1Y7IA

Structural and biochemical studies identify tobacco sabp2 as a methylsalicylate esterase and further implicate it in plant innate immunity, northeast structural genomics target ar2241
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
258
structure length
258
Chain Sequence
EGKHFVLVHGACHGGWSWYKLKPLLEAAGHKVTALDLAASGTDLRKIEELRTLYDYTLPLMELMESLSADEKVILVGHSLGGMNLGLAMEKYPQKIYAAVFLAAFMPDSVHNSSFVLEQYNERTPAENWLDTQFLPYGSPEEPLTSMFFGPKFLAHKLYQLCSPEDLALASSLVRPSSLFMEDLSKAKYFTDERFGSVKRVYIVCTEDKGIPEEFQRWQIDNIGVTEAIEIKGADHMAMLCEPQKLCASLLEIAHKYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords salicylic acid-binding protein 2
publication title Structural and biochemical studies identify tobacco SABP2 as a methyl salicylate esterase and implicate it in plant innate immunity
pubmed doi rcsb
source organism Nicotiana tabacum
total genus 75
structure length 258
sequence length 258
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1y7iA00
1CQWA 3HABA 5E4TA 1EH5A 4P08A 2WFLA 1W1IA 5D6OA 3G9UA 1QIIA 4J7AA 3AIKA 4FBLA 2VJCA 5AM5A 4QDOA 3IBTA 4H18A 1GKLA 3QPCA 5LLSA 3FLAA 4OYLA 1H2YA 3FCXA 4JNCA 2XMSA 2VJAA 3T4UA 5AKKA 3R3YA 3WK6A 1N8SA 3DNMA 4U2FA 4UBOA 3D2AA 1THTA 2VSQA 4UBKA 2C58A 2ZVDA 4WJLA 4W1QA 3QPAA 2Z3WA 2XUJA 4NZZA 4X92A 2BUAA 1F8UA 5IVKA 4BTLA 1L7QA 1W52X 4H7FA 3WMRA 3BJMA 5K3FA 4PSCA 1H2ZA 4NVRA 2PSDA 1UWCA 5AI8A 5AICA 3I1YA 2PSEA 5BWBA 4CIAA 4GEGA 5A6VA 4HXEB 2CJPA 1QIFA 2CZQA 2GYVA 3GA7A 5CH5A 3NUZA 3JYHA 1YR2A 1CRLA 2JGLA 3HZOA 4UPDA 1QTRA 3AIOA 4H7IA 4DGQA 3EIOA 4JH0A 4A23A 1LPPA 2WSLA 4S0XA 3QH4A 4EZIA 1LLFA 5A7FA 3WA6A 2XUIA 3FAKA 3O9VA 1AC5A 2YASA 2BCEA 4BRZA 4FLFA 4HXFB 3PDCA 4FFVA 2EEPA 4CFSA 3WZLA 1GGVA 5CMLA 1TKRA 4ITVA 1Y7HA 1GZ7A 1JMYA 3N0TA 3H1AA 3IUNA 5JZSA 5CXUA 2OXEA 4DNQA 5SYMA 4IHAA 3C6ZA 1GPNA 1TAHA 4W1PA 1HPLA 3WK7A 3VJKA 4H7DA 3D2CA 1QFMA 3GELA 1FJ2A 4FDMA 1QIKA 5AIBA 4OB8A 3DYVA 4CCWA 3CN9A 4UBLA 4J0JA 5AKGA 1QIHA 4B83A 2QXUA 1CUAA 2C5GA 4CI9A 1MX5A 3DCNA 2XQFA 4CG3A 4Y2XA 3E4DA 5AI4A 1JI3A 3AINA 1ZD5A 1DWOA 4AXBA 1VE7A 4EB0A 3RM3A 5EIEA 4DMCA 5ALPA 2OCLA 3VKFA 4BATA 2PSHA 3IURA 6YASA 2AJBA 2QMQA 4K2AA 4HRYA 4F21A 4G9GA 2YH2A 4UHCA 2AJDA 3R3WA 4BC1A 1CLEA 1RWQA 5FRDA 4H7EA 1JJBA 5YASA 4AMYA 2WUEA 1VZ3A 5AKHA 4DMKA 4WDQA 3VVLA 5JAPA 3DS8A 3STYA 2R8BA 4LKOA 1LPNA 2HDWA 1BEZA 2HU7A 1NU6A 2G4LA 3WKAA 2NW6A 4Y9SA 4DYHA 3GZJA 4W1SA 1AUOA 3DKRA 3O4JA 3ED1A 3G9XA 2VTVA 2VJBA 4PO3X 4OUKX 1JJFA 3FSGD 2Y1KA 4HZGA 1CUZA 3O4HA 1WB6A 2JGFA 4DIUA 3N2ZB 1RP1A 4F60A 3Q8WA 2ROQA 5BWCA 5HF6A 1DWQA 3FLBA 3IUJA 2WTMA 2GBCA 2CUTA 5E4JA 1FFCA 3H17A 1UK6A 4X85A 4B0PA 1MNQA 3WKEA 1MX9A 3O95A 2RONA 2WFLB 2AJ8A 1RYYA 2BUCA 1QJ4A 4UUQA 5ALXA 4BC0A 3O4IA 2JGIA 1QOZA 4EBBA 5ALKA 4L3WA 1OXMA 2DSNA 2QVBA 3WL6A 5HF5A 1XZAA 5ALYA 3PUHA 