS0A 4L87A 2UXDB 4PDRA 1GH6A 5KHGA 3THOA 4TT3G 1TGOA 1RPOA 2DE0X 2WLJA 3AK2A 1QR8A 2F4VB 4IGGA 3K5MA 2YEVB 1E1RG 2ZDIA 4CC5A 4BAYA 4OX9B 3CJHB 2BE3A 2XAJA 4I0XA 4EB6B 1OCRB 2G38A 5KHKA 2EIMC 5FLXN 4PV1B 2QEXV 4FM0A 2XUMA 4UV9A 4PDMA 1YDXA 1N0NA 2C2AA 5LGTA 2ZXWC 2UXDO 2WSSG 1IBLO 4GYCB 4PA6A 2Q0AA 3OMNB 2CTRA 2QWOB 3H9VA 1VQ4V 3LDDA 2AHZA 4TQFA 3K5NA 3CXHF 1MNGA 4KHPB 3P30A 3FB6C 5L3EA 1VQ5V 1PV0A 1R6TA 1R6KA 1SQGA 1L1FA 3CCMV 1XOUA 2M6YA 3L71H 1SA0B 5CA1B 3E22B 4DR7B 3M7MX 3ETGA 2DYRB 1KKCA 5LHGA 3NR7A 1DGSA 2YEVA 2ZCEA 1PL0A 3DXRA 4TV8B 5IT9N 4DK1A 1AVMA 4I9QA 1J95A 2UUBB 3CCVV 1YVWA 3VQVA 4KHPO 1SQFA 2CH7B 4FFKA 3ABMB 4NXNO 5EBMC 3M8AA 4X9QA 3WB1A 4ZIBA 4F4LA 1AP5A 4IL6Z 1CXZB 2HHHO 2CK3G 1TVKB 3J80N 1S72V 2ZQMA 3UO3A 2P4VA 5CB4B 3K0DA 2HR3A 2WPDG 2ZDIC 4JI5B 3AG2C 5KMGB 3L75H 3SDLA 3BA9A 2ZIOA 4U7OA 4FFBB 2JRIA 5KAIZ 2LFSA 3VQYA 2UXBO 1ZLZA 1NI8A 4BIZA 5B1AB 2FMLA 4IYIA 5H6QA 5IJ0A 1VQ9V 1SZTA 5LBQA 1L0NH 4NXNB 3OGIB 2WLHA 4G27B 1KKDA 3I56V 4R7CA 4FZ0A 2FTKA 1MOFA 3ZJZA 1SESA 1US6A 4O2AA 3W7XA 1XNQO 2ODMA 1VEWA 4LWSB 1ZX3A 1S0VA 2BCCH 4NTYA 4DV5B 3KCXA 5EBLC 4BW9A 1XUQA 4JASA 2UUAO 2ZKOA 1IDSA 1VP7A 2JVDA 2RCVA 3ETDA 4UUJC 4AI8A 3A0HZ 5LYJB 4TUYB 1K3EA 2LFRA 2QDOA 1HNWO 3HKBB 1GN6A 3ZHTA 1XEQA 3EVKA 1QU7A 3ASNB 3T4DA 5L3FA 1MSDA 4JZ2A 2QKSA 4FPPA 1BHAA 4LCUC 4N21A 1PD3A 3OE7G 3NXSA 4B3TO 3SPJA 3CRCA 2LO1A 4K3AA 2ADPA 4ZOLA 1HNXO 5HFMA 4Q6GA 5BXZA 1BQ0A 4KFMA 2KKWA 3N2KA 1FAFA 4I0XB 4EB6A 4YJ2A 3OMAB 4O4LB 2EINB 4F6RA 1KBHA 5BR8O 3VQWA 2PYLA 1Z5VA 1AROP 3JYCA 4JAUA 3EHBB 2ZR2A 3T1HO 4JGSA 3LNMB 2GHYA 3RN4A 1M5IA 4ZBMA 4YJ3A 3RYHB 3BAAA 2DOSA 3ETQA 5LP6A 1IURA 5LA6A 4K8XA 1Y4MA 3P3PA 2PTMA 2JDIG 3QG5A 4ASUG 3CCLV 1FJGB 5LMNB 3RYIA 3ML0A 5JH7B 2DWEC 5J2UA 3T1YB 1XMOB 3K3WA 1FPOA 4CH6A 1BZKA 4UCRA 4LFBO 4KUMA 1XREA 3K58A 1JR9A 3OM3B 1WPBA 1R6NA 2CE4A 2EZOA 1WP7A 1IX9A 2KB1A 4QJFB 3ZMVA 4O4IA 4JI3O 4TSFG 1B04A 1I7FA 5L3CA 3ABTA 3AG4C 1SETA 4GLXA 3VQXA 1N36O 3B2EE 3ZBHA 2XT9A 4TV8A 2VQEO 2R9RB 2OT5A 4X8AA 1IBKB 4R6ZA 3UM7A 2UUCB 4D7TA 4ZHQA 4X89A 2AHYA 2DMXA 4YHHO 1LUWA 3D8CA 5KHIA 4WFAV 1YXBA 2GV9A 2WLIB 3QTCA 3ASOC 4CBCA 3A0BZ 5K1XA 5J2TB 1FXKB 2B1IA 5J2UB 5JH7A 1D5AA 4DXWA 2AXTZ 5CMUA 4GT1A 5CA3A 2KG7B 2RNBA 3JD4A 4DV3B 1X4TA 3RWRD 2W6IG 2XHBA 2JS3A 4WFEA 1FS0G 1KECA 4O4IB 1ZL8A 1SQBH 5C8YA 1Q6UA 2HEPA 1OCCC 2LP7A 4X1YA 2CTPA 4B3RO 1Y76B 2LQTA 3ZHSA 4CH4A 2Q73A 3E35A 2PGGA 1VQNV 1B06A 4U7NA 3HKCA 4PA7A 2AGAA 2HVKC 5J9PC 3ZMUA 1Q6HA 3F7VC 3SPCA 1Q81W 5IY5B 4K35A 2O57A 4OGQB 3JARB 1OCZC 1RSOA 2JJ2G 1Q90D 1RFYA 3WU2Z 1I08A 5IYZB 2LW7A 4MVQA 2WLIA 5LYJA 4DUZB 2IJJA 3U11A 3FFQA 5JCOA 2IH3C 3TETA 3CCQV 1SKVA 3K5OA 2EJRA 3ZRWB 5KA6A 4J41A 4JI0O 1JQ0A 1MG1A 2W0XA 1M56C 1Q86W 4JTAB 3O65A 2GUZA 3U0ZA 1JJ2U 2VQFO 2E75B 2HHHB 1OZ0A 2NLJC 1F4NA 5LXTB 4W4LA 4IIJB 4DV6O 4I4TB 3ABKC 3AK3A 1WNSA 1VIBA 3L74H 3ZEDA 3K9SA 1W0KG 4HZ3A 2EBOA 4PJ0Z 5BY1A 5IY5C 2XTAA 3QF7A 1DTOA 2ILMA 1XMQO 4PI0A 