1Y76A

Solution structure of patj/pals1 l27 domain complex
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
62
structure length
62
Chain Sequence
NPAAEKMQVLQVLDRLRGKLQEKGDTTQNEKLSAFYETLKSPLFNQILTLQQSIKQLKGQLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A unified assembly mode revealed by the structures of tetrameric L27 domain complexes formed by mLin-2/mLin-7 and Patj/Pals1 scaffold proteins.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein
molecule keywords protein associated to tight junctions
total genus 23
structure length 62
sequence length 62
chains with identical sequence C
ec nomenclature
pdb deposition date 2004-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09045 L27_2 L27_2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.650 Mainly Alpha Orthogonal Bundle Helix Hairpins L27 domain 1y76A00
1Y74A 1VF6C 1Y76B 1Y76A 1ZL8A 1Y74B 1RSOB 1ZL8B 1VF6A 3B40A
chains in the Genus database with same CATH superfamily
1YXBA 4O4JA 3OMNB 4AQYO 1BGYH 2QKCA 4DV6B 2YEVB 3FB7C 4FLTA 2KQXA 4FPPA 4B3MO 3RVYA 1GN3A 4PA9A 1ORQC 1GM8A 3P32A 2JEUA 3F7YC 1XOUA 4NXNO 3H1KH 1SF9A 4B7EA 2DOSA 4CZZA 1Y76A 3KZIZ 5KA6A 1M90W 4LF5B 3ABMC 4K0KB 4O4LB 3K9SA 1OZ0A 1TAEA 3LNMB 2R72A 1Y66A 5BY1A 4Q20A 4JI0O 3UO3A 3MDSA 1R1BA 2EIKC 4DRXA 4DV7B 4IHJB 2DYSB 4IIJB 5J2TA 4CBCA 3BA8A 2PYLA 2JEXA 3K79A 1VQ4V 5DM6V 5CA0B 3OTFA 3FB6C 1FYJA 1YCIA 1XEQA 5JCOA 4J10A 5IYCO 2A0LA 1AR5A 3JD2A 3UT5B 2YXHA 3SYCA 3LUTB 1VQKV 4IYHA 3JYCA 5IYZA 4KP4A 4DV5O 1R3KC 1W0JG 2UXCO 1VF6A 2R9IA 5DECA 3ZN0A 4U3FH 1N34O 5JWPA 4X64B 2D3OW 1FD9A 4XBFA 5L3CA 3TXQA 3ABKC 2C2AA 3CC2V 4MSWC 2XASA 3LSSA 3M7MX 2FB5A 3VQYA 1FPOA 3K5OA 1BT8A 2DWEC 5H5NA 2LW1A 1XL6A 4JI2O 3AG3B 1YJWV 4HBNA 2VQFB 3OEEG 2KG7A 2XT9A 4RWUA 3JD0A 1TVKA 5FLXN 5H6QA 4UV8A 2ZNJA 1YSCA 1NTZH 4MTXA 4I9QA 4JF3A 3CP1A 3CX5F 4H33A 2LW7A 3CWBH 1TA8A 1GN4A 3ZMZA 1R73A 3E83A 2V4DA 1H2MA 1EN5A 1HP8A 4H44B 2CH7A 3H1JH 1FFXA 2Y0IA 4DV4O 3T1HO 3JASA 2YIAA 1K33A 3AG4C 4C7UA 2Q7GA 2ZD9A 1VF5B 1YJNV 2RN9A 3H9VA 4JI6O 2ZXWC 4K8ZA 3BFRA 4RQFA 5CBGA 1AI4A 3ZRVA 4R6ZA 1XUQA 4WFGA 4NXMO 4DV0O 3SYPA 3ICXA 1Q86W 2UXNA 2KSDA 2X6AA 4JAVA 3ETDA 1RPOA 2HP8A 1QLNA 2QM4A 4DW0A 2E74B 4B3SO 3QNEA 4W4LA 5C8YA 1L8DA 1LUWA 1K73W 4CH5A 1B3QA 3LDDA 1P7GA 4B3SB 1A32A 2A79B 5D5QA 1SQQH 3LSUA 1F4NA 1EN4A 4JI1O 2YI9A 1XNRB 2F4VO 1H8EG 2WA3A 3DC5A 2JDIG 4TV9A 3JARA 2O57A 4I0XB 1OCOB 2Q68A 2NLJC 5KMGB 2CH7B 3C3SA 2EZOA 4LF6O 4HAMA 3CRRA 1MNGA 4DV2B 4I4TB 5IE9A 4P30A 1RM1C 1MSWD 2GUZA 1FAFA 3UM7A 4FM1A 4LF6B 2CTQA 1CEZA 1JX9A 1VQNV 3BCCH 3APQA 2Q73A 3CEIA 2UU9O 1AR4A 3WG7B 4DV1O 4BR6A 1X59A 2P90A 2LJ2A 3D36A 1VEWA 4QNHB 4J9ZB 2DYRC 1P49A 1V55C 1IVSA 4KL1A 1SC5B 1H8HG 1GO3F 4CC6A 2P4KA 2LFSA 4LNUA 2Q7EA 5JQGB 2XOKG 4X64O 1BZKA 1MA1A 1IZ3A 3AG1C 1M1KW 4X1IA 1ZL8A 2JGDA 3F7VC 2UXDO 3WG7C 2EILB 1I7FA 1SQBH 4FLZA 1K5SA 3T2MA 1QVGU 1WJZA 4JI7O 1EZJA 4IHJA 4I50A 2UUCB 1R6TA 1DTOA 2F95B 4MVSA 1K5QA 4FVMA 1HNXB 4MTOA 1M56C 2YIDA 2OT5A 2B1GA 5IY5B 2YXLA 3B2EE 1QR9A 4AI8A 1QHTA 3E22A 1Q6HA 4OXSA 3CHXA 4K3AA 3ZRXA 1K3EA 3GWOA 3DSQA 4ASUG 1AROP 2NR5A 2OCHA 2XAQA 2KKWA 3SPIA 4LP8A 3SYOA 1FXHA 3ZN1A 2ZNIA 4I4TA 4GX1A 3K5LA 4ZOLA 1H2LA 1YI2V 3VBBA 1S0VA 3OT7A 1SETA 4MVUA 4PA3A 1XMQB 4DR7B 2BSKB 3TGUH 2KB1A 4LF8O 3HKEB 1HNXO 4J7JA 1OCZC 4P2ZA 5LHHA 5BXZA 4DV4B 1XNRO 2F4VB 3S3WA 1Y4MA 3CRQA 4DV3B 2IU3A 3DTUB 3FYIB 4JAAA 3K0GA 3OGIB 4E2LA 5KA5A 1K34A 4BIOA 1NT2B 2X7RB 3E8FA 1S5LZ 1TUBA 2EJRA 5JJNB 2LQTA 2ZE8A 4LFCO 5KAFZ 4LFBB 1KUQA 4K8XA 3OR6C 2WLIA 3H1IH 3SJCC 2ITDC 4DR3B 1DF4A 1AI6A 1XL4A 3C90A 1COWG 1R3JC 1ZAUA 2EINC 3B4SA 5LA6A 2P5OA 3ZIAG 3P30A 2WLLA 3N2KA 1K4DC 4B3RB 3D36C 3B77A 4QGPA 2E5LO 1S5JA 2PI5A 4GCZA 2AZ2A 3KG2A 1Q43A 2Q4PA 4MW3A 2QTOA 4JZ2A 2K9PA 3L71H 2G38A 4XDLA 3N2GA 