3FVRA 1CEXA 3HRHA 1LNSA 5AKIA 2O2IA 4HRXA 2XUGA 1O6GA 4TVKA 3R3XA 2V97A 4QWMA 3UUEA 4B81A 2B61A 4G5XA 4UHBA 2XQJA 4QA9A 5KBYA 5AI0A 3AZQA 2WJ3A 4AO8A 1ZJ5A 4FNGA 4BE4A 1CUUA 5DWDA 5JD4A 1CUGA 1WM1A 4U2CA 2Q0XA 2HA0A 1GT6A 3KOOA 1C7IA 3G0BA 2ORYA 4H7HA 2VAXA 2R11A 2BAGA 4Q82A 1D07A 3S2ZA 3A2MA 2OGTA 4G8DA 4EY5A 5K3FB 2PL5A 2LIPA 1WHSA 2HFKA 4BYMA 5FV4A 3D2BA 4N8DA 3FLEA 3D0KA 1G4HA 4Q1VA 2QS9A 2WG1A 2X76A 2JIDA 5AM0A 5LZ4A 4BVKA 4CG1A 5ESRA 4UHFA 2DHEA 2ZJ7A 1E8NA 2QOEA 2IX9A 3QYJA 3V1MA 1WB4A 1AKNA 1SC9A 3KDAA 5AK3A 4BAZA 4HAIA 1ACJA 1LBSA 3AZPA 3Q0TA 4G4GA 2OAGA 1ETHA 2HA6A 2XUQA 3STUA 3G0GA 1B41A 2WUGA 5CXXA 2WG0A 5JAOA 3ANSA 1QO7A 1R9NA 4AZ3A 1R1DA 4FLMA 1VA5A 2QRUA 3L1IA 4ZXFA 4F5ZA 2XT0A 3NOXA 4Y2TA 3A70A 3S8YA 2XLBA 1YSCA 1BS9A 1EHYA 4UBMA 2DQYA 5E4YA 4K6HA 5AKZA 5C8VA 2VA9A 1DT3A 1Y37A 5LKAA 4Y2RA 1SCIA 2HA4A 2PX6A 1XZDA 4UHHA 2HRQA 4P93A 3GROA 5K3DA 1DQZA 2V98A 2ZYIA 2HHAA 2QR5A 5CT6A 2BUBA 2WIKA 5KREA 5JANA 2WIGA 2WLSA 4GDMA 1CIJA 3GFFA 3MUNA 3BXPA 3STXA 3I1IA 3G9TA 1ZD4A 1GXSA 2H9YA 2HA7A 1QZ3A 4KE9A 4Q34A 2WIDA 5C8XA 2Y2UA 4O08A 4N8SA 3AJAA 1YAJA 1CUJA 3U1TA 1UZAA 2HFJA 3EQ9A 1ZI8A 4E14A 2HM7A 2XMZA 2PU7A 1XZFA 2JF0A 4PSUA 4J0IA 4B84A 3IDAA 4QLOA 4J0GA 1DTEA 2E3JA 5AM1A 4JYMA 1J1IA 1XZGA 3DL4A 2H1IA 5HQ3A 2DQZA 2WHPA 3LCRA 4DMHA 3CN7A 5LYYA 4PW0A 5AKJA 3ZI7A 4Y2UA 2QXTA 1IUNA 2XUPA 3H18A 4ARAA 2B9VA 3I2IA 3I6YA 4GECA 3D4LA 2CKMA 2JGEA 3V1NA 4BAUA 3C6XA 3WWOA 3WYNA 3O9MA 4U2BA 5K3EA 3KD2A 1N5RA 1GPLA 1CUEA 4LIPD 1E8MA 3R3VA 2HA5A 3WK9A 2XB6A 2HA3A 1T4MA 5AK4A 4DNOA 5AKEA 5ALOA 4B0OA 3UUFA 4P92A 5JZBA 1OCEA 1VXOA 1W75A 4ZV9A 2VF2A 3PICA 1FFDA 5LIPA 5DYWA 4EY7A 2BKLA 5A7HA 3D5EA 1A7UA 3AUKA 2W6CX 4UFPA 1PJAA 4X6UA 3MUOA 2HL6A 1EB8A 4X6YA 2O7VA 4DMFA 5ALHA 3CCCA 2ACEA 4XX1A 2WM2A 4QE3A 4C6HA 4CCYA 4X93A 5ALIA 4FKBA 2XQKA 1QO9A 4C4YA 4I19A 4X91A 5AHXA 3OM8A 1MT3A 4BZWA 3ICVA 5K3AA 5ALEA 4X6XA 4G9EA 1KEZA 4X00A 2WG2A 3TJMA 4QDXA 2AXEA 3I2KA 2C5FA 1BN7A 4IH9A 3W05A 2WUDA 4EY6A 3VVMA 1Y7IA 1W6RA 3I2GA 3W06A 4F0JA 3C5WP 2Z8ZA 4ROTA 5D7BA 2Z5GA 4ETWA 4J03A 1XRPA 3WIBA 3V9AA 4QLAA 2QJWA 3KWJA 2XQIA 4AX4A 1CR6A 4G1FA 1O6FA 5CBKA 2YXPX 3I28A 5K3CA 5JATA 5D3ZA 2DR0A 4W63A 3BIWA 4Q05A 5JAUA 1YB6A 4QNNA 1CUCA 1FSSA 1P0MA 4RE6A 2CEKA 1YAHA 4BCBA 3V1LA 2PM8A 3C43A 5C8ZA 1IZ8A 1XQXA 1R3DA 5LZ8A 2FX5A 5IKXA 5BV7A 2Y2VA 1AGYA 3GBSA 1A8UA 4E11A 4KAAA 4J0DA 3HLKA 3WQHA 1ZGBA 3IUMA 3WL7A 3B12A 3ESCA 1S8OA 2OQIA 3YASA 2Y6UA 4JYPA 1CUYA 2Y6VA 4EUSA 1DX4A 1PFQA 2O2GA 3WKBA 1SCKA 3ZV7A 2C4HA 3C6YA 3QITA 2ZYSA 4EY4A 2V9ZA 2C0PA 5AK6A 4MQMA 5A71A 1B6GA 2FJPA 3P2MA 1DINA 1ODCA 3KSRA 4DLNA 3C70A 3C6BA 2HU8A 1EK2A 3R3UA 4EY8A 1AX9A 3UMJA 1HDEA 3HEAA 1IMJA 3QBJA 1KU0A 4KRYA 2BJHA 1UKAA 1CUFA 4LYEA 1JU4A 1OILA 4I3FA 4C01A 1MJ5A 3QMMA 1VZ2A 1XZJA 2J3QA 