1NVPD 2F23A 2NR5A 3LDEA 1HDJA 2Z0AA 1FFXB 2HP8A 1YJNV 1QQCA 3CD6V 4QIWF 2CGOA 1BE3H 1EN5A 1S5JA 3D36A 3GVMA 5FL7G 2IJKA 1WAZA 2AZ2A 4MVSA 1H8HG 2M7WA 3JASA 1TUEB 4J9ZB 1M56B 2E74B 3CRQA 1FFTB 1EN4A 3SJQC 2X7RB 1D2DA 4DR3O 2CTWA 2XAFA 2V1DA 3Q4HA 4JPRA 1ZTEA 5CBFA 4UVBA 2YXYA 1GTOA 4DRXB 3FYIB 4JI4O 5KX5B 1HNZB 1KQSU 2NNUA 2LGQA 1AI7A 3ABLB 5ITZA 4DV0B 2ADQB 1E1QG 4DV2O 2DYRC 1G1XB 5B1BB 2Y0IA 4D7SA 3BA8A 1XNQB 1I5XA 2N04A 2MK3A 5DECA 2DQ3A 1V9PA 3JAKA 3JD3A 3ETEA 2HG5C 3ICXA 4B3RB 2XAQA 3HKDA 1KP3A 3ZMSA 1QLEC 1RPRA 1K97A 2P67A 2Y48A 4LF7B 4FMTA 2JK5C 2Y69B 2Y4UA 4UCUA 3ABLC 1PNKA 4YIOA 5GTHZ 3RYCB 3OFNG 4PELA 3FB8C 4DUZO 4J9YB 3PJSK 2RQ6A 3BABA 3E2EA 1O9HA 2FB5A 4QPKA 2QKCA 3K57A 4FVMA 2JJ1G 4O4HB 1V55B 4X1IB 2JGDB 4O4JB 3G67A 2PF4E 4MW8A 1QVGU 1SS3A 3SYOA 4NXMO 5KLVH 3DC5A 4X1KB 3B8NA 1HNXB 5H5NA 3A0RA 1GN4A 3STZC 4MVOA 3DTUB 2YS8A 1UPGA 1FXHA 4LC1A 5LOVB 4LF5O 2JS5A 3JAMN 5H9CA 5IWAB 4LH7A 1COWG 1H8EG 2JIZG 4I9WA 1CPYA 3ZMTA 5D5QA 1P84F 1IXMA 3APQA 5JQGB 1BSMA 3CMAV 3I5DA 4JI8O 4H33A 5LXTA 1Q8IA 4I7ZB 3C90A 1WLEA 4XDKA 2YDEA 4DR1B 1H2NA 4JV5B 1H2SB 2CUGA 3GWOA 3OAAG 4FZ1A 1YIJV 3OR7C 2H94A 5BZBA 4I55B 2F43G 4DV5O 4C7UA 3K5LA 2CAZC 2XNDG 3ZIAG 4FJCC 3CCSV 3K03A 4X1IA 3ABKB 3DC6A 3B4SA 3CCJV 1P49A 1YZBA 1JJOA 1KB9F 1U97A 4FLWA 1IBKO 2ZM6O 3KG2A 2Y4TA 1QHTA 4FLYA 1K92A 4CC6A 5J2TA 2BTQB 3UT5B 2P22C 2P90A 3APOA 1AI4A 4DV0O 2UXBB 5GONA 3ZCCA 1S77D 5IYBO 3C3SA 1XMQB 1B6QA 2X6AA 3E8FA 1BHBA 5KX5A 4K8ZA 1ZWIC 2N74A 2EILB 1TVKA 1P7GA 1RM1C 2UU9O 1O9GA 1NZ6A 4MVRA 1FJGO 1EZVH 3G71V 1NR1A 3F5TA 4X62B 4DR6O 4KL1A 2HKOA 3F7YC 4DRXA 2QM7A 5LMNO 3JARA 3P3NA 2WWWA 3DSQA 3LSSA 4N23A 2DYSC 4FLZA 5BR8B 5FPRA 1XHXA 3EXAA 1OCZB 2Q4PA 1PP9H 4PA3A 4DV1O 2L35A 1R3LC 3OW2U 3HKDB 4RQFA 3AEIA 2QWPB 2ZINA 1EBOA 2Q69A 4XDLA 2CH7A 5LMUB 1G4YB 1JMKC 3S3WA 2WLKA 1OJHA 4YIPA 1QR9A 3B77A 4JAVA 1QLNA 3DGEA 4EFBA 1V54C 1WB7A 4ZI7A 4JI4B 1NQTA 4LF4O 2QR4A 2Q7HA 1K9MW 2F4VO 4DV4B 4DV7O 4NTWA 3CEIA 1GO3F 2IU0A 4I4TA 5B1AC 1SZXA 1SQXH 4UB8Z 2DWDC 2EULA 3SYCA 3CXCU 3JALB 3MHHC 4XBFA 3KKYA 2UXCB 2JEUA 1XDCA 2DQ0A 3HKBA 1N34O 1JFFB 3TXSA 1F7YA 1GMGA 3EFFK 4J10A 1JA8A 2A79B 2QA4V 1N34B 1SERA 2P06A 3A2FA 4JAAA 4A5UB 1SA0A 4EKWA 3BHPA 5JQGA 4LFCO 1NR7A 3TGUH 5IWAO 3SYQA 2UUAB 5JJJB 2XAGA 4GKJO 5BMVA 3CMEV 3PN1A 1K5SA 1AILA 2E76B 2OCCB 1H38A 2HFEC 4MTGA 3OEHG 2D2CB 3K04A 4DR4O 1XL4A 1IBMO 4IHJA 3IJ4A 1K5QA 4LF5B 4J11A 5JCOC 2GTAA 5L3BA 3W7TA 4EFEA 1G8MA 1K33A 1BL8A 3ABUA 3K06A 5DEDA 1XILA 4LH6A 5KA5A 1VQPV 5E79Z 4WBNA 4DUYO 4MVZA 5LMUO 1K34A 4GKJB 4NR1A 5KHHA 3W7WA 2BOCC 2V7QG 2EIJC 2X0LA 3SJBC 1AJNA 1GKFA 1NTZH 2PI4A 3H1IH 1XL6A 5EBWC 3G4SV 3JCZA 2MW2B 3K0GA 4LP8A 4UXNA 3RT3C 2L6LA 2Q6AA 4WFFA 1XI1A 3SJAC 1B3QA 4OXSA 4B3SO 2VRZA 3BY6A 1P7BA 3E8GA 1FKAO 3ZRVA 1J5EO 2GDSA 3OEEG 2ZE5A 3IAYA 4O2AB
chains in the Genus database with same CATH topology