3UO2A 2B1IA 5KX5A 4O2AB 4I7ZB 4DXWA 3CRCA 4PDMA 2QEXV 4JI6B 3NR7A 4X1IB 3RN4A 2FMLA 2EILC 4FIPC 4D7TA 4DR5B 1VQLV 1Q3EA 4LF5O 2LGQA 4PD4F 5L3BA 2NN4A 1ZWIC 1JFFB 5CMUA 2LP7A 2X6CA 2X0LA 1FXKC 5LL6Y 1B04A 1E79G 4PDRA 1SRYA 5BR8B 1D2DA 3FD9A 1WP8A 1NKDA 1E1QG 3ZJZA 2ZM6B 1KP2A 3ZBHA 4UVAA 1GM7A 3UKMA 4L87A 3KKYA 4EB6A 4N21A 3OGCC 2QE7G 1UJWB 3CCQV 4MTFA 3CCLV 1D5AA 1N36O 3BA9A 3ZX6A 1URFA 5H6RA 2YDEA 4GZRB 4L8JA 5EIBD 1CPYA 4NXNB 3OD4A 2UXCB 5LGTA 4EFEA 2HG5C 2AHYA 5B66Z 2JK5C 2JGUA 4IL6Z 4YIOA 3CPWU 2IH1C 2QJ1A 3SJQC 1YHQV 4JTDB 1XBLA 4DUYB 4AHCA 4JAUA 5CA0A 2Y69B 4X66B 3B8NA 2ZDIC 2QWOB 3QO7A 4LWSB 1YTFB 1N8RW 3W7UA 4H37A 4FFBA 5C8YB 1XMOB 3TJTA 5B5EZ 3FX7A 3HKDA 1AI5A 3OM3B 3PN1A 4UCOA 2HEPA 2N74A 4F6EA 3OW2U 4J42A 1AI7A 3OUFA 2MW2B 1SQPH 5LHIA 1X4TA 1M56B 4YIPA 4JYCA 1RPRA 3FB5C 1Q5OA 5ITZA 1QR8A 1WP7A 2XAGA 4HYOA 3K06A 1P4RA 1N4CA 2Q9LA 2QWRB 4DR1O 3ABLC 1VF7A 4UCSA 1SA0A 4FJCC 3QO8A 3BVOA 3CJHB 2W6JG 4O4JB 5LGUA 2KG7B 4MTGA 3ZHUA 2JRIA 4X62O 2YXYA 2LFRA 4B3TB 2R70A 4NTXA 3K03A 1VP7A 4N23A 4F6RA 3Q4HB 3N2KB 1S3JA 4JYAO 1S76D 5B3SB 4JI3B 1HW7A 2EIJB 4TWKA 3DXRB 1I08A 2IJJA 1XI1A 2HHHO 1NBMG 1WN7A 1WA8B 1R6KA 2EBOA 1M5IA 4XDJA 4PA6A 1JCHA 2HLDG 3QG5A 3RT3C 3X2QB 1QLEB 1YVWA 4O4HA 3QVNA 1XILA 4QPJA 2EIJC 4UFZA 5LXTA 3JAKB 5E79Z 1V55B 4QPKA 2CTRA 4LBEC 2WLKA 3S3XA 3BAAA 2ODMA 1QVFU 3T4DA 1YJ9V 4FLXA 1GRJA 1K92A 5BZBA 3RYFA 5IT9N 1ZTEA 2HHHB 1US6A 3GVMA 1RSOB 3IC9A 1YTFD 4LF8B 1BHBA 3ZRWA 1VARA 2EX3A 1UFIA 4YY3O 2UU9B 2AXTZ 4G27B 3D8CA 1PNMA 1XNQO 2JJ1G 1TUBB 4JPRA 1PD3A 5EC1C 5L3GA 4J7KA 2QKSA 4EKWA 4ZBMA 3LSQA 2JJ2G 3K59A 4JI8O 1AB3A 5FNVB 3A8TA 1YF2A 3SPGA 3AK2A 4MVZA 4RQEA 1BSMA 2WLMA 3OUSA 4WF9V 4UCRA 2UXBO 2GBOA 3RW0A 3MD0A 3ML0A 1ZL8B 4JV5O 1IBMO 1IX9A 3G80A 3VOUA 1AP6A 4YHHO 4H13B 4K35A 3TXSA 2ILMA 3VQVA 3SPCA 1GN6A 4I9WA 1L1FA 4O4IB 3ZS8C 4DV5B 3A0HZ 3WB1A 4X88A 3CCUV 1AILA 5B1NA 2BCCH 1IBLB 4O4IA 2QDOA 5JJJB 1K4CC 4DUYO 3R66A 3ASNB 4NTYA 3IFXA 4CH3A 3JAKA 3EXAA 4EEQA 5EZYA 4JTAB 1XREA 2P67A 4JI3O 2ZIOA 2ZR3A 1VQ7V 2QR4A 1PPJH 1XMQO 4MW8A 2GV9A 1XHZA 1M57B 5ITZB 3ZHVA 1JMKC 4WBNB 2R9RB 4KXRA 5IWAO 3HKBB 1CP9A 1B06A 3STZC 4JI5B 2DMXA 4DUZO 1IBLO 4G2KA 5LMUO 3JSLA 5IWAB 4GUNA 3M8AA 4BWAA 1H2NA 5BR8O 3N27A 3SPJA 4JI2B 5K1PA 1IBKO 1L0NH 2W6IG 2ZT9B 3K5NA 4AQYB 3GWKC 1OV9A 1J5EB 2N05A 3U0ZA 4X1KA 1Y67A 3ABMB 5JVDA 1DGSA 2QM8A 4JI1B 2GHYA 4P9PA 1XMOO 3ASNC 2RMKB 3KCXA 5GW7A 4X1YA 2A3QA 2PF4E 2Q69A 1NTKH 5DN6G 2EIMC 4BW5A 3A0RA 1QU7A 3A0BZ 1XDCA 3UQ8A 4U3JA 5B3SC 3LNNA 4HNAA 3AG7A 3L74H 5IYBO 3JD3A 1JJ2U 1EZVH 1I94O 2BOCC 4JI4O 3OE7G 4YHHB 1EM1A 3B09A 3CCVV 5IDJA 4RUEA 4DV2O 5LP6A 2OTJV 1BCCH 4U3JB 4UXNA 4CS3A 2VRZA 3SYAA 5F2VO 1PV0A 2AZ0A 4AILC 3FAVB 5LP6C 4J7ZA 3E35A 4PI0A 4MS2A 2ZDIA 4X1KB 3D3QA 4U7NA 1GM9A 3RYIA 4TSFG 1K7DA 3CE2A 3BRCA 2A7WA 1KBHA 2PYJA 3ZHSA 4BIUA 2VWJA 1PM9A 3CJHA 5B1BC 2ZM6O 4UV9A 1J95A 3JATB 3L72H 1SA0B 1WPXA 1CXZB 2EIKB 3NXSA 1UPGA 2EIMB 2P06A 1P84F 2WSSG 5KHKA 5LMUB 1F23A 3E89A 2FKXA 3WFVA 1GTOA 2RNBA 1V54C 3SPHA 3QF7A 2LO1A 2QA4V 2DWDC 5B1OA 3BHPA 2XHBA 1BL8A 2IH3C 3FYEB 2DYSC 4KUMA 4CC5A 1ROPA 3JALB 2HJFC 5KHIA 3TCUA 3HKBA 3BPZA 3G71V 3CC7V 1WB7A 3JD4A 5CA3A 4PHZA 1OCCB 1FJGB 3JD1A 1JA8A 1VQPV 3WU2Z 4R50A 3SR2C 3L75H 2HR3A 5KHHA 2DQ0A 4DRXB 2UUCO 4DV6O 3ETGA 1R3LC 3CXCU 4NYKA 3K57A 3F5TA 4O2AA 2ADQB 2XAFA 5LYJA 2CTWA 5LGNA 1NS1A 4NR1A 1NZ6A 2RJZA 2OWOA 1OCRB 4DV0B 5EK0A 4ZI7A 1NVPB 1KQSU 4BIZA 5FPOA 1Y76B 4TUYA 4DV7O 5JCOC 5HFLA 3UT5A 1W0KG 1QBZA 3RYCB 5IJ0B 3WB2A 1DF5A 2M7WA 4RAIA 4DR6B 4X62B 3U11A 5CB4A 4PDVA 2E5LB 2WLIB 4PI2A 4IIJA 2VS0A 4DR1B 5FL7G 3AG2C 1HR0O 5FNVA 4DR3O 4OPAA 2ATKC 2Z5UA 2A06H 3KCYA 1RSOA 4FM2A 4LF4O 4JYYA 3JCUZ 3GB7C 2DW4A 2ZE5A 1QNMA 4I55B 5EBWC 5LMNO 3APOA 3P3PA 1EBOA 2QWQB 1YIJV 4WFEA 3ZCCA 2AHZA 1H2KA 2WLNA 