1JT2A 1WOMA 2WIFA 1WPXA 4E15A 1ZICA 3O0DA 4X97A 3CCBA 2XDWA 2XMGA 2GBFA 1ZI9A 2P8SA 5K5EA 4UBJA 1GQSA 2B4KA 3JW8A 3WK8A 2J4FA 1G5FA 1BU8A 1XLVA 3I2JA 4C87A 3OURA 4AO7A 5HQ3B 4GW3A 1YASA 4Y2VA 3LS2A 2WHPB 4LXIA 4HVTA 2GBGA 1MTZA 5DLPA 4YX9A 3HJUA 4Q3LA 3G0CA 3BJRA 3FVTA 4YK7A 1GKKA 1XQWA 3H19A 1QFSA 1K4YA 2O7RA 1QE3A 3ZLVA 4RGYA 1XFDA 4BVJA 1A8SA 1P0QA 4XWGA 3GUUA 1UFOA 4J3JA 4UFOA 5HF9A 1TIBA 2I78A 4OD0A 1QIMA 5BOVA 5H3HA 1DU4A 4WY8A 2WIJA 1NX9A 5CH3A 2W22A 1Q0RA 4KJXA 1Q0ZA 4Y2YA 1R9MA 4B80A 3IUQA 4L9AA 1XRNA 1CUXA 3PE6A 3WWEA 3WK5A 3WK4A 1XRLA 2ONCA 2Z3ZA 5EIHA 2RHTA 1BCRA 4Z49A 5AKXA 3ILSA 1JFRA 2C0QA 4CCYB 5LP1A 4OSEA 1L7RA 5CT5A 3AZOA 3R3ZA 5ALJA 3RLIA 5AH0A 1DX6A 4FFWA 5AM2A 5AJHA 2V96A 1YB7A 4LXGA 4AB1A 2ZSHA 5ALRA 1BE0A 2EDCA 2ES4A 2I3ZA 3DLTA 5AIAA 4TPKA 5EIAA 1P0PA 1BCSA 2QM0A 4U2DA 5AP9A 5EGNA 4OYYA 5K3BA 1F0NA 3A2LA 4H0CA 1MO2A 4B6GA 3BF7A 3BF8A 1EXWA 1YA8A 3STWA 4WFIA 1CUHA 5DYTA 5HCUA 3RK4A 1TCAA 1VXRA 1AMNA 5AM3A 4MXDA 2G5PA 3HXKA 4GWLA 4LYDA 3LLCA 1WHTA 3DOHA 4TGLA 1AZWA 4X3CA 5CTAA 4PNZA 4BB0A 4BCCA 2ZYHA 2WUFA 2H7YA 3O4GA 1C4XA 4J0HA 4A5SA 1XQYA 3OOSA 5AKYA 4V2IA 4IQ4A 1N1MA 4M0MA 5JALA 3F67A 5ISMA 5E2IA 2B20A 1YCDA 3M82A 1TCBA 3IB3A 2WHRA 1E8DA 5DNVA 4K6KA 1ORVA 3CXUA 5AM4A 1UKBA 2DCMA 4HTAA 4DNPA 1FFBA 1J2EA 2RGUA 4PF1A 1QLWA 5A2GA 4NS4A 1LPBB 3FWHA 2X8BA 3WKCA 2JBWA 2WU3A 3D59A 1Q84A 1SFRA 2OQVA 3B5EA 2XUOA 2YYSA 4B7ZA 3H1BA 1H2XA 1MAHA 4U2EA 3FSGA 1EDEA 5JD6A 2OGSA 4Y2QA 4RPCA 5ALVA 4QDUA 3KXPA 3DL7A 3ESDA 3MGAA 3RARA 4UFNA 1HQDA 4Q3KA 4DSZA 2OLEA 4M0EA 3H2JA 3WLAA 5ALMA 1G42A 4FNMA 3IIIA 1LZKA 5JARA 4U2GA 1XKTA 1AURA 3PFCA 3QZUA 4Q3OA 4WFKA 5DYYA 2J3DA 3OPMA 1BEEA 1UT6A 2OCGA 3ESBA 2BGNA 3PUIA 1XZHA 2O2HA 1IUPA 2OG1A 4GHWA 2I3DA 4L72A 1XZCA 5LZ7A 1ORWA 2CBGA 3I6ZA 4N5HX 2H7CA 5CW2A 3G9ZA 1Z68A 1E3QA 3WJ1A 5HF8A 4MQLA 1X2EA 3IVMA 3VDXA 1LGYA 5JAHA 3AIMA 3I6MA 3KWFA 4ZI5A 3SC2A 4X90A 5AK5A 1XZEA 1CQZA 3VISA 5JZ9A 5FKJA 2HADA 3F8SA 1XZKA 4BCDA 3E1GA 5IVDA 3WWCA 3WL8A 2XMBA 4G8CA 1CUVA 5T4FA 3W04A 4C88A 4MWTA 5T4HA 1E89A 1SOMA 1UOOA 3ZLUA 3C87A 2HIHA 1QIDA 1XZMA 3DEAA 2G63A 3QVMA 3L1JA 3AILA 1UOQA 2JGMA 4AN0A 1QIJA 4KE6A 2GBIA 4RNCA 1KU6A 1ODSA 4AQDA 3WIOA 3LIIA 1J07A 1P0IA 2RIPA 1ZJ4A 1THGA 4Y2PA 3PFBA 3TEJA 1QGED 1QONA 5ALGA 3A6ZA 5CRIA 4OU5A 1CVLA 3BWXA 3V48A 2WTNA 3ZLTA 4GLBA 5I8PA 3WA7A 1CFJA 4MWSA 4DSAA 1XROA 1ZI6A 1HL7A 1AQLA 1MNAA 4E46A 1DWPA 1PV1A 4NMWA 5ALUA 3WYDA 1R88A 1LPSA 3C8DA 1K5PA 2WILA 5EFZA 4B9EA 1J06A 4QEKA 4AO6A 3FYTA 3I2HA 5AOBA 2OGZA 3PF9A 3M3DA 4PQEA 4YASA 1VLQA 1YS2X 4WDRA 1VJ5A 4FOLA 1HKHA 1QTIA 2XMQA 1MPXA 4Y2SA 1IZ7A 5AOAA 1ZGCA 3ANTA 4BE9A 1Q83A 1MN6A 2QT9A 1X2BA 3BDIA 5EHXA 2VEOA 4JUIA 5JADA 4GXNA 1HBJA 3G02A 1R4ZA 2WJ6A 5JASA 3QM1A 4B82A 5CT9A 2ZJ6A 2XUDA 1XLWA 1CUDA 1FFAA 1H23A 5ALZA 