1VF6C 1Y74A 1Y76B 1ZL8B 1ZL8A 1RSOB 1Y74B 3B40A 1VF6A 1Y76A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VF6 C;  1Y74 A;  1Y76 B;  1ZL8 B;  1ZL8 A;  1RSO B;  1Y74 B;  3B40 A;  1VF6 A;  1Y76 A; 
#chains in the Genus database with same CATH topology
 4GZR B;  4PD4 F;  1F4M A;  3CWB H;  4BR6 A;  2JGD A;  4UB6 Z;  4LR3 A;  3AG3 C;  4O4J A;  3B8M A;  4WCE V;  2EZP A;  1GM8 A;  4RUE A;  1FXV A;  1VQ6 V;  4QPJ A;  4MVU A;  3HKE B;  3L72 H;  2PYJ A;  4DK0 A;  2A06 H;  1KD1 W;  1TUB A;  3C3T A;  1I94 O;  2B5U A;  3STL C;  3T1C A;  1SC5 B;  1KYO F;  4UV8 A;  4PHZ A;  4RUF A;  4JYA B;  2XAS A;  3LNN A;  4FLU A;  2YIC A;  2AZ0 A;  2YXH A;  5LOV A;  3OUS A;  4JI7 O;  2GSM B;  1YTF B;  4MS2 A;  4QE7 A;  4X62 O;  3K9A A;  1AI6 A;  4MSW C;  1VF6 C;  4J80 A;  2Z3Y A;  1HWY A;  3OTO B;  1M90 W;  1YJW V;  1ENV A;  2PUS A;  3SJC C;  4DR5 O;  3SYA A;  1VQK V;  2B9Z A;  3AG3 B;  3CRM A;  4PA9 A;  4YJ2 B;  2ZNI A;  1NH2 B;  4B3S B;  2OIE A;  3JAW B;  5LL6 Y;  4LF9 B;  3CCU V;  2F66 C;  2XAH A;  3W7U A;  3ZN0 A;  4J7J A;  1SRY A;  4NKG B;  1WJZ A;  1NS1 A;  3CS5 A;  1UJW B;  1AR5 A;  3RGB A;  2A7W A;  3ZRS A;  1K4D C;  2RN9 A;  3RYI B;  3AG7 A;  1BQZ A;  5E1A C;  2R9A A;  1Y74 A;  2OTJ V;  3BEH A;  3FX7 A;  5GON B;  3HR0 A;  1YF2 A;  3B40 A;  5K1P A;  1QLE B;  3RYF A;  3QVN A;  4JI8 B;  1DLB A;  4JTC B;  2NN4 A;  5H2F Z;  4FIP C;  3N2G A;  3FAV A;  1W59 A;  4DR1 O;  3RVZ A;  3WG7 C;  3M99 B;  1S3J A;  1YEW A;  5B3S B;  2UXC O;  1VQ7 V;  2IJI A;  2OCH A;  4RO2 A;  4UCV A;  4GKK B;  2EJ7 A;  2QE7 G;  4J7Z A;  3SGI A;  3LSU A;  2QTS A;  2Q67 A;  1U96 A;  4X66 B;  1XQ8 A;  1NH2 D;  2W0F C;  3MHS C;  2RDC A;  5IYZ A;  5EIB C;  4GKK O;  3OD4 A;  3LDC A;  1N8R W;  4PDL A;  1RM1 B;  4LFC B;  3A8T A;  2PZS A;  2W6J G;  1TAE A;  3D3I A;  3QNE A;  4NB5 A;  1PPJ H;  3UKM A;  3JAS B;  3ASO B;  4LNU A;  1FD9 A;  4GX2 A;  4FLT A;  2BSK A;  3ZHQ A;  3E8B A;  1K4C C;  3OR6 C;  2YIB A;  1A32 A;  1VAR A;  4KXR A;  3OTO O;  1F23 A;  4ZI7 B;  1H2G A;  2Q8V A;  4I50 B;  1R3J C;  3Q4H B;  1JX9 A;  2GBO A;  1PKX A;  1N33 B;  1LR1 A;  1Z5W A;  2R70 A;  1ZL8 B;  2VWK A;  3SPG A;  2VWJ A;  1Q7Y W;  4KP4 A;  3N2G B;  4FM2 A;  3L70 H;  4LF8 O;  3TCU A;  1OCC B;  2YI8 A;  4DV4 O;  4DV7 B;  4X64 B;  3BCC H;  4JYA O;  1AI5 A;  1BGY H;  2Q0O C;  4DO2 A;  2Q7G A;  1NU1 H;  2ETN A;  3D36 C;  3K79 A;  5IJ9 B;  1GN2 A;  1N36 B;  2P6J A;  4U3J A;  1YHQ V;  3CHX A;  2BOB C;  5B1B C;  3E22 A;  5D5P A;  4MTX A;  4NVP A;  1HR0 B;  4YXW G;  1AB3 A;  1RSO B;  3J7A U;  2A9H A;  1KC8 W;  4JI5 O;  1V54 B;  4X65 O;  5H6R A;  3LUT B;  4B3M B;  3H01 A;  2R72 A;  3W7S A;  3H1K H;  2OYQ A;  3UO2 A;  3X2Q C;  3TJT A;  4HBN A;  2P4K A;  1KUQ A;  1M93 A;  2CTQ A;  5EK0 A;  4TQD A;  5L3D A;  2PI5 A;  3BFR A;  3ZRW A;  3HPL C;  2DN9 A;  3ZHV A;  4LF6 O;  3QO8 A;  5A9G A;  2H3O A;  3TK1 A;  1Y67 A;  2QSA A;  1MZE A;  5EC1 C;  5KAF Z;  1JCH A;  2YSU B;  4LFA B;  2OCC C;  4JI7 B;  4JI0 B;  4XDJ A;  2DYS B;  5FNV