1V9PA 3OAAG 3IGAC 2VQEO 4D7SA 1RFYA 4WFHA 1U97A 1VIBA 3G6EV 4UVBA 1H2GA 4Z1MG 1Q6IA 1OHHG 1N36B 4DV1B 2XTAA 4JI7B 4LNUB 1VQ9V 4KFMA 5H9CA 4JGSA 4CS4A 3J80N 4Z2WA 5IJ9B 1W59A 2YUAA 4W4KA 1P7BA 4FLWA 2QM7A 3STLC 4GKKB 3MHSC 3R65A 3IJ4A 3QO5A 4JI0B 2R9AA 2CUGA 1Y6XA 2CGNA 4LH6A 2EINB 3VQWA 1PNKA 5GTHZ 5CA1B 1R3IC 3I5DA 5EBLC 4LFAO 1O9GA 1KU9A 2QGNA 3AK1A 3ZMUA 4ZHQB 3Q4HA 5BMVA 2Q6AA 5J2UB 3I56V 1PL4A 1G4YB 1H38A 4JTCB 2M6YA 3HKEA 2QSAA 1WA8A 3K08A 2P7TC 3DC6A 2HVKC 4UB8Z 2BTQB 2V7QG 3CYOA 4GYCB 1VF6C 4NB5A 3JATA 4B08A 2L35A 4JI5O 3H1LH 4LF9B 2Q5ZA 1I94B 2RQ6A 2ZR2A 3HKCB 2DQ3A 3UCSC 5D5PA 1MABG 1AJNA 1QQCA 5IY5C 3E8HA 2OIGA 2AGAA 4JZGA 3CXHF 5CB4B 4J9YB 2QWNB 2Q7HA 1ZX3A 4GX0A 5GONB 3G67A 2WPDG 3MHHC 2WAMA 2YS8A 4B3TO 1J5EO 1BQZA 5IYDO 1Z2GA 4LWSA 1H2SB 4IGGA 3RYHB 4YJ3B 4JI4B 1Z5VA 4TOIA 4H0LB 1SQFA 1Q8IA 5LYJB 1NR7A 2ZCEA 2XUMA 1OCOC 4Z1VA 2P22C 2GTSA 4X65O 4DYLA 4X20B 2OCCC 1AJQA 2E76B 1QCEA 4ZIBA 1M4UA 4EB6B 1KYOF 2ZE7A 2PZSA 3E86A 4X9QA 3LDCA 2OTLV 1FXKB 1AR1B 1KP3A 3ETEA 4BAYA 2UXBB 2AW9A 5JVDB 3W7XA 5KUMA 2JS5A 1KB9F 2YC0A 3FKSG 3CRMA 3W7SA 3IC7A 5K1XA 2WA4A 5LOVA 3SJBC 2JIZG 5CN0A 2OCCB 3T1HB 2UUAB 1F7YA 5FPRA 4DUZB 1NU1H 5A2QN 5LOVB 4LF9O 1HDJA 2UXXA 2CTPA 4X65B 5A9GA 1N33O 1N0JA 2E75B 2YIBA 1L0LH 1TUEB 4PDLA 1Y74B 3THOA 3T4ZA 4NVPA 2Y4UA 2XAJA 2P6JA 3ETQA 5KUKA 3E2EA 4PA7A 1QLEC 3ASOB 1G6UA 3ABLB 3HB3B 4BW9A 3E8BA 3L73H 4TV9B 4QJFB 5KX5B 2UUBO 3DGEA 3N2GB 1TVKB 5L3DA 3OFNG 2WLJA 4FFBB 2Y69C 3JAWB 4JYAB 1Q90D 3H01A 3CCSV 2IM9A 2JS3A 3T1YB 2CK3G 1PL0A 1SQGA 4DR4B 1ZSPA 3J81N 2ADPA 4B3MB 3E8GA 2B5UA 4X8AA 4D6TH 1VQ6V 2Z0AA 1HNZO 1JPXA 2GSMB 3CS5A 2QKAA 3ZMSA 3CD6V 2NNUA 2VWKA 4LF4B 3OR7C 1GAXA 2ZXWB 1HNWO 1N32O 1XNQB 1MZFA 4MVQA 5B1BB 4YXWG 2Y4TA 2V1DA 3HKCA 4FZ0A 4XDKA 3EVKA 3OTOO 4NKGB 4IYIA 1GKFA 3CCJV 3L70H 2YEVA 2EULA 3JSNA 5J2TB 3H1HH 2BSKA 1OCZB 1SQVH 2OYQA 2ITCC 1WLEA 4WFAV 3AG4B 3EHBB 2N04A 1HNZB 1FS0G 3ASOC 1WPBA 1Z5WA 4UCUA 1DLBA 3BEHA 4O4LA 1HR0B 2H8PC 4LH7A 2GDSA 5EBMC 3CB2A 4YJ2A 4KHPB 3AK3A 2DYRB 4PV1B 5E1AC 1SESA 1N33B 1Q81W 1WNSA 5KLVH 2FL4A 4GX5A 3ZRWB 4A5UB 1G1XB 5KHJA 3E22B 3PJSK 4LFAB 3BY6A 2F43G 3K9AA 1U96A 4R8CA 3JAMN 4E4EA 3AG1B 3RYFB 5IJ0A 2Y0PA 2BTQA 2BE3A 2EZPA 3K3WA 4R7CA 2CDYA 3CCEV 4JASA 5EZYB 3P3NA 1PNLA 1LR1A 5JQGA 1EFRG 4DR7O 4UCVA 2LGWA 3K04A 1SKVA 3ZMTA 4FLYA 3ZHTA 1D5NA 3CCRV 3SJAC 2E3CA 2F93B 5KHGA 4P9OA 1F51A 2H94A 4UUJC 1NVPD 1IXMA 2IJHA 5LA6B 5EYPB 4KHPO 5KAIZ 1VQOV 3AG3C 2Q8VA 5CA1A 2PI4A 4CH4A 1I5YA 1SERA 2ETNA 4J80A 2HFEC 2CGOA 4UB6Z 2IJKA 4LC1A 1GH6A 4GLXA 4FK5C 3B8MA 2Q0OC 3AG2B 2HKOA 3WB0A 3L9DA 4LF7O 4G28B 1DK1A 3ABUA 4GKJB 2EJ7A 4F6RB 1HNWB 3RFRA 1HWYA 1EN6A 2FYUH 1N34B 4OPHA 3I55V 4B3RO 2W0FC 3G6BA 5KMGA 4NTWA 5L3FA 2CAZC 5CBFA 5JJEB 1SZTA 4UVCA 4I55A 3T1YO 2BTOA 1MZEA 2Q67A 1ENVA 4ZOLB 3RVZA 2VQFO 3K0DA 4LFBO 1Q7YW 1XQ8A 1KC8W 1FKAO 4MVOA 1OJHA 4U7OA 1MMMA 3ZMVA 1GMGA 4TUYB 2JVDA 2F23A 3OMAB 1NI8A 4GKJO 3T1CA 1K97A 4YJ2B 2RCVA 3HPLC 3CCMV 4GX2A 1BMFG 4J11A 3MAQA 4F4LA 2GUZB 3HKDB 1S72V 3SYQA 4LFCB 4OX9B 2Q0AA 3ZHRA 1FXKA 4GT1A 2GTAA 3CRAA 4I50B 4DV3O 2OIEA 5TISZ 2UUBB 1N32B 2H3OA 3A2FA 3TK1A 1NTMH 4DK0A 1RM1B 1V54B 2DE0X 3ABKB 3JARB 4I0XA 5LXTB 4X20A 2YIBD 1I5XA 1KECA 1NH2B 3JALA 4LR3A 4O2BB 1YITV 2WLHA 3O9OA 3FB8C 4RO2A 4OGQB 3O65A 1I0HA 1T5EA 4YJ3A 1MOFA 3JASB 2HJDA 1K8AW 3RYHA 4PJ0Z 3CSXA 4MVRA 2ZIMA 3C3TA 2XAHA 2DJVA 4CH6A 3DXRA 1BQ0A 2Z3YA 1FFTB 5GONA 3K58A 2XNDG 1VQ5V 3FFQA 4PA4A 1IBKB 4MT8A 2PTMA 1G8MA 3ZHQA 5JH7A 2PUSA 1BHAA 3JAWA 2FTKA 1F4MA 1ZLZA 1BS3A 1FXVA 2QTSA 3ZEDA 2YSUB 1R6NA 2WWWA 3U10A 5C93A 1JOYA 2A9HA 1LUVA 2F66C 2YICA 1IBMB 2RDCA 2BOBC 4WFBV 3RWRD 2IW5A 1NJIW 2HVJC 2P4VA 1FFXB 3M99B 3RYIB 4YY3B 4J41A 4NXMB 1AP5A 4DK1A 2Y48A 5J9PC 1Y74A 2B9ZA 4ZHQA 5HFMA 1YDXA 3CC4V 1PKXA 1E1RG 1MG1A 1JQ0A 