1F0PA 4WCVA 3X3HA 1UK7A 1EI9A 1CPYA 3OG9A 4UBNA 3G8YA 2QKYA 4GBGA 2AJCA 1I6WA 2PPLA 3PI6A 2OPHA 5CT4A 3W9UA 2ACKA 1ZOIA 2XUKA 3C45A 2CB9A 3DDUA 4QDZA 3LP5A 3BL8A 2VATA 1E66A 4JEIA 1CUSA 5FPQA 3R41A 1A88A 3QMWA 1H2WA 4FMPA 5D3KA 4OCZA 1NU8A 4INZA 4KAJA 1EA5A 5LZ5A 2XI4A 2WFZA 3H2KA 1U4NA 4H7KA 1UK8A 5AI6A 2HRRA 4UHEA 3FNBA 3WWPA 5A7GA 2VJDA 4A16A 3V1KA 3OC0A 4DM7A 3FYUA 4C4ZA 1DT5A 1JJIA 2K2QB 3F9CA 3L1HA 5CH8A 2PSJA 3F98A 5DNWA 1BROA 5HZGA 5DTIA 1GQRA 2WFMA 3F97A 3C8HA 1TK3A 1BN6A 2PSFA 5ALTA 4BDSA 2CMFA 1EVQA 3DD5A 4YPVA 2OCIA 4ARBA 1QIGA 3SX4A 4J0KA 4DNFA 1A8QA 2XQGA 2DHDA 4ZRDA 5FPPA 3T52A 3MVEA 1XZBA 4I4CA 5C7YA 1TCCA 4LXHA 2HA2A 2X5XA 2OCKA 1TRHA 3JWEA 3SWWA 4CG2A 5CURA 3VJLA 4C4XA 3BE8A 2G5TA 3I2FA 4B9AA 3D3NA 2XMRA 4N5IX 3C5VA 1F6WA 2VT7A 1IVYA 4IH1A 3WI7A 4QDTA 1R50A 1XLUA 2WHQA 1EX9A 2QUBA 3WWDA 4H7JA 3HYSA 1X70A 3WKDA 2GYWA 3QMVA 3M81A 1VE6A 1EDDA 4M0FA 3R0VA 2XUAA 2JGKA 3EF3A 2GZRA 4HS9A 5FP0A 4FHZA 3H2GA 5ALDA 3H2IA 5KWIA 4X95A 5LZ2A 3PF8A 4BP8A 3WL5A 1U2EA 4ZGBA 4BZZA 1LPMA 3DOIA 4BBZA 2VAVA 1UOPA 2QTBA 1EB9A 4H35A 3FBWA 2WKWA 4MYSA 4Y7DA 1XQVA 1SCQA 2IITA 4QWWA 4EA6A 3BIXA 3IA2A 4X71A 4BTVA 4XJVA 1LZLA 3R40A 1WPRA 5T4BA 5C81A 1ZD2P 3AFIA 3ICWA 3F96A 4HXGA 1XZLA 5IVHA 5DNUA 5I9IA 3NGMA 4MJ3A 1W76A 1N5MA 3W2TA 1K8QA 4KACA 5T4EA 4C89A 4FLEA 4XVCA 2BFNA 4OPMA 1K6EA 4UHDA 1T2NA 4KRXA 2WQZA 4MEBA 1CUIA 1VKHA 2UZ0A 4Y2JA 1JKMA 4EHBA 4K6GA 3K6KA 1EINA 3DKKA 3IULA 4WY5A 1VA4A 1GPKA 1EDBA 3K9BA 3B3QA 4KAFA 4WFJA 4P9NA 4KE8A 2HU5A 4MEAA 2EDAA 1QIEA 1IUOA 4FBMA 2XUFA 5AO9A 4ZV7A 1JMKC 1LPAB 4ZREA 4J0CA 5FDFA 4FWBA 3TRDA 2D5LA 3ZPXA 2JEZA 5JYCA 1HLGA 2JEYA 1JU3A 3ZWQA 2ZSIA 2WU4A 3H2HA 4AN1A 3DQZA 5F4ZA 2PUJA 5KWJA 1BRTA 5IVIA 4BP9A 5EI5A 4G4JA 1CV2A 3ESAA 3E0XA 4PSDA 1ZIYA 2XMDA 4OB7A 2GYUA 1H22A 3D7RA 1MX1A 1UXOA 4FTWA 3DJYA 5ALWA 1K63A 3STVA 4K5QA 1U65A 1VOTA 1YS1X 3VJMA 3K2IA 1ACLA 4KEAA 3G0IA 4DTCA 4MYDA 5LZ9A 2QUAA 2RHWA 2RI6A 5I7UA 1XRMA 2QJRA 5AI5A 4ZWNA 2PUHA 5HFNA 5HK8A 3BDVA 5HKAA 3EBLA 3G0DA 2JGJA 2XMCA 1LPOA 3EQ7A 2GZSA 5DJ5A 3EQ8A 4LHEA 4W1RA 5AOCA 3G7NA 1MU0A 2IIVA 5ALLA 3U0VA 2FJ0A 1ODTC 5HFAA 3STTA 5JD5A 2ECFA 2VT6A 5FUMA 2PVSA 4CIBA 4N8EA 3HACA 3HSSA 4X94A 1U8EA 5ALFA 5FXMA 5LKRA 3FYUB 1XZIA 2J4CA 5EHZA 3NWOA 4IO0A 2C7BA 4XIIA 3DYIA 4BAGA 4H77A 1MAAA 2I03A 5AKLA 3WJ2A 2ZJFA 1XKLA 2XE4A 1DQYA 3TGLA 1CUWA 1E5TA 1ISPA 3QPDA 5FOQA 4BDTA 1UK9A 4UBIA 2PU5A 4D9JA 2D0DA 5A62A 1WCYA 4L0CA 1TQHA 2VQ6A 5EHQA 2XLCA 2DFPA 5CT8A 3HC7A 7YASA 3H0CA 4KR0A 3H04A 1YA4A 4AZ0A 2WJ4A 4RE5A 5SYNA 2PBLA 2RAUA 5HK9A 4OU4A 5ALSA 2FUKA 3WZMA 2Z8XA 3A2NA 4BVLA 2BGRA 1ZD3A 1USWA 1M33A 4W9RA 3E3AA 3OTQA 3SK0A 4X7BA 3RKSA 4B85A 1G66A 1UKCA 4PV7A 4QZVA 5IH7A 4OB6A 1FFEA 3FOBA 5JIBA 1WB5A 5ALNA 1CUBA 1ZIXA 1EVEA 5ALQA 3FCYA 2DHCA 5EHNA 4KYVA 5AI9A 5HKBA 1LBTA 4G8BA 1C7JA 2ZYRA 5FLKA 1L7AA 5DTJA 2OAEA 3LIPA 3M83A 2XUHA 3VXKA 4AMZA 4BRSA 2PKYX 4G4IA 4GI1A 1XRRA 4KE7A 1XRQA 3FYUC 5J3JA 3HI4A 4IH4A 2AJLI 3W9BA 2QZPA 1W4LA 2H7XA 1EK1A