B;  4NTX A;  3JSN A;  1QNM A;  3JD2 A;  3IGA C;  4RWU A;  1YI2 V;  4WBN B;  4X65 B;  5KUM A;  2RJZ A;  4LF9 O;  1Y6X A;  4UVC A;  4GX5 A;  3J81 N;  4GX1 A;  4AHC A;  4OX9 O;  3BRC A;  3HB3 B;  4P2Z A;  1M4U A;  1BMF G;  5DN6 G;  4DR5 B;  3WB0 A;  3JAW A;  5JJN B;  4DV1 B;  2E3C A;  3D3Q A;  1S5L Z;  5IJ0 B;  4U3F H;  2CGN A;  1M57 B;  3SPI A;  1N0J A;  2ZE6 A;  3R66 A;  1NTK H;  4D6T H;  5CA1 A;  1W2B U;  4LFB B;  3OMI B;  3H1H H;  5KHJ A;  4GX0 A;  4AIL C;  4QE9 A;  4LWS A;  1NVP B;  1Q6I A;  2Z5U A;  1H2K A;  4FM1 A;  4ZKI A;  1MA1 A;  2LGW A;  2UXX A;  3MDS A;  4LF8 B;  4K0K O;  1BT8 A;  2ZD9 A;  2DJV A;  1KMI Z;  3FYE B;  1MMM A;  1YCI A;  2QKA A;  4DUY B;  1VMG A;  4TUY A;  4CZZ A;  1JOY A;  1BS3 A;  5B1O A;  4L8J A;  4W4K A;  3DXR B;  3UQ8 A;  3FKS G;  4LNU B;  2E5L B;  1EZJ A;  4JI6 O;  3CP1 A;  3G6B A;  2WLL A;  4LF7 O;  2BTQ A;  3JAT A;  4UCT A;  2YXL A;  4PDV A;  1WP8 A;  4JI2 B;  2F93 B;  4I5S A;  4X66 O;  2ZT9 B;  3R65 A;  1GRJ A;  5KMG A;  2ZM6 B;  1PNM A;  1QBZ A;  4P9O A;  2VQF B;  4ZOL B;  5LGN A;  3CYO A;  3OTF A;  1IVS A;  2IH1 C;  5CBH A;  3OGC C;  1PM9 A;  4UCS A;  1XBL A;  1VQ8 V;  3BPZ A;  4HYO A;  2QM8 A;  2Y69 C;  2EX3 A;  3QO7 A;  1DK1 A;  4JYB A;  1VQO V;  4CH3 A;  5GW7 A;  3UT5 A;  2BSK B;  1NTM H;  2EIM B;  4DR2 O;  3IC9 A;  4JI1 B;  2QJ1 A;  3CSX A;  4GCZ A;  2YID A;  4FLX A;  2OWO A;  1OCR C;  5KUK A;  1NJI W;  5IYC O;  1SF9 A;  2JGU A;  1Q82 W;  4DR3 B;  2ZE7 A;  2DW4 A;  1VF6 A;  1WPX A;  2A0L A;  4HAM A;  5HFL A;  2FYU H;  1GM9 A;  1ZSP A;  4TV9 B;  2UU9 B;  2WLL B;  2ZE8 A;  5L3G A;  2D3O W;  4U3J B;  3RFR A;  2FL4 A;  2IBZ H;  3KZI Z;  3N27 A;  2IM9 A;  2K1E A;  1GAX A;  4R50 A;  4JZG A;  1OHH G;  3FAV B;  3ZX6 A;  1YIT V;  2YIA A;  1K73 W;  3IC7 A;  5LHI A;  3SR2 C;  3ASN C;  2Q5Z A;  4F6E A;  1GM7 A;  3S3X A;  4DV2 B;  1R3I C;  4ZHQ B;  1GN3 A;  3RVY A;  4RQE A;  1CP9 A;  3P32 A;  4Q20 A;  2Q9L A;  3MAQ A;  4I55 A;  1G6U A;  1XHZ A;  2ATK C;  2QWQ B;  2ZXW B;  4Z2W A;  4G2K A;  3RBZ A;  4J42 A;  1SQQ H;  1AP6 A;  1VQM V;  5C93 A;  3G80 A;  3ZN1 A;  1ZAU A;  3SYP A;  4PI2 A;  2ZNJ A;  4EEQ A;  5LA6 B;  3CRR A;  1P4R A;  3N2K B;  1D5N A;  1W0J G;  3KCY A;  1IBL B;  5A2Q N;  4H13 B;  1PL4 A;  4DR2 B;  5LHH A;  4R8C A;  1IZ3 A;  1AJQ A;  4B3M O;  1JFF A;  4E2L A;  2EIN C;  4YJ3 B;  3RYH A;  4IHJ B;  5LP6 B;  4RAI A;  4B3T B;  1Y76 A;  1N4C A;  1Q5O A;  2WA4 A;  3FB5 C;  2QWN B;  4HNA B;  2EIK B;  3JAL A;  2ITD C;  2JEX A;  4OPH A;  4BWA A;  1K8A W;  1J5E B;  1SQP H;  1YSC A;  1SQV H;  4J7K A;  2ITC C;  1NT2 B;  2R9I A;  4QNH B;  3AG4 B;  2YIB D;  5CN0 A;  5FPO A;  5F2V O;  3F5W C;  5EYP B;  1VF5 B;  2B1G A;  4JTD B;  1OV9 A;  3ZRX A;  4CH5 A;  2A3Q A;  5GTI Z;  5BMV B;  1I94 B;  1N33 O;  5LP6 C;  3CC2 V;  1THZ A;  1S76 D;  1DF4 A;  4OPA A;  3K08 A;  4ABM A;  5JVD B;  4JF3 A;  1HP8 A;  3CJH A;  1AR4 A;  3TXQ A;  1MSW D;  4O2B B;  3RW0 A;  