5H2FZ 4CS2A 1AVMA 4PELA 1Q6UA 2ZKOA 4DR6O 4ZKIA 4HNAB 1OCRC 4JI8B 1S5HC 5JH7B 3CMAV 3HR0A 4FLVA 1M9NA 2YI8A 5LP6B 2WLLB 1VQMV 2CE4A 4DO2A 4WCEV 3CMEV 4FZ1A 5IJ9A 3SDLA 1SS3A 5LHGA 2K1EA 4FLUA 2ARHA 3FAVA 2L6LA 4TQFA 1KMIZ 3ZRSA 5IYZB 1TGOA 1NH2D 3K5MA 1GN2A 2ZINA 4B7KA 3BABA 5B1AB 3RBZA 4I5SA 3W7TA 4OX9O 4DR2B 1SQXH 1M57C 4LF7B 4QE9A 2D2CB 1IXBA 5DEDA 4GKKO 4EFBA 1N0NA 5EC2C 1YEWA 1XHXA 3ABTA 2ZE6A 5LBQA 1JVMA 4QE7A 5LMNB 4X1YB 3JCZA 4X66O 1THZA 4K0KO 4HZ3A 4TQDA 5B1AC 1Q82W 3LDEA 4WFFA 2X6BA 4X89A 1W2BU 2UXDB 3W7WA 2UUAO 5GTIZ 1M93A 1MSDA 4JYBA 1JFFA 4DR2O 3AEIA 1KKCA 2VQEB 1RP3B 4RUFA 2IJIA 4JV5B 2QWPB 3SGIA 4FMTA 4TV8B 4LCUC 3RYCA 4FFKA 1PP9H 2IBZH 3OEHG 1KKDA 4WBNA 3OTOB 3IAYA 3EFFK 4ZI7B 1B6QA 2DN9A 2ZQMA 1YZBA 5J2UA 4O4HB 3VQXA 5BMVB 1VMGA 4Q6GA 4QIWF 5EIBC 3G4SV 3D3IA 4DW1A 2PY5A 4O2BA 1WAZA 2JGDB 5CBHA 4ABMA 3QTCA 5L3EA 1IURA 5AG2A 4UCTA 1FJGO 1NR1A 4DR4O 4DR5O 1BE3H 1GK9A 3TETA 1JR9A 1JJOA 4MVMA 3F5WC 1K9MW 5EYPA 4IT5A 2W0XA 4TT3G 1SZXA 1LNQA 4FM0A 1O9HA 1KD1W 4TV8A 1NQTA 2PGGA 2F1MA 1OCCC 1VQ8V 1ZUQA 1IDSA 3OMIB 3RGBA 1AJPA 2IU0A 3J7AU 1S77D 1WB8A 2MK3A 4ICGA 3X2QC 3B40A
chains in the Genus database with same CATH topology
1Y74A 1VF6C 1Y76B 1Y76A 1ZL8A 1Y74B 1RSOB 1ZL8B 1VF6A 3B40A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y74 A;  1VF6 C;  1Y76 B;  1Y76 A;  1ZL8 A;  1Y74 B;  1RSO B;  1ZL8 B;  1VF6 A;  3B40 A; 
#chains in the Genus database with same CATH topology
 1YXB A;  4O4J A;  3OMN B;  4AQY O;  1BGY H;  2QKC A;  4DV6 B;  2YEV B;  3FB7 C;  4FLT A;  2KQX A;  4FPP A;  4B3M O;  3RVY A;  1GN3 A;  4PA9 A;  1ORQ C;  1GM8 A;  3P32 A;  2JEU A;  3F7Y C;  1XOU A;  4NXN O;  3H1K H;  1SF9 A;  4B7E A;  2DOS A;  4CZZ A;  1Y76 A;  3KZI Z;  5KA6 A;  1M90 W;  4LF5 B;  3ABM C;  4K0K B;  4O4L B;  3K9S A;  1OZ0 A;  1TAE A;  3LNM B;  2R72 A;  1Y66 A;  5BY1 A;  4Q20 A;  4JI0 O;  3UO3 A;  3MDS A;  1R1B A;  2EIK C;  4DRX A;  4DV7 B;  4IHJ B;  2DYS B;  4IIJ B;  5J2T A;  4CBC A;  3BA8 A;  2PYL A;  2JEX A;  3K79 A;  1VQ4 V;  5DM6 V;  5CA0 B;  3OTF A;  3FB6 C;  1FYJ A;  1YCI A;  1XEQ A;  5JCO A;  4J10 A;  5IYC O;  2A0L A;  1AR5 A;  3JD2 A;  3UT5 B;  2YXH A;  3SYC A;  3LUT B;  1VQK V;  4IYH A;  3JYC A;  5IYZ A;  4KP4 A;  4DV5 O;  1R3K C;  1W0J G;  2UXC O;  1VF6 A;  2R9I A;  5DEC A;  3ZN0 A;  4U3F H;  1N34 O;  5JWP A;  4X64 B;  2D3O W;  1FD9 A;  4XBF A;  5L3C A;  3TXQ A;  3ABK C;  2C2A A;  3CC2 V;  4MSW C;  2XAS A;  3LSS A;  3M7M X;  2FB5 A;  3VQY A;  1FPO A;  3K5O A;  1BT8 A;  2DWE C;  5H5N A;  2LW1 A;  1XL6 A;  4JI2 O;  3AG3 B;  1YJW V;  4HBN A;  2VQF B;  3OEE G;  2KG7 A;  2XT9 A;  4RWU A;  3JD0 A;  1TVK A;  5FLX N;  5H6Q A;  4UV8 A;  2ZNJ A;  1YSC A;  1NTZ H;  4MTX A;  4I9Q A;  4JF3 A;  3CP1 A;  3CX5 F;  4H33 A;  2LW7 A;  3CWB H;  1TA8 A;  1GN4 A;  3ZMZ A;  1R73 A;  3E83 A;  2V4D A;  1H2M A;  1EN5 A;  1HP8 A;  4H44 B;  2CH7 A;  3H1J H;  1FFX A;  2Y0I A;  4DV4 O;  3T1H O;  3JAS A;  2YIA A;  1K33 A;  3AG4 C;  4C7U A;  2Q7G A;  2ZD9 A;  1VF5 B;  1YJN V;  2RN9 A;  3H9V A;  4JI6 O;  2ZXW C;  4K8Z A;  3BFR A;  4RQF A;  5CBG A;  1AI4 A;  3ZRV A;  4R6Z A;  1XUQ A;  4WFG A;  4NXM O;  4DV0 O;  3SYP A;  3ICX A;  1Q86 W;  2UXN A;  2KSD A;  2X6A A;  4JAV A;  3ETD A;  1RPO A;  2HP8 A;  1QLN A;  2QM4 A;  4DW0 A;  2E74 B;  4B3S O;  3QNE A;  4W4L A;  5C8Y A;  1L8D A;  1LUW A;  1K73 W;  4CH5 A;  1B3Q A;  3LDD A;  1P7G A;  4B3S B;  1A32 A;  2A79 B;  5D5Q A;  1SQQ H;  3LSU A;  1F4N A;  1EN4 A;  4JI1 O;  2YI9 A;  1XNR B;  2F4V O;  1H8E G;  2WA3 A;  3DC5 A;  2JDI G;  4TV9 A;  3JAR A;  2O57 A;  4I0X B;  1OCO B;  2Q68 A;  2NLJ C;  5KMG B;  2CH7 B;  3C3S A;  2EZO A;  4LF6 O;  4HAM A;  3CRR A;  1MNG A;  4DV2 B;  4I4T B;  5IE9 A;  4P30 A;  1RM1 C;  1MSW D;  2GUZ A;  1FAF A;  3UM7 A;  4FM1 A;  