chains in the Genus database with same CATH superfamily
3HABA 5CFPA 2DQ4A 4H6XA 4MVJH 3TAHA 1VSBA 4P08A 4WK0B 4ACBA 5JTUA 3CUYA 2QTMA 5IHXA 4MZXA 5K0ZA 3O6VA 4CEJA 5FNVB 3G9UA 3DDOA 2J07A 3KAKA 5LP6F 3EZ9A 1U5AA 2H5IA 2C94A 3ZU6A 1VJTA 2GPSA 3IHLA 4EGAA 3TD9A 3PX7A 3H5RA 3LHKA 1E2BA 4C3VA 4D80A 3I2YX 5GMOA 4XWKA 1YZVA 4UTPA 4ENQA 1P3DA 1JDBC 2F1OA 4LW8A 5AM5A 3RVJA 1RKVA 1UDXA 1FXWF 3R9IA 5T8KC 1V6CA 4P7FA 4YRIA 5D5HA 1EJ2A 2JJ1A 3V4OA 2PL1A 1ULAA 1D1SA 3R0QA 5JWRA 2XXAA 1WW2A 1HDXA 2MSNA 2QM8A 2R47A 3L8EA 3MC1A 3PP8A 4Q6WA 1ZNZA 2R62A 4JI6B 2ANBA 3R7DA 3E8SA 3QPCA 5LLSA 2RHHA 1JSXA 1H2YA 3QPVA 1UWVA 1YS9A 4ZPXA 5IT0A 4YMVA 5FPTA 3JQPA 4B3JA 1OZAA 1XEAA 4EHFA 3H5NA 1XAGA 3GLGB 1RE0A 4CF6A 3X1XA 4CF5A 2FW8A 1TU4A 5COBA 3TLZA 3DZJA 1EVLA 3E70C 5BOSA 3R0JA 1XTJA 1IIBA 3BSSA 1GTMA 3SLRA 4GL4A 5CP8A 2WJIA 3AY7A 3CO5A 1P17A 1MF7A 1F5NA 5EZ6B 3FHOA 1NX6A 1E61A 3LCMA 2O57A 3DMTA 4FWTA 4KNVA 1CT9A 1A4UA 3SOPA 3JAKB 1K7FB 4L51A 3JQEA 1SBHA 3ONFA 3ZZMA 4BVGA 4WJLA 5JXIA 1AXEA 3QPAA 4FFBB 2XUJA 3KHUA 5FPYA 3PDIB 2QXYA 3OE1A 4GYKA 2HJGA 4RJLA 2O5EA 3FUUA 3QTBA 1FTNA 1L7QA 5ADWA 5F1PA 2P0YA 2OZLB 3AF1A 1PV2A 1TFRA 1CETA 3PG5A 4UNQA 2GQ0A 1PVOA 2EERA 4DC1A 3L02A 1R74A 3AQ4A 3AL2A 2IYRA 2ZWVA 3ZE1B 1ZK2A 1U0EA 5AI8A 5BWBA 5AICA 3I1YA 5ULLA 1YB4A 4CIAA 4QHTA 2FZKA 2UVPA 3LT5A 1LW7A 4JJIA 2VWGA 3OH8A 5AUNB 5HKKA 4NR0A 2QZZA 4QDKA 4XFJA 1PFGA 2CJPA 1AK9A 1HI9A 2QX4A 3DUFB 2NNWB 2PX5A 3LC7O 1KNXA 3NT4A 3BHNA 4CRWB 3EPJA 1O95A 1JL3A 2E9SA 2ZRBA 4RF2A 3TR0A 4ENRA 2O1WA 3JYHA 1KYTA 5DYNA 1E62A 1OI7A 1KKUA 3A9RA 3RUDA 2JGLA 3JPWA 2XB2A 4XIGS 1QTRA 3C3KA 2BF7A 3AIOA 2K7FA 3VYSB 1EX7A 2I4LA 4NU5A 3P19A 2X2EA 5THKA 4JNKA 1O77A 4MJLA 4JQYA 1ZN9A 4YCLA 1WCIA 1AUQA 5EWMA 2ZJOA 4QYIA 1G17A 3EIOA 4JH0A 2P91A 2SECE 3SU8A 4UTVA 1SC3A 3R7FA 1GKYA 4S0XA 1EZ4A 1OB5A 4S2EA 2HUPA 2D2EA 3ETCA 1T1IA 4NIMA 2LNDA 3PNQA 5H1YA 1IL0A 1EAMA 1ZCBA 1DHTA 3V7UA 2O5VA 4AJPA 4L4ZA 4XA8A 4G5FA 1JA0A 1H2BA 4E7PA 2XUIA 2BGGA 4PN7A 2IVZA 5FYDA 3JXEA 1Z6ZA 1P39A 1NF9A 4LJ8A 4Q7KA 2BOVA 2E89A 2ST1A 3N8NA 4CFSA 3WZLA 3HNOA 1QYDA 5IVPA 5JNLA 2E4VA 3I42A 1BVRA 5SZJA 1BRMA 5FLXA 5TF4A 1Y7HA 4MUEA 1GZ7A 3WAJA 5HHTA 1JVSA 3R44A 5F23A 5CM8B 3P2KA 4K0KB 2WF6A 3N0TA 4PAMA 5IARA 3H1AA 1C7ZA 4KVGA 1M0WA 2H48A 3S7ZA 2H2GA 4CR8A 2GS9A 3CLSD 2V4UA 1SXJC 2A0FA 4QODA 4IHAA 4M0CA 1GPNA 3P27A 3KB2A 3LH5A 4RZHA 1EE9A 1HPLA 1OU0A 5JJBA 3D2CA 1G59A 4Z9XA 5KVAA 3IUSA 2RHLA 3PIDA 2WP0A 3GFSA 4F8YA 2BTEA 1XEFA 4A0HA 3ND7A 3TVYA 1QIKA 1SUDA 1O7JA 3UH1A 5FOSA 1WJGA 4LDJA 2DVMA 2W6MA 1T9DA 3KHKA 4OB8A 3S28A 1NJ6A 2F9MA 4CCWA 