1WB8 A;  3CX5 F;  1TA8 A;  3JD1 A;  3JAT B;  5JJE B;  3FB7 C;  3H1L H;  1M1K W;  1Q3E A;  2UXN A;  1XNR B;  1R1B A;  3B09 A;  1AJP A;  4BW5 A;  4G28 B;  2KG7 A;  2N05 A;  4IIJ A;  2EIK C;  1FXK C;  4JI2 O;  3VOU A;  2WA3 A;  1XNR O;  2QM4 A;  3UCS C;  3CC7 V;  4NXM B;  5EZY B;  5C8Y B;  3U10 A;  4MT8 A;  3SPH A;  4MTO A;  4X1Y B;  2AW9 A;  2OTL V;  1L8D A;  2KSD A;  1T5E A;  1UFI A;  4B08 A;  2GTS A;  3IFX A;  1MAB G;  5B3S C;  3ZHR A;  2F95 B;  3L9D A;  4IYH A;  2ZR3 A;  4WF9 V;  3CC4 V;  4AQY B;  1Y66 A;  2ARH A;  1I5Y A;  1OCO B;  4DW0 A;  1FXK A;  2Q68 A;  3H1J H;  3HKE A;  3AK1 A;  3JSL A;  3CB2 A;  1AR1 B;  1GK9 A;  5JWP A;  3GB7 C;  1TUB B;  4JYY A;  4B7E A;  3WB2 A;  4UFZ A;  1E79 G;  3HKC B;  4O2B A;  5CBG A;  3ABM C;  4LF4 B;  3LSQ A;  1WA8 A;  1IBM B;  3BVO A;  5LGU A;  2VQE B;  4WFB V;  4UCO A;  5CA0 A;  5IE9 A;  3CCE V;  3G6E V;  3FD9 A;  1Z2G A;  2IJH A;  4E4E A;  3ZHU A;  2BTO A;  3T1H B;  4MVM A;  1DF5 A;  5EIB D;  5EZY A;  4JI3 B;  5CB4 A;  4MTF A;  1QVF U;  1HW7 A;  2H8P C;  3X2Q B;  3AG1 C;  4TOI A;  3T4Z A;  4DW1 A;  4NYK A;  1EFR G;  2QGN A;  2GUZ B;  2HVJ C;  2ZIM A;  1Y74 B;  4CS3 A;  2EIJ B;  3T1Y O;  1XMO O;  1HNZ O;  4K0K B;  1VQL V;  1FFX A;  1S5H C;  2HLD G;  4DYL A;  3I55 V;  1YJ9 V;  2K9P A;  3CPW U;  2F1M A;  4YY3 O;  3MD0 A;  4HNA A;  1EM1 A;  4H0L B;  1HNW B;  4LF6 B;  2Q7E A;  1ZUQ A;  1R73 A;  5IDJ A;  2QWR B;  3JCU Z;  5B1N A;  2YI9 A;  1WA8 B;  3L73 H;  3ZMZ A;  4BIO A;  1BCC H;  1LUV A;  1Q43 A;  1X59 A;  4DR7 O;  5EC2 C;  3RYF B;  4MW3 A;  3WFV A;  3CCR V;  2YUA A;  4P30 A;  2Y0P A;  3JD0 A;  4GUN A;  2WLM A;  2IW5 A;  3E89 A;  4WFG A;  1I0H A;  1VF7 A;  1N32 B;  1KP2 A;  5B66 Z;  5TIS Z;  1URF A;  1L0L H;  1ROP A;  4TV9 A;  4LFA O;  1JPX A;  4DR6 B;  5IYD O;  4FK5 C;  3E8H A;  4JYC A;  1JVM A;  2QTO A;  2FKX A;  1QCE A;  1ORQ C;  4DV6 B;  1CEZ A;  3K59 A;  2KQX A;  4JI6 B;  5EYP A;  4Z1M G;  4JV5 O;  1K7D A;  4I50 A;  4P9P A;  3OT7 A;  4X20 B;  2X6C A;  4FLV A;  2WLN A;  5B5E Z;  4AQY O;  2IU3 A;  2CDY A;  5JVD A;  2EIL C;  2WAM A;  4O4L A;  4F6R B;  1NBM G;  1HR0 O;  3OUF A;  1NKD A;  2P7T C;  4CS2 A;  4FFB A;  1V55 C;  3AG2 B;  2X6B A;  4X88 A;  3QO5 A;  3VBB A;  5IJ9 A;  1IXB A;  3T2M A;  1F51 A;  4O4H A;  4B7K A;  1M57 C;  4Z1V A;  5ITZ B;  1R3K C;  4DR4 B;  1MZF A;  4QGP A;  4X64 O;  2LJ2 A;  1OCO C;  4WFH A;  4LBE C;  1KU9 A;  3RYC A;  1EN6 A;  2PY5 A;  4H37 A;  2V4D A;  2OIG A;  4UVA A;  2XOK G;  1PNL A;  2P5O A;  1H2M A;  2RMK B;  3WG7 B;  3JAK B;  2LW1 A;  2E5L O;  1H2L A;  5CA0 B;  4JI1 O;  1WN7 A;  1YTF D;  3GWK C;  1FYJ A;  4DV3 O;  4X1K A;  4X20 A;  1LNQ A;  3E83 A;  3ZS8 C;  4H44 B;  5FNV A;  2HJD A;  4YHH B;  1M9N A;  4YY3 B;  3CE2 A;  3O9O A;  2YC0 A;  5DM6 V;  3CRA A;  4IT5 A;  5AG2 A;  3AG1 B;  4ICG A;  3E86 A;  2HJF C;  2UUB O;  2UUC O;  4TWK A;  4PA4 A;  4BIU A;  4CS4 A;  1N32 O;  1RP3 B;  2VS0 A;  4L87 A;  2UXD