4LF6 B;  2CTQ A;  1CEZ A;  1JX9 A;  1VQN V;  3BCC H;  3APQ A;  2Q73 A;  3CEI A;  2UU9 O;  1AR4 A;  3WG7 B;  4DV1 O;  4BR6 A;  1X59 A;  2P90 A;  2LJ2 A;  3D36 A;  1VEW A;  4QNH B;  4J9Z B;  2DYR C;  1P49 A;  1V55 C;  1IVS A;  4KL1 A;  1SC5 B;  1H8H G;  1GO3 F;  4CC6 A;  2P4K A;  2LFS A;  4LNU A;  2Q7E A;  5JQG B;  2XOK G;  4X64 O;  1BZK A;  1MA1 A;  1IZ3 A;  3AG1 C;  1M1K W;  4X1I A;  1ZL8 A;  2JGD A;  3F7V C;  2UXD O;  3WG7 C;  2EIL B;  1I7F A;  1SQB H;  4FLZ A;  1K5S A;  3T2M A;  1QVG U;  1WJZ A;  4JI7 O;  1EZJ A;  4IHJ A;  4I50 A;  2UUC B;  1R6T A;  1DTO A;  2F95 B;  4MVS A;  1K5Q A;  4FVM A;  1HNX B;  4MTO A;  1M56 C;  2YID A;  2OT5 A;  2B1G A;  5IY5 B;  2YXL A;  3B2E E;  1QR9 A;  4AI8 A;  1QHT A;  3E22 A;  1Q6H A;  4OXS A;  3CHX A;  4K3A A;  3ZRX A;  1K3E A;  3GWO A;  3DSQ A;  4ASU G;  1ARO P;  2NR5 A;  2OCH A;  2XAQ A;  2KKW A;  3SPI A;  4LP8 A;  3SYO A;  1FXH A;  3ZN1 A;  2ZNI A;  4I4T A;  4GX1 A;  3K5L A;  4ZOL A;  1H2L A;  1YI2 V;  3VBB A;  1S0V A;  3OT7 A;  1SET A;  4MVU A;  4PA3 A;  1XMQ B;  4DR7 B;  2BSK B;  3TGU H;  2KB1 A;  4LF8 O;  3HKE B;  1HNX O;  4J7J A;  1OCZ C;  4P2Z A;  5LHH A;  5BXZ A;  4DV4 B;  1XNR O;  2F4V B;  3S3W A;  1Y4M A;  3CRQ A;  4DV3 B;  2IU3 A;  3DTU B;  3FYI B;  4JAA A;  3K0G A;  3OGI B;  4E2L A;  5KA5 A;  1K34 A;  4BIO A;  1NT2 B;  2X7R B;  3E8F A;  1S5L Z;  1TUB A;  2EJR A;  5JJN B;  2LQT A;  2ZE8 A;  4LFC O;  5KAF Z;  4LFB B;  1KUQ A;  4K8X A;  3OR6 C;  2WLI A;  3H1I H;  3SJC C;  2ITD C;  4DR3 B;  1DF4 A;  1AI6 A;  1XL4 A;  3C90 A;  1COW G;  1R3J C;  1ZAU A;  2EIN C;  3B4S A;  5LA6 A;  2P5O A;  3ZIA G;  3P30 A;  2WLL A;  3N2K A;  1K4D C;  4B3R B;  3D36 C;  3B77 A;  4QGP A;  2E5L O;  1S5J A;  2PI5 A;  4GCZ A;  2AZ2 A;  3KG2 A;  1Q43 A;  2Q4P A;  4MW3 A;  2QTO A;  4JZ2 A;  2K9P A;  3L71 H;  2G38 A;  4XDL A;  3N2G A;  3UO2 A;  2B1I A;  5KX5 A;  4O2A B;  4I7Z B;  4DXW A;  3CRC A;  4PDM A;  2QEX V;  4JI6 B;  3NR7 A;  4X1I B;  3RN4 A;  2FML A;  2EIL C;  4FIP C;  4D7T A;  4DR5 B;  1VQL V;  1Q3E A;  4LF5 O;  2LGQ A;  4PD4 F;  5L3B A;  2NN4 A;  1ZWI C;  1JFF B;  5CMU A;  2LP7 A;  2X6C A;  2X0L A;  1FXK C;  5LL6 Y;  1B04 A;  1E79 G;  4PDR A;  1SRY A;  5BR8 B;  1D2D A;  3FD9 A;  1WP8 A;  1NKD A;  1E1Q G;  3ZJZ A;  2ZM6 B;  1KP2 A;  3ZBH A;  4UVA A;  1GM7 A;  3UKM A;  4L87 A;  3KKY A;  4EB6 A;  4N21 A;  3OGC C;  2QE7 G;  1UJW B;  3CCQ V;  4MTF A;  3CCL V;  1D5A A;  1N36 O;  3BA9 A;  3ZX6 A;  1URF A;  5H6R A;  2YDE A;  4GZR B;  4L8J A;  5EIB D;  1CPY A;  4NXN B;  3OD4 A;  2UXC B;  5LGT A;  4EFE A;  2HG5 C;  2AHY A;  5B66 Z;  2JK5 C;  2JGU A;  4IL6 Z;  4YIO A;  3CPW U;  2IH1 C;  2QJ1 A;  3SJQ C;  1YHQ V;  4JTD B;  1XBL A;  4DUY B;  4AHC A;  4JAU A;  5CA0 A;  2Y69 B;  4X66 B;  3B8N A;  2ZDI C;  2QWO B;  3QO7 A;  4LWS B;  1YTF B;  1N8R W;  3W7U A;  4H37 A;  4FFB A;  5C8Y B;  1XMO B;  3TJT A;  5B5E Z;  3FX7 A;  3HKD A;  1AI5 A;  3OM3 B;  3PN1 A;  4UCO A;  2HEP A;  2N74 A;  4F6E A;  3OW2 U;  4J42 A;  1AI7 A;  3OUF A;  2MW2 B;  1SQP H;  5LHI A;  1X4T A;  1M56 B;  4YIP A;  4JYC A;  1RPR A;  3FB5 C;  1Q5O A;  5ITZ A;  1QR8 A;  1WP7 A;  2XAG A;  4HYO A;  3K06 A;  1P4R A;  1N4C A;  2Q9L A;  2QWR B;  4DR1 O;  3ABL C;  1VF7 A;  4UCS A;  1SA0 A;  4FJC C;  3QO8 A;  3BVO A;  3CJH B;  2W6J G;  4O4J B;  5LGU A;  2KG7 B;  4MTG A;  3ZHU A;  2JRI A;  4X62 O;  2YXY A;  2LFR A;  4B3T B;  2R70 A;  4NTX A;  3K03 A;  1VP7 A;  4N23 A;  4F6R A;  3Q4H B;  3N2K B;  1S3J A;  4JYA O;  1S76 D;  5B3S B;  4JI3 B;  1HW7 A;  2EIJ B;  4TWK A;  3DXR B;  1I08 A;  2IJJ A;  1XI1 A;  2HHH O;  1NBM G;  1WN7 A;  1WA8 B;  1R6K A;  2EBO A;  1M5I A;  4XDJ A;  4PA6 A;  1JCH A;  2HLD G;  3QG5 A;  3RT3 C;  3X2Q B;  1QLE B;  1YVW A;  4O4H A;  3QVN A;  1XIL A;  4QPJ A;  2EIJ C;  4UFZ A;  