1T2DA 1WPGA 1RWXA 1H65A 4E5MA 1W1WA 4WA7A 3HXPA 5HFJA 5HUQA 2CLMB 2GHTA 2R6HA 4B4OA 3IPLA 5J4HA 4PS0A 1KK3A 1V8ZA 2VPIA 4ZEMA 2QSUA 3SOZA 4IGKA 4B83A 1PJ2A 2PRJA 2P9CA 4LBVA 1MX5A 1F1BA 3K94A 4IUYA 3BEOA 1TM3E 1G5PA 3RB8A 5CG2A 1J2RA 1ICEA 4KQXA 1QHIA 1Z5ZA 2ECOA 2JHFA 1FDSA 2UYOA 3VSBA 3TNLA 4CIVA 3LO8A 2Q3DA 1ZD5A 4F6CA 4QQKA 2WINI 5DNCA 2P9BA 1VE7A 3ROQA 4KGVA 3GC6A 1KH2A 2B99A 1WULS 2XWSA 5ECDA 1MKYA 2FMUA 4RAOA 5K8UA 1KJ9A 3GI1A 1JV2B 3PHIA 5BPFA 1PFWA 3SEZA 3TZQA 2YYAA 4DLUA 4G0MA 4KLZA 3QEMB 4KZKA 5ELMA 4ZI3A 4QG3A 4DMLA 2AJBA 1FDVA 3TL3A 2B7BA 4R7ZA 4CL2A 1NSTA 1E92A 3TW6A 1OROA 1U1IA 3KSMA 3LOUA 4XWWA 2O8DA 5BSMA 4HRYA 4G9GA 2XE6A 3L7LA 4AZ0B 4UHCA 1Y63A 1XVLA 1VRWA 2XNJA 1DCMA 2WYVA 1IWOA 1CEQA 3EC7A 3W0LB 2J3MA 1XTIA 1MB3A 1RWQA 5JV5A 2FN4A 3RYTC 4QFDA 2YBDA 3NM5A 4QREA 3WS7A 3I04M 4XWOA 2YYZA 4GVLA 1TGYA 2B0CA 3F8WA 1IQRA 3F3MA 3KR0A 2QZJA 3AF2A 2WUEA 1NM5A 2HF9A 1AKWA 3HGMA 4PC1A 5A3VA 4BE7B 4X1YA 4MTLA 3RVBA 2F3UA 5HA5A 5G0UA 5JAPA 3TX2A 4MS3B 3NUGA 1H2FA 4MGYR 3KK0A 5FAXA 3STYA 3VPFA 5FO0A 2YWRA 1DOZA 2I3BA 3A3OA 4AKIA 1LDEA 1C9JA 1FQOA 3D8UA 3RANA 3DQPA 1BXRB 3UHJA 5BVHB 2WAAA 1JALA 2HU7A 3AU8A 4CBVA 1NU6A 2FK7A 1D4ZA 2B2CA 4Q3BA 3W5VA 4MS4B 2F3RA 3DZHA 4QOFA 4Q9KA 3U1VA 5HIAA 4KDRA 3F49S 4UJ3A 1TXGA 2C8KA 4D9GA 3W8EA 2UDPA 2VPQA 2GBLA 4ZYYA 3AYZB 1I10A 3MMXA 1RHJA 3BTVA 1NJ8A 2QVLA 4FPXA 5SZHB 3DZ8A 3VQTA 2GN9A 3SHQA 4BO6A 3ER9A 2GDJA 2REQB 5FBHA 5A5DA 4YMLA 4UARA 1ZGAA 2WOOA 4WWHA 1P5HA 3ZY5A 5K3SA 4I9NA 3LQFA 2D8AA 4L6AA 4CFYA 4BNGA 4YONB 1MA0A 1ZM4A 2DAPA 4EKDA 5A5EA 3EEQA 4GKBA 5A3SA 4DIUA 4RS4A 4DJEC 1RP1A 3OY2A 2PWPA 1RWBA 4F60A 2CV2A 4R7TA 4CV3A 3C7CB 5EXSA 3ZLJA 3O7MA 1PK9A 1FC0A 1FMTA 4G01B 3UKDA 2XUZA 1U8TA 3DLPX 3HKCA 2M6LA 5TR9A 4RK6A 4A5OA 2GB4A 3Q98A 4ZJPA 4DEVA 3MHTA 2WIAA 4XGIA 5GVSA 4IINA 3ADOA 3HCFA 1KOFA 2CVZA 2DGDA 1U8UA 5LPNA 4MW4A 3DMDA 2Z0MA 3H8SA 1TM4E 1YBAA 2V8OA 4B6JA 4D26A 4J91A 3KQNA 4IIEA 5JLJA 4UJ5A 1TE2A 5JYBA 3DW3X 1MX9A 3IKVA 2YTZA 3EHDA 5LB2A 1PNTA 5JHGB 1X42A 4LCBA 4GF5A 4BEWA 4A8HA 3PYXA 3EVAA 2L17A 2EKBA 3O95A 4NCNA 2QTCA 3AFHA 3GQBA 4MPTA 2O2ZA 2P5YA 2WFLB 3I4LA 4HX5A 4MIEA 1PT5A 4CDGA 2NSLA 2AJ8A 3GLHA 4DQUA 3PIRA 1M7BA 3CH4B 2PH1A 3Q5DA 5TMEA 4EZEA 3AUXA 1QJ4A 4GNRA 3ZUPA 1UPUA 3FXAA 5ALXA 4F84A 1Y33E 2ODQA 1FUEA 3O4IA 1T13A 1GL6A 2QRPA 4D3YA 3HBAA 5KNLA 3RJ5A 2Q41A 2IEZA 1A2OA 1DRKA 2GXAA 5LBTA 5KHLB 2OORA 3FPHA 3CTMA 2IE0A 3LQRA 4L3WA 4JLDA 3V46A 1I3LA 2ISQA 4KL8S 2OENG 3NDJA 2PZGA 4QU0A 1E9VA 1XZAA 5ALYA 4P34A 1JDZA 3FF1A 4KPUA 3UTDA 4AULA 1DVRA 1NUTA 1QQ5A 1X1DA 2O2IA 2XBUA 5AKIA 1UMKA 3NHPA 2BDEA 3EZYA 3ISTA 4HNAA 4F4DA 2V97A 1E1CA 6AT1A 1B4DA 2HIGA 2J30A 1WUTA 4NAVA 3UUEA 1JHQA 5EQJB 2L19A 3KJXA 4OQQA 4UM8B 3IDFA 4J3FA 1WMSA 4QA9A 1W4RA 1B00A 1XXLA 1W93A 3PWTA 4AN4A 