B;  4PDR A;  1GH6 A;  5KHG A;  3THO A;  4TT3 G;  1TGO A;  1RPO A;  2DE0 X;  2WLJ A;  3AK2 A;  1QR8 A;  2F4V B;  4IGG A;  3K5M A;  2YEV B;  1E1R G;  2ZDI A;  4CC5 A;  4BAY A;  4OX9 B;  3CJH B;  2BE3 A;  2XAJ A;  4I0X A;  4EB6 B;  1OCR B;  2G38 A;  5KHK A;  2EIM C;  5FLX N;  4PV1 B;  2QEX V;  4FM0 A;  2XUM A;  4UV9 A;  4PDM A;  1YDX A;  1N0N A;  2C2A A;  5LGT A;  2ZXW C;  2UXD O;  2WSS G;  1IBL O;  4GYC B;  4PA6 A;  2Q0A A;  3OMN B;  2CTR A;  2QWO B;  3H9V A;  1VQ4 V;  3LDD A;  2AHZ A;  4TQF A;  3K5N A;  3CXH F;  1MNG A;  4KHP B;  3P30 A;  3FB6 C;  5L3E A;  1VQ5 V;  1PV0 A;  1R6T A;  1R6K A;  1SQG A;  1L1F A;  3CCM V;  1XOU A;  2M6Y A;  3L71 H;  1SA0 B;  5CA1 B;  3E22 B;  4DR7 B;  3M7M X;  3ETG A;  2DYR B;  1KKC A;  5LHG A;  3NR7 A;  1DGS A;  2YEV A;  2ZCE A;  1PL0 A;  3DXR A;  4TV8 B;  5IT9 N;  4DK1 A;  1AVM A;  4I9Q A;  1J95 A;  2UUB B;  3CCV V;  1YVW A;  3VQV A;  4KHP O;  1SQF A;  2CH7 B;  4FFK A;  3ABM B;  4NXN O;  5EBM C;  3M8A A;  4X9Q A;  3WB1 A;  4ZIB A;  4F4L A;  1AP5 A;  4IL6 Z;  1CXZ B;  2HHH O;  2CK3 G;  1TVK B;  3J80 N;  1S72 V;  2ZQM A;  3UO3 A;  2P4V A;  5CB4 B;  3K0D A;  2HR3 A;  2WPD G;  2ZDI C;  4JI5 B;  3AG2 C;  5KMG B;  3L75 H;  3SDL A;  3BA9 A;  2ZIO A;  4U7O A;  4FFB B;  2JRI A;  5KAI Z;  2LFS A;  3VQY A;  2UXB O;  1ZLZ A;  1NI8 A;  4BIZ A;  5B1A B;  2FML A;  4IYI A;  5H6Q A;  5IJ0 A;  1VQ9 V;  1SZT A;  5LBQ A;  1L0N H;  4NXN B;  3OGI B;  2WLH A;  4G27 B;  1KKD A;  3I56 V;  4R7C A;  4FZ0 A;  2FTK A;  1MOF A;  3ZJZ A;  1SES A;  1US6 A;  4O2A A;  3W7X A;  1XNQ O;  2ODM A;  1VEW A;  4LWS B;  1ZX3 A;  1S0V A;  2BCC H;  4NTY A;  4DV5 B;  3KCX A;  5EBL C;  4BW9 A;  1XUQ A;  4JAS A;  2UUA O;  2ZKO A;  1IDS A;  1VP7 A;  2JVD A;  2RCV A;  3ETD A;  4UUJ C;  4AI8 A;  3A0H Z;  5LYJ B;  4TUY B;  1K3E A;  2LFR A;  2QDO A;  1HNW O;  3HKB B;  1GN6 A;  3ZHT A;  1XEQ A;  3EVK A;  1QU7 A;  3ASN B;  3T4D A;  5L3F A;  1MSD A;  4JZ2 A;  2QKS A;  4FPP A;  1BHA A;  4LCU C;  4N21 A;  1PD3 A;  3OE7 G;  3NXS A;  4B3T O;  3SPJ A;  3CRC A;  2LO1 A;  4K3A A;  2ADP A;  4ZOL A;  1HNX O;  5HFM A;  4Q6G A;  5BXZ A;  1BQ0 A;  4KFM A;  2KKW A;  3N2K A;  1FAF A;  4I0X B;  4EB6 A;  4YJ2 A;  3OMA B;  4O4L B;  2EIN B;  4F6R A;  1KBH A;  5BR8 O;  3VQW A;  2PYL A;  1Z5V A;  1ARO P;  3JYC A;  4JAU A;  3EHB B;  2ZR2 A;  3T1H O;  4JGS A;  3LNM B;  2GHY A;  3RN4 A;  1M5I A;  4ZBM A;  4YJ3 A;  3RYH B;  3BAA A;  2DOS A;  3ETQ A;  5LP6 A;  1IUR A;  5LA6 A;  4K8X A;  1Y4M A;  3P3P A;  2PTM A;  2JDI G;  3QG5 A;  4ASU G;  3CCL V;  1FJG B;  5LMN B;  3RYI A;  3ML0 A;  5JH7 B;  2DWE C;  5J2U A;  3T1Y B;  1XMO B;  3K3W A;  1FPO A;  4CH6 A;  1BZK A;  4UCR A;  4LFB O;  4KUM A;  1XRE A;  3K58 A;  1JR9 A;  3OM3 B;  1WPB A;  1R6N A;  2CE4 A;  2EZO A;  1WP7 A;  1IX9 A;  2KB1 A;  4QJF B;  3ZMV A;  4O4I A;  4JI3 O;  4TSF G;  1B04 A;  1I7F A;  5L3C A;  3ABT A;  3AG4 C;  1SET A;  4GLX A;  3VQX A;  1N36 O;  3B2E E;  