5LXT A;  3JAK B;  5E79 Z;  1V55 B;  4QPK A;  2CTR A;  4LBE C;  2WLK A;  3S3X A;  3BAA A;  2ODM A;  1QVF U;  3T4D A;  1YJ9 V;  4FLX A;  1GRJ A;  1K92 A;  5BZB A;  3RYF A;  5IT9 N;  1ZTE A;  2HHH B;  1US6 A;  3GVM A;  1RSO B;  3IC9 A;  1YTF D;  4LF8 B;  1BHB A;  3ZRW A;  1VAR A;  2EX3 A;  1UFI A;  4YY3 O;  2UU9 B;  2AXT Z;  4G27 B;  3D8C A;  1PNM A;  1XNQ O;  2JJ1 G;  1TUB B;  4JPR A;  1PD3 A;  5EC1 C;  5L3G A;  4J7K A;  2QKS A;  4EKW A;  4ZBM A;  3LSQ A;  2JJ2 G;  3K59 A;  4JI8 O;  1AB3 A;  5FNV B;  3A8T A;  1YF2 A;  3SPG A;  3AK2 A;  4MVZ A;  4RQE A;  1BSM A;  2WLM A;  3OUS A;  4WF9 V;  4UCR A;  2UXB O;  2GBO A;  3RW0 A;  3MD0 A;  3ML0 A;  1ZL8 B;  4JV5 O;  1IBM O;  1IX9 A;  3G80 A;  3VOU A;  1AP6 A;  4YHH O;  4H13 B;  4K35 A;  3TXS A;  2ILM A;  3VQV A;  3SPC A;  1GN6 A;  4I9W A;  1L1F A;  4O4I B;  3ZS8 C;  4DV5 B;  3A0H Z;  3WB1 A;  4X88 A;  3CCU V;  1AIL A;  5B1N A;  2BCC H;  1IBL B;  4O4I A;  2QDO A;  5JJJ B;  1K4C C;  4DUY O;  3R66 A;  3ASN B;  4NTY A;  3IFX A;  4CH3 A;  3JAK A;  3EXA A;  4EEQ A;  5EZY A;  4JTA B;  1XRE A;  2P67 A;  4JI3 O;  2ZIO A;  2ZR3 A;  1VQ7 V;  2QR4 A;  1PPJ H;  1XMQ O;  4MW8 A;  2GV9 A;  1XHZ A;  1M57 B;  5ITZ B;  3ZHV A;  1JMK C;  4WBN B;  2R9R B;  4KXR A;  5IWA O;  3HKB B;  1CP9 A;  1B06 A;  3STZ C;  4JI5 B;  2DMX A;  4DUZ O;  1IBL O;  4G2K A;  5LMU O;  3JSL A;  5IWA B;  4GUN A;  3M8A A;  4BWA A;  1H2N A;  5BR8 O;  3N27 A;  3SPJ A;  4JI2 B;  5K1P A;  1IBK O;  1L0N H;  2W6I G;  2ZT9 B;  3K5N A;  4AQY B;  3GWK C;  1OV9 A;  1J5E B;  2N05 A;  3U0Z A;  4X1K A;  1Y67 A;  3ABM B;  5JVD A;  1DGS A;  2QM8 A;  4JI1 B;  2GHY A;  4P9P A;  1XMO O;  3ASN C;  2RMK B;  3KCX A;  5GW7 A;  4X1Y A;  2A3Q A;  2PF4 E;  2Q69 A;  1NTK H;  5DN6 G;  2EIM C;  4BW5 A;  3A0R A;  1QU7 A;  3A0B Z;  1XDC A;  3UQ8 A;  4U3J A;  5B3S C;  3LNN A;  4HNA A;  3AG7 A;  3L74 H;  5IYB O;  3JD3 A;  1JJ2 U;  1EZV H;  1I94 O;  2BOC C;  4JI4 O;  3OE7 G;  4YHH B;  1EM1 A;  3B09 A;  3CCV V;  5IDJ A;  4RUE A;  4DV2 O;  5LP6 A;  2OTJ V;  1BCC H;  4U3J B;  4UXN A;  4CS3 A;  2VRZ A;  3SYA A;  5F2V O;  1PV0 A;  2AZ0 A;  4AIL C;  3FAV B;  5LP6 C;  4J7Z A;  3E35 A;  4PI0 A;  4MS2 A;  2ZDI A;  4X1K B;  3D3Q A;  4U7N A;  1GM9 A;  3RYI A;  4TSF G;  1K7D A;  3CE2 A;  3BRC A;  2A7W A;  1KBH A;  2PYJ A;  3ZHS A;  4BIU A;  2VWJ A;  1PM9 A;  3CJH A;  5B1B C;  2ZM6 O;  4UV9 A;  1J95 A;  3JAT B;  3L72 H;  1SA0 B;  1WPX A;  1CXZ B;  2EIK B;  3NXS A;  1UPG A;  2EIM B;  2P06 A;  1P84 F;  2WSS G;  5KHK A;  5LMU B;  1F23 A;  3E89 A;  2FKX A;  3WFV A;  1GTO A;  2RNB A;  1V54 C;  3SPH A;  3QF7 A;  2LO1 A;  2QA4 V;  2DWD C;  5B1O A;  3BHP A;  2XHB A;  1BL8 A;  2IH3 C;  3FYE B;  2DYS C;  4KUM A;  4CC5 A;  1ROP A;  3JAL B;  2HJF C;  5KHI A;  3TCU A;  3HKB A;  3BPZ A;  3G71 V;  3CC7 V;  1WB7 A;  3JD4 A;  5CA3 A;  4PHZ A;  1OCC B;  1FJG B;  3JD1 A;  1JA8 A;  1VQP V;  3WU2 Z;  4R50 A;  3SR2 C;  3L75 H;  2HR3 A;  5KHH A;  2DQ0 A;  4DRX B;  2UUC O;  4DV6 O;  3ETG A;  1R3L C;  3CXC U;  4NYK A;  3K57 A;  3F5T A;  4O2A A;  2ADQ B;  2XAF A;  5LYJ A;  2CTW A;  5LGN A;  1NS1 A;  4NR1 A;  1NZ6 A;  2RJZ A;  2OWO A;  1OCR B;  4DV0 B;  5EK0 A;  4ZI7 A;  1NVP B;  1KQS U;  4BIZ A;  5FPO A;  1Y76 B;  4TUY A;  4DV7 O;  5JCO C;  5HFL A;  3UT5 A;  1W0K G;  1QBZ A;  3RYC B;  5IJ0 B;  3WB2 A;  1DF5 A;  2M7W A;  4RAI A;  4DR6 B;  4X62 B;  3U11 A;  5CB4 A;  4PDV A;  2E5L B;  2WLI B;  4PI2 A;  4IIJ A;  2VS0 A;  4DR1 B;  5FL7 G;  3AG2 C;  1HR0 O;  5FNV A;  4DR3 O;  4OPA A;  2ATK C;  2Z5U A;  2A06 H;  3KCY A;  1RSO A;  4FM2 A;  4LF4 O;  4JYY A;  3JCU Z;  3GB7 C;  2DW4 A;  2ZE5 A;  1QNM A;  4I55 B;  5EBW C;  5LMN O;  3APO A;  3P3P A;  1EBO A;  2QWQ B;  1YIJ V;  4WFE A;  3ZCC A;  2AHZ A;  1H2K A;  2WLN A;  1V9P A;  3OAA G;  3IGA C;  2VQE