2CMDA 5KBYA 2BGIA 3OMXA 1YUNA 4PYRA 3K9CA 3HL0A 2RCYA 2ADOA 3AZQA 4QUDA 1D5WA 4ND7A 1P1BA 1OC2A 3JCZA 4FYHA 3IAM6 5EWJB 3CKKA 3OJOA 1VB3A 3GDWA 2D3WA 4BE4A 3GEMA 1XZNA 1CD5A 1LQ2A 1CUGA 1NXXA 3AM4A 3GFOA 2Q0XA 3T9EA 3WNDA 2EJBA 3H5WA 3GDFA 3G0BA 4GMKA 4Z5XA 1OGYA 2O48X 3SN6A 3AR9A 1UM8A 4DILA 2XQVA 3AHCA 1JDNA 4TQ9A 3S2ZA 3GCWA 3AKCA 3ROZA 1UBFA 3BOSA 3TQIA 2JI4A 1N5JA 4PPFA 1FX0A 4RDIA 4NF2A 3W78A 5B58C 4PZZA 3PL5A 4XGRA 3KQHA 3NTUA 3BB1A 4QECA 5FV4A 3DBLB 5L51A 4OBWA 4PHTA 5I7OA 3BXEA 1V8OA 1SXIA 3FLEA 4FYKA 3U81A 2AXNA 2ZP1A 3ZY3A 2HPZA 4Q1VA 3RVQA 4YAGA 2JBAA 2GPWA 2I99A 4HPXB 2X76A 1EBFA 3GA5A 4TUYB 4TRMA 5EIFA 4RVFA 3ZCVA 4AQYB 3CKMA 3L0OA 1XN1A 1JG4A 1G7CA 1Q6ZA 4Z0HO 1FYWA 1WZ2A 4BV8A 2Q2OA 4F1KA 1GRNA 1SCUA 5F5XA 3VR3A 1H3FA 1JEJA 4DV3B 3ILXA 4YJ3A 1JSRA 4NH4A 4OQMA 3Q3IA 2WJPA 3V00A 4BVKA 1K68A 3OOYA 2HI0A 2F43B 1J8QA 2EARA 3V4PB 5K8TA 1OUMA 4EITA 3EWIA 3ZHTA 3QYJA 3IDZA 2B21A 2B9EA 1MP0A 3BGIA 4JOSA 1Q15A 3A3YA 1AKNA 4J3NA 2VDPB 4AMVA 2R4UA 2EYUA 3GGGA 5EP1A 2AMVA 1B0PA 4A91A 2R7AA 3Q0TA 3VKGA 4G4GA 1ZL2A 3UIEA 3QUCA 2FSHA 4AIRA 4DV1B 3S70A 1Z6XA 3TOCA 4MLCA 4EGSA 1HNZB 3AI2A 2QTRA 3TG2A 2QI9F 3X1DA 3ZG6A 1QHXA 2ZYGA 3IYLW 3PD1A 2WG0A 2Q7OE 1U7UA 1XXHE 2DBVO 4TLBA 2P75A 3COSA 1ZRSA 4G1BA 3W5HA 4B2IA 1FSFA 1C9NA 3U7QA 1SIOA 2BFMA 4HEHA 5FI0B 3O94A 4OUDA 4CMKA 4CTJA 1QO7A 2A33A 1KEUA 1EM8B 1PUXA 2PMFA 2BFOA 1R1DA 4EJ2A 3I01M 2QRUA 3L1IA 3EVDA 3A4MA 4FYVA 4ZXFA 3ZY2A 2CT8A 4ZI2A 4WHMA 1W88B 1D09A 3WHKA 2Q1XA 1E64A 5E9QA 3K70C 5THXA 2GX6A 1UC5B 3ECAA 5DBIA 5CFZA 4MVJM 4M89A 1QCDA 3S8YA 1BWSA 2NZJA 1EHYA 2VDUE 4OLFA 1JQDA 3HB5X 1O94C 5A0VA 3HI6A 4BLOA 5C8VA 4WLOA 3D6UA 5LP6A 4LRYA 4G0UA 1H1LA 1M67A 5BQ5A 3CRZA 2C7RA 2XF8A 3HK2A 1VGRA 1RQ7A 3HKBA 2FW0A 2HA4A 1FXUA 3N8KA 4ZDKA 3NCHA 2IYPA 4LYGA 5ITSA 2PUDA 1EZ1A 3TZEA 4NTZA 3Q7TA 3TL2A 1BX3A 5K05A 1FXWA 1Z56C 5KYKA 4C2TA 5B2ZA 2HRQA 4P93A 3D1LA 1AO3A 4FOSA 3KYDB 1DQZA 1KGDA 1C4WA 4KQ1A 1XNJA 2ZVQX 3OI7A 4MV0A 1FSPA 2HSDA 3WLQA 3ECCA 2EV9A 1JN0A 2VPXA 3IP5A 1NP7A 1S4MA 2PS3A 3EZGA 2BEJA 5KREA 4ACAA 5JANA 4ZAFA 3KFVA 1WSDA 4MVJI 3O2JA 1SVKA 4DB2A 3L8CA 3EXFB 4BUJA 1PSZA 2AK2A 1L3BA 5G53C 3CJQA 1GUAA 2X0KA 4G25A 1FLDA 1Z0AA 3BSFA 1X7YA 1A4XA 4PXAA 5E1MA 1V6SA 3K72B 1GU0A 2Q0HA 4KPFC 4MAFA 5DM60 2WI8A 4EHHA 3T6KA 4IXWA 3QEBZ 3VU9A 1GXSA 1NDHA 1M5TA 4Y6RA 4JVLA 1RE1A 1PGPA 1T9GS 1VBFA 4U4AA 2C8JA 2PH7A 3WGLA 1SC1A 3HMQA 2DMRA 3L04A 1BW9A 4FYYA 4UULA 1YVEI 2ET6A 1E1KA 2UYQA 1M2OA 2WRZA 3V6MA 4LXQA 2DWCA 2JEOA 3LO5A 3ZV3A 3OZWA 3VPXA 4EKIA 3D8SA 2I9KA 3W79A 3JALB 1GCOA 4JD5A 5LA6B 4NCXA 1HDIA 5GADl 1CUJA 3QOWA 1F4VA 1UPXA 3A1EA 3VHXB 4YNBA 1YQQA 3V8PA 4S24A 4CL8A 3GVXA 3ZEAA 1OGJA 2OP1A 1F8YA 3EHEA 3DLHA 1DKPA 1XTRA 3TXYA 5CD1A 4E14A 3TFWA 3AVYA 4NYMR 1NMQA 2JH9A 5CXQA 4LF8B 3X1JA 4AS1A 