3ZBH A;  2XT9 A;  4TV8 A;  2VQE O;  2R9R B;  2OT5 A;  4X8A A;  1IBK B;  4R6Z A;  3UM7 A;  2UUC B;  4D7T A;  4ZHQ A;  4X89 A;  2AHY A;  2DMX A;  4YHH O;  1LUW A;  3D8C A;  5KHI A;  4WFA V;  1YXB A;  2GV9 A;  2WLI B;  3QTC A;  3ASO C;  4CBC A;  3A0B Z;  5K1X A;  5J2T B;  1FXK B;  2B1I A;  5J2U B;  5JH7 A;  1D5A A;  4DXW A;  2AXT Z;  5CMU A;  4GT1 A;  5CA3 A;  2KG7 B;  2RNB A;  3JD4 A;  4DV3 B;  1X4T A;  3RWR D;  2W6I G;  2XHB A;  2JS3 A;  4WFE A;  1FS0 G;  1KEC A;  4O4I B;  1ZL8 A;  1SQB H;  5C8Y A;  1Q6U A;  2HEP A;  1OCC C;  2LP7 A;  4X1Y A;  2CTP A;  4B3R O;  1Y76 B;  2LQT A;  3ZHS A;  4CH4 A;  2Q73 A;  3E35 A;  2PGG A;  1VQN V;  1B06 A;  4U7N A;  3HKC A;  4PA7 A;  2AGA A;  2HVK C;  5J9P C;  3ZMU A;  1Q6H A;  3F7V C;  3SPC A;  1Q81 W;  5IY5 B;  4K35 A;  2O57 A;  4OGQ B;  3JAR B;  1OCZ C;  1RSO A;  2JJ2 G;  1Q90 D;  1RFY A;  3WU2 Z;  1I08 A;  5IYZ B;  2LW7 A;  4MVQ A;  2WLI A;  5LYJ A;  4DUZ B;  2IJJ A;  3U11 A;  3FFQ A;  5JCO A;  2IH3 C;  3TET A;  3CCQ V;  1SKV A;  3K5O A;  2EJR A;  3ZRW B;  5KA6 A;  4J41 A;  4JI0 O;  1JQ0 A;  1MG1 A;  2W0X A;  1M56 C;  1Q86 W;  4JTA B;  3O65 A;  2GUZ A;  3U0Z A;  1JJ2 U;  2VQF O;  2E75 B;  2HHH B;  1OZ0 A;  2NLJ C;  1F4N A;  5LXT B;  4W4L A;  4IIJ B;  4DV6 O;  4I4T B;  3ABK C;  3AK3 A;  1WNS A;  1VIB A;  3L74 H;  3ZED A;  3K9S A;  1W0K G;  4HZ3 A;  2EBO A;  4PJ0 Z;  5BY1 A;  5IY5 C;  2XTA A;  3QF7 A;  1DTO A;  2ILM A;  1XMQ O;  4PI0 A;  1NVP D;  2F23 A;  2NR5 A;  3LDE A;  1HDJ A;  2Z0A A;  1FFX B;  2HP8 A;  1YJN V;  1QQC A;  3CD6 V;  4QIW F;  2CGO A;  1BE3 H;  1EN5 A;  1S5J A;  3D36 A;  3GVM A;  5FL7 G;  2IJK A;  1WAZ A;  2AZ2 A;  4MVS A;  1H8H G;  2M7W A;  3JAS A;  1TUE B;  4J9Z B;  1M56 B;  2E74 B;  3CRQ A;  1FFT B;  1EN4 A;  3SJQ C;  2X7R B;  1D2D A;  4DR3 O;  2CTW A;  2XAF A;  2V1D A;  3Q4H A;  4JPR A;  1ZTE A;  5CBF A;  4UVB A;  2YXY A;  1GTO A;  4DRX B;  3FYI B;  4JI4 O;  5KX5 B;  1HNZ B;  1KQS U;  2NNU A;  2LGQ A;  1AI7 A;  3ABL B;  5ITZ A;  4DV0 B;  2ADQ B;  1E1Q G;  4DV2 O;  2DYR C;  1G1X B;  5B1B B;  2Y0I A;  4D7S A;  3BA8 A;  1XNQ B;  1I5X A;  2N04 A;  2MK3 A;  5DEC A;  2DQ3 A;  1V9P A;  3JAK A;  3JD3 A;  3ETE A;  2HG5 C;  3ICX A;  4B3R B;  2XAQ A;  3HKD A;  1KP3 A;  3ZMS A;  1QLE C;  1RPR A;  1K97 A;  2P67 A;  2Y48 A;  4LF7 B;  4FMT A;  2JK5 C;  2Y69 B;  2Y4U A;  4UCU A;  3ABL C;  1PNK A;  4YIO A;  5GTH Z;  3RYC B;  3OFN G;  4PEL A;  3FB8 C;  4DUZ O;  4J9Y B;  3PJS K;  2RQ6 A;  3BAB A;  3E2E A;  1O9H A;  2FB5 A;  4QPK A;  2QKC A;  3K57 A;  4FVM A;  2JJ1 G;  4O4H B;  1V55 B;  4X1I B;  2JGD B;  4O4J B;  3G67 A;  2PF4 E;  4MW8 A;  1QVG U;  1SS3 A;  3SYO A;  4NXM O;  5KLV H;  3DC5 A;  4X1K B;  3B8N A;  1HNX B;  5H5N A;  3A0R A;  1GN4 A;  3STZ C;  4MVO A;  3DTU B;  2YS8 A;  1UPG A;  1FXH A;  4LC1 A;  5LOV B;  4LF5 O;  2JS5 A;  3JAM N;  5H9C A;  5IWA B;  4LH7 A;  1COW G;  1H8E G;  2JIZ G;  4I9W A;  1CPY A;  3ZMT A;  5D5Q A;  1P84 