O;  4D7S A;  1RFY A;  4WFH A;  1U97 A;  1VIB A;  3G6E V;  4UVB A;  1H2G A;  4Z1M G;  1Q6I A;  1OHH G;  1N36 B;  4DV1 B;  2XTA A;  4JI7 B;  4LNU B;  1VQ9 V;  4KFM A;  5H9C A;  4JGS A;  4CS4 A;  3J80 N;  4Z2W A;  5IJ9 B;  1W59 A;  2YUA A;  4W4K A;  1P7B A;  4FLW A;  2QM7 A;  3STL C;  4GKK B;  3MHS C;  3R65 A;  3IJ4 A;  3QO5 A;  4JI0 B;  2R9A A;  2CUG A;  1Y6X A;  2CGN A;  4LH6 A;  2EIN B;  3VQW A;  1PNK A;  5GTH Z;  5CA1 B;  1R3I C;  3I5D A;  5EBL C;  4LFA O;  1O9G A;  1KU9 A;  2QGN A;  3AK1 A;  3ZMU A;  4ZHQ B;  3Q4H A;  5BMV A;  2Q6A A;  5J2U B;  3I56 V;  1PL4 A;  1G4Y B;  1H38 A;  4JTC B;  2M6Y A;  3HKE A;  2QSA A;  1WA8 A;  3K08 A;  2P7T C;  3DC6 A;  2HVK C;  4UB8 Z;  2BTQ B;  2V7Q G;  3CYO A;  4GYC B;  1VF6 C;  4NB5 A;  3JAT A;  4B08 A;  2L35 A;  4JI5 O;  3H1L H;  4LF9 B;  2Q5Z A;  1I94 B;  2RQ6 A;  2ZR2 A;  3HKC B;  2DQ3 A;  3UCS C;  5D5P A;  1MAB G;  1AJN A;  1QQC A;  5IY5 C;  3E8H A;  2OIG A;  2AGA A;  4JZG A;  3CXH F;  5CB4 B;  4J9Y B;  2QWN B;  2Q7H A;  1ZX3 A;  4GX0 A;  5GON B;  3G67 A;  2WPD G;  3MHH C;  2WAM A;  2YS8 A;  4B3T O;  1J5E O;  1BQZ A;  5IYD O;  1Z2G A;  4LWS A;  1H2S B;  4IGG A;  3RYH B;  4YJ3 B;  4JI4 B;  1Z5V A;  4TOI A;  4H0L B;  1SQF A;  1Q8I A;  5LYJ B;  1NR7 A;  2ZCE A;  2XUM A;  1OCO C;  4Z1V A;  2P22 C;  2GTS A;  4X65 O;  4DYL A;  4X20 B;  2OCC C;  1AJQ A;  2E76 B;  1QCE A;  4ZIB A;  1M4U A;  4EB6 B;  1KYO F;  2ZE7 A;  2PZS A;  3E86 A;  4X9Q A;  3LDC A;  2OTL V;  1FXK B;  1AR1 B;  1KP3 A;  3ETE A;  4BAY A;  2UXB B;  2AW9 A;  5JVD B;  3W7X A;  5KUM A;  2JS5 A;  1KB9 F;  2YC0 A;  3FKS G;  3CRM A;  3W7S A;  3IC7 A;  5K1X A;  2WA4 A;  5LOV A;  3SJB C;  2JIZ G;  5CN0 A;  2OCC B;  3T1H B;  2UUA B;  1F7Y A;  5FPR A;  4DUZ B;  1NU1 H;  5A2Q N;  5LOV B;  4LF9 O;  1HDJ A;  2UXX A;  2CTP A;  4X65 B;  5A9G A;  1N33 O;  1N0J A;  2E75 B;  2YIB A;  1L0L H;  1TUE B;  4PDL A;  1Y74 B;  3THO A;  3T4Z A;  4NVP A;  2Y4U A;  2XAJ A;  2P6J A;  3ETQ A;  5KUK A;  3E2E A;  4PA7 A;  1QLE C;  3ASO B;  1G6U A;  3ABL B;  3HB3 B;  4BW9 A;  3E8B A;  3L73 H;  4TV9 B;  4QJF B;  5KX5 B;  2UUB O;  3DGE A;  3N2G B;  1TVK B;  5L3D A;  3OFN G;  2WLJ A;  4FFB B;  2Y69 C;  3JAW B;  4JYA B;  1Q90 D;  3H01 A;  3CCS V;  2IM9 A;  2JS3 A;  3T1Y B;  2CK3 G;  1PL0 A;  1SQG A;  4DR4 B;  1ZSP A;  3J81 N;  2ADP A;  4B3M B;  3E8G A;  2B5U A;  4X8A A;  4D6T H;  1VQ6 V;  2Z0A A;  1HNZ O;  1JPX A;  2GSM B;  3CS5 A;  2QKA A;  3ZMS A;  3CD6 V;  2NNU A;  2VWK A;  4LF4 B;  3OR7 C;  1GAX A;  2ZXW B;  1HNW O;  1N32 O;  1XNQ B;  1MZF A;  4MVQ A;  5B1B B;  4YXW G;  2Y4T A;  2V1D A;  3HKC A;  4FZ0 A;  4XDK A;  3EVK A;  3OTO O;  4NKG B;  4IYI A;  1GKF A;  3CCJ V;  3L70 H;  2YEV A;  2EUL A;  3JSN A;  5J2T B;  3H1H H;  2BSK A;  1OCZ B;  1SQV H;  2OYQ A;  2ITC C;  1WLE A;  4WFA V;  3AG4 B;  3EHB B;  2N04 A;  1HNZ B;  1FS0 G;  3ASO C;  1WPB A;  1Z5W A;  4UCU A;  1DLB A;  3BEH A;  4O4L A;  1HR0 B;  2H8P C;  4LH7 A;  2GDS A;  5EBM C;  3CB2 A;  4YJ2 A;  4KHP B;  3AK3 A;  2DYR B;  4PV1 B;  5E1A C;  1SES A;  1N33 B;  1Q81 W;  1WNS A;  5KLV H;  2FL4 A;  4GX5 A;  3ZRW B;  4A5U B;  1G1X B;  5KHJ A;  3E22 B;  3PJS K;  4LFA B;  3BY6 A;  2F43 G;  3K9A A;  1U96 A;  4R8C A;  3JAM N;  4E4E A;  3AG1 B;  3RYF B;  5IJ0 A;  2Y0P A;  2BTQ A;  2BE3 A;  2EZP A;  3K3W A;  4R7C A;  2CDY A;  3CCE V;  4JAS A;  5EZY B;  3P3N A;  1PNL A;  1LR1 A;  5JQG A;  1EFR G;  4DR7 O;  4UCV A;  2LGW A;  3K04 A;  1SKV A;  3ZMT A;  4FLY A;  3ZHT A;  1D5N A;  3CCR V;  3SJA C;  2E3C A;  2F93 B;  5KHG A;  4P9O A;  1F51 A;  2H94 A;  4UUJ C;  1NVP D;  1IXM A;  2IJH A;  5LA6 B;  5EYP B;  4KHP O;  5KAI Z;  1VQO V;  3AG3 C;  2Q8V A;  5CA1 A;  2PI4 A;  4CH4 A;  1I5Y A;  1SER A;  2ETN A;  4J80 A;  2HFE C;  2CGO A;  4UB6 Z;  2IJK A;  4LC1 A;  1GH6 