F;  1IXM A;  3APQ A;  5JQG B;  1BSM A;  3CMA V;  3I5D A;  4JI8 O;  4H33 A;  5LXT A;  1Q8I A;  4I7Z B;  3C90 A;  1WLE A;  4XDK A;  2YDE A;  4DR1 B;  1H2N A;  4JV5 B;  1H2S B;  2CUG A;  3GWO A;  3OAA G;  4FZ1 A;  1YIJ V;  3OR7 C;  2H94 A;  5BZB A;  4I55 B;  2F43 G;  4DV5 O;  4C7U A;  3K5L A;  2CAZ C;  2XND G;  3ZIA G;  4FJC C;  3CCS V;  3K03 A;  4X1I A;  3ABK B;  3DC6 A;  3B4S A;  3CCJ V;  1P49 A;  1YZB A;  1JJO A;  1KB9 F;  1U97 A;  4FLW A;  1IBK O;  2ZM6 O;  3KG2 A;  2Y4T A;  1QHT A;  4FLY A;  1K92 A;  4CC6 A;  5J2T A;  2BTQ B;  3UT5 B;  2P22 C;  2P90 A;  3APO A;  1AI4 A;  4DV0 O;  2UXB B;  5GON A;  3ZCC A;  1S77 D;  5IYB O;  3C3S A;  1XMQ B;  1B6Q A;  2X6A A;  3E8F A;  1BHB A;  5KX5 A;  4K8Z A;  1ZWI C;  2N74 A;  2EIL B;  1TVK A;  1P7G A;  1RM1 C;  2UU9 O;  1O9G A;  1NZ6 A;  4MVR A;  1FJG O;  1EZV H;  3G71 V;  1NR1 A;  3F5T A;  4X62 B;  4DR6 O;  4KL1 A;  2HKO A;  3F7Y C;  4DRX A;  2QM7 A;  5LMN O;  3JAR A;  3P3N A;  2WWW A;  3DSQ A;  3LSS A;  4N23 A;  2DYS C;  4FLZ A;  5BR8 B;  5FPR A;  1XHX A;  3EXA A;  1OCZ B;  2Q4P A;  1PP9 H;  4PA3 A;  4DV1 O;  2L35 A;  1R3L C;  3OW2 U;  3HKD B;  4RQF A;  3AEI A;  2QWP B;  2ZIN A;  1EBO A;  2Q69 A;  4XDL A;  2CH7 A;  5LMU B;  1G4Y B;  1JMK C;  3S3W A;  2WLK A;  1OJH A;  4YIP A;  1QR9 A;  3B77 A;  4JAV A;  1QLN A;  3DGE A;  4EFB A;  1V54 C;  1WB7 A;  4ZI7 A;  4JI4 B;  1NQT A;  4LF4 O;  2QR4 A;  2Q7H A;  1K9M W;  2F4V O;  4DV4 B;  4DV7 O;  4NTW A;  3CEI A;  1GO3 F;  2IU0 A;  4I4T A;  5B1A C;  1SZX A;  1SQX H;  4UB8 Z;  2DWD C;  2EUL A;  3SYC A;  3CXC U;  3JAL B;  3MHH C;  4XBF A;  3KKY A;  2UXC B;  2JEU A;  1XDC A;  2DQ0 A;  3HKB A;  1N34 O;  1JFF B;  3TXS A;  1F7Y A;  1GMG A;  3EFF K;  4J10 A;  1JA8 A;  2A79 B;  2QA4 V;  1N34 B;  1SER A;  2P06 A;  3A2F A;  4JAA A;  4A5U B;  1SA0 A;  4EKW A;  3BHP A;  5JQG A;  4LFC O;  1NR7 A;  3TGU H;  5IWA O;  3SYQ A;  2UUA B;  5JJJ B;  2XAG A;  4GKJ O;  5BMV A;  3CME V;  3PN1 A;  1K5S A;  1AIL A;  2E76 B;  2OCC B;  1H38 A;  2HFE C;  4MTG A;  3OEH G;  2D2C B;  3K04 A;  4DR4 O;  1XL4 A;  1IBM O;  4IHJ A;  3IJ4 A;  1K5Q A;  4LF5 B;  4J11 A;  5JCO C;  2GTA A;  5L3B A;  3W7T A;  4EFE A;  1G8M A;  1K33 A;  1BL8 A;  3ABU A;  3K06 A;  5DED A;  1XIL A;  4LH6 A;  5KA5 A;  1VQP V;  5E79 Z;  4WBN A;  4DUY O;  4MVZ A;  5LMU O;  1K34 A;  4GKJ B;  4NR1 A;  5KHH A;  3W7W A;  2BOC C;  2V7Q G;  2EIJ C;  2X0L A;  3SJB C;  1AJN A;  1GKF A;  1NTZ H;  2PI4 A;  3H1I H;  1XL6 A;  5EBW C;  3G4S V;  3JCZ A;  2MW2 B;  3K0G A;  4LP8 A;  4UXN A;  3RT3 C;  2L6L A;  2Q6A A;  4WFF A;  1XI1 A;  3SJA C;  1B3Q A;  4OXS A;  4B3S O;  2VRZ A;  3BY6 A;  1P7B A;  3E8G A;  1FKA O;  3ZRV A;  1J5E O;  2GDS A;  3OEE G;  2ZE5 A;  3IAY A;  4O2A B; 
#chains in the Genus database with same CATH homology
 1VF6 C;  1Y74 A;  1Y76 B;  1ZL8 B;  1ZL8 A;  1RSO B;  1Y74 B;  3B40 A;  1VF6 A;  1Y76 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...