A;  4GLX A;  4FK5 C;  3B8M A;  2Q0O C;  3AG2 B;  2HKO A;  3WB0 A;  3L9D A;  4LF7 O;  4G28 B;  1DK1 A;  3ABU A;  4GKJ B;  2EJ7 A;  4F6R B;  1HNW B;  3RFR A;  1HWY A;  1EN6 A;  2FYU H;  1N34 B;  4OPH A;  3I55 V;  4B3R O;  2W0F C;  3G6B A;  5KMG A;  4NTW A;  5L3F A;  2CAZ C;  5CBF A;  5JJE B;  1SZT A;  4UVC A;  4I55 A;  3T1Y O;  2BTO A;  1MZE A;  2Q67 A;  1ENV A;  4ZOL B;  3RVZ A;  2VQF O;  3K0D A;  4LFB O;  1Q7Y W;  1XQ8 A;  1KC8 W;  1FKA O;  4MVO A;  1OJH A;  4U7O A;  1MMM A;  3ZMV A;  1GMG A;  4TUY B;  2JVD A;  2F23 A;  3OMA B;  1NI8 A;  4GKJ O;  3T1C A;  1K97 A;  4YJ2 B;  2RCV A;  3HPL C;  3CCM V;  4GX2 A;  1BMF G;  4J11 A;  3MAQ A;  4F4L A;  2GUZ B;  3HKD B;  1S72 V;  3SYQ A;  4LFC B;  4OX9 B;  2Q0A A;  3ZHR A;  1FXK A;  4GT1 A;  2GTA A;  3CRA A;  4I50 B;  4DV3 O;  2OIE A;  5TIS Z;  2UUB B;  1N32 B;  2H3O A;  3A2F A;  3TK1 A;  1NTM H;  4DK0 A;  1RM1 B;  1V54 B;  2DE0 X;  3ABK B;  3JAR B;  4I0X A;  5LXT B;  4X20 A;  2YIB D;  1I5X A;  1KEC A;  1NH2 B;  3JAL A;  4LR3 A;  4O2B B;  1YIT V;  2WLH A;  3O9O A;  3FB8 C;  4RO2 A;  4OGQ B;  3O65 A;  1I0H A;  1T5E A;  4YJ3 A;  1MOF A;  3JAS B;  2HJD A;  1K8A W;  3RYH A;  4PJ0 Z;  3CSX A;  4MVR A;  2ZIM A;  3C3T A;  2XAH A;  2DJV A;  4CH6 A;  3DXR A;  1BQ0 A;  2Z3Y A;  1FFT B;  5GON A;  3K58 A;  2XND G;  1VQ5 V;  3FFQ A;  4PA4 A;  1IBK B;  4MT8 A;  2PTM A;  1G8M A;  3ZHQ A;  5JH7 A;  2PUS A;  1BHA A;  3JAW A;  2FTK A;  1F4M A;  1ZLZ A;  1BS3 A;  1FXV A;  2QTS A;  3ZED A;  2YSU B;  1R6N A;  2WWW A;  3U10 A;  5C93 A;  1JOY A;  2A9H A;  1LUV A;  2F66 C;  2YIC A;  1IBM B;  2RDC A;  2BOB C;  4WFB V;  3RWR D;  2IW5 A;  1NJI W;  2HVJ C;  2P4V A;  1FFX B;  3M99 B;  3RYI B;  4YY3 B;  4J41 A;  4NXM B;  1AP5 A;  4DK1 A;  2Y48 A;  5J9P C;  1Y74 A;  2B9Z A;  4ZHQ A;  5HFM A;  1YDX A;  3CC4 V;  1PKX A;  1E1R G;  1MG1 A;  1JQ0 A;  5H2F Z;  4CS2 A;  1AVM A;  4PEL A;  1Q6U A;  2ZKO A;  4DR6 O;  4ZKI A;  4HNA B;  1OCR C;  4JI8 B;  1S5H C;  5JH7 B;  3CMA V;  3HR0 A;  4FLV A;  1M9N A;  2YI8 A;  5LP6 B;  2WLL B;  1VQM V;  2CE4 A;  4DO2 A;  4WCE V;  3CME V;  4FZ1 A;  5IJ9 A;  3SDL A;  1SS3 A;  5LHG A;  2K1E A;  4FLU A;  2ARH A;  3FAV A;  2L6L A;  4TQF A;  1KMI Z;  3ZRS A;  5IYZ B;  1TGO A;  1NH2 D;  3K5M A;  1GN2 A;  2ZIN A;  4B7K A;  3BAB A;  5B1A B;  3RBZ A;  4I5S A;  3W7T A;  4OX9 O;  4DR2 B;  1SQX H;  1M57 C;  4LF7 B;  4QE9 A;  2D2C B;  1IXB A;  5DED A;  4GKK O;  4EFB A;  1N0N A;  5EC2 C;  1YEW A;  1XHX A;  3ABT A;  2ZE6 A;  5LBQ A;  1JVM A;  4QE7 A;  5LMN B;  4X1Y B;  3JCZ A;  4X66 O;  1THZ A;  4K0K O;  4HZ3 A;  4TQD A;  5B1A C;  1Q82 W;  3LDE A;  4WFF A;  2X6B A;  4X89 A;  1W2B U;  2UXD B;  3W7W A;  2UUA O;  5GTI Z;  1M93 A;  1MSD A;  4JYB A;  1JFF A;  4DR2 O;  3AEI A;  1KKC A;  2VQE B;  1RP3 B;  4RUF A;  2IJI A;  4JV5 B;  2QWP B;  3SGI A;  4FMT A;  4TV8 B;  4LCU C;  3RYC A;  4FFK A;  1PP9 H;  2IBZ H;  3OEH G;  1KKD A;  4WBN A;  3OTO B;  3IAY A;  3EFF K;  4ZI7 B;  1B6Q A;  2DN9 A;  2ZQM A;  1YZB A;  5J2U A;  4O4H B;  3VQX A;  5BMV B;  1VMG A;  4Q6G A;  4QIW F;  5EIB C;  3G4S V;  3D3I A;  4DW1 A;  2PY5 A;  4O2B A;  1WAZ A;  2JGD B;  5CBH A;  4ABM A;  3QTC A;  5L3E A;  1IUR A;  5AG2 A;  4UCT A;  1FJG O;  1NR1 A;  4DR4 O;  4DR5 O;  1BE3 H;  1GK9 A;  3TET A;  1JR9 A;  1JJO A;  4MVM A;  3F5W C;  1K9M W;  5EYP A;  4IT5 A;  2W0X A;  4TT3 G;  1SZX A;  1LNQ A;  4FM0 A;  1O9H A;  1KD1 W;  4TV8 A;  1NQT A;  2PGG A;  2F1M A;  1OCC C;  1VQ8 V;  1ZUQ A;  1IDS A;  3OMI B;  3RGB A;  1AJP A;  2IU0 A;  3J7A U;  1S77 D;  1WB8 A;  2MK3 A;  4ICG A;  3X2Q C;  3B40 A; 
#chains in the Genus database with same CATH homology
 1Y74 A;  1VF6 C;  1Y76 B;  1Y76 A;  1ZL8 A;  1Y74 B;  1RSO B;  1ZL8 B;  1VF6 A;  3B40 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...