4LRUA 4PSUA 4B84A 4J4TA 1HSOA 1BD3A 2DPGA 4J0GA 4QLOA 2Q99A 1OYOA 1GRVA 4MVJP 2NZ2A 4U5XA 1I3OA 2JJ2D 3JQRA 3THYA 2I67A 4M36A 2PLRA 1I0ZA 3DMPA 5G1PA 3FKSD 3HCAA 4Z86A 2WICA 3A1FA 5EXXA 4JMPA 5F2EA 2IV7A 3MMZA 1Q3KA 3F5MA 3H1GA 3G8AA 2AOTB 5JBIA 2D2IA 1MQ9A 3K1YA 3P7MA 3PJRA 3SJ7A 1K98A 5T6BA 3OE7A 1CCWA 1XZGA 3KKLA 3DL4A 4RTNA 4BFVA 3QXGA 2XB8A 2QRVA 3PGJA 1O95C 3UMFA 2CJFA 3EIHA 4J0QA 2P4UA 1RYBA 2IYEA 2Q5LA 2B8WA 5DMHA 3WOVA 4CU2A 1E20A 3LCRA 3DT9A 4EFDA 2FPGB 1WSAA 3CVOA 4BN5A 4DSUA 2IJGX 3HVKA 5C5EA 1MO6A 1P3JA 4JB0A 2PBFA 4PW0A 4PZAA 3VR4A 3ZI7A 2BMEA 3MW8A 2XE8A 1LKZA 3F4KA 4RD1A 3OM1A 1ZG3A 1KEEB 2YXNA 4UNIA 2B94A 3JQQA 1IBLB 5DASA 2LDBA 3A25A 4YAWA 1P3Y1 3S2EA 4E5DA 4E2YA 3B9RA 4XDZA 4E21A 2MMCA 3I2IA 3RUPA 3BJZA 3D4LA 4A9AA 4DYVA 3H8WA 5AVYA 3SVTA 1X1SA 2DTDA 4AUEA 1CZHA 1BIFA 2JGEA 4MR9A 1AMUA 4C4TA 2WMDA 4M54A 4US2R 4RTJA 2C84A 4TRNA 2BH9A 2HBRA 1Z5PA 3O9MA 1Q6YA 4WXMA 1WZIA 4B5LA 3N2KA 2QN9A 1Q7GA 1VYTA 3WGTA 1D2GA 821PA 3CZRA 3VYWA 5AHKA 1QF6A 2N1BA 3DT6A 1TVKB 3FGNA 5E9JA 2IHYA 3X43A 4I9GA 4FFOA 1LC3A 1QO0A 1N9GA 4Z4QA 4M4SA 3GEPA 2FZGA 1GNLA 3Q8KA 2LRHA 3F78A 4PYLA 1N3LA 4D0NA 3EFHA 2XGJA 3H2YA 2X6TA 4WCDA 1T4MA 1QB7A 2CJWB 2EGGA 2PGXA 3TGWA 1PX2A 4BJ3A 3SHWA 3EDYA 3MGGA 3HGTA 3K30A 4HS4A 2XECA 3TQQA 2QG6A 4G0QA 1YI8A 3DNFA 4WJKB 3E5MA 4RLSA 1PE0A 4FE4A 4MUAA 5L40A 3ICOA 1EZZA 3OPYB 3UUFA 3RH0A 2G6BA 1SXQA 2GAFA 4D82A 5JZBA 1MOPA 2L69A 4ZEXA 3F6EX 4FN5A 2HH9A 2H1VA 1KQGA 2C59A 5CLIA 2XGOA 2D0PB 3CRQA 4LWOA 2EZTA 1QVZA 3IMFA 3NXKA 2R6DA 3KAPA 4CKEA 1E1RA 3CLTD 5A7HA 3BC1A 2A1TS 3VYVA 3AUKA 4JX8A 1RBMA 3UW1A 3LD9A 2PAAA 3ET4A 4RGQA 1PJAA 4MPPA 2IOYA 1HDCA 4TV8F 4X6UA 4YRZA 1MZPA 1V9SA 5KTOA 1XDWA 1FJXA 3QLVA 4P7GA 2Q5HA 3R4VA 2H11A 3VC7A 5H70A 1EMDA 3KJNA 3ULKA 4V38A 4Y1RB 4YFVA 3ZCUA 1XNRB 1FLVA 2ONJA 4KFTA 3ELBA 3U48A 4DMFA 1KHHA 3WBFA 3RCBA 2DHRA 2C2WA 3CCCA 2Y1EA 2ACEA 4MQEA 3WAKA 3ZEIA 4QE3A 2BC9A 1KOJA 4A1FA 3SS7X 1U5BA 5JQGB 1KI9A 2UUOA 3NRCA 1IN5A 2Q3CA 4OGLA 1XVAA 4LG1A 1RC1A 1VCHA 2BFDB 2C2KA 5ALIA 2XQKA 2WNSA 2YWFA 5ICEA 2C2BA 4AJ2A 3ZJTA 2A5FA 3DO5A 3C15C 1AE1A 4C1BA 4LSZA 3BJEA 3D4NA 2IEAA 1RXUA 1FPMA 1MT3A 2G1JA 3ICVA 3WRYA 3KTAB 4F4HA 4RWEA 2G06A 5AW7A 3CVUA 3LLUA 1ODLA 4FILA 4GC9A 1HV8A 1I3KA 3S81A 2FDRA 3VNUA 4JP3A 2B37A 3K1AA 2H8GA 3IUEA 5COQA 3BB4A 4DLAA 2A58A 2KW5A 2WG2A 4N82A 1LBEA 4LJLA 3RNLA 1E0JA 2WUWE 3I2KA 2C5FA 3U7JA 1BN7A 4RA9B 4RD4A 8LDHA 2HCRA 4H0NA 1MD9A 1PS8A 1QE0A 3PL1A 4IM7A 1NM5C 4R16A 3BWDD 1UMDB 3FH0A 4NYJQ 1V1MA 4W6ZA 2X40A 2C3OA 2NU8B 1W6RA 3I2GA 1P2BA 4MULA 3NV9A 3QIAA 1TTPB 4XDGA 5JS7A 1E4YA 4HH1A 4DT1A 3GLIE 3L7DA 1E2IA 3IP9A 4OMCA 1NQWA 4HBZA 4R0MA 1U1FA 3C5WP 2OFXA 4RF4A 5ANRB 1ZUD1 4TXHA 5HGJA 1SU4A 1ZWKA 1NSFA 2Z5GA 5M2QA 2OV2A 3C3MA 1EU1A 4ETWA 3ONWA 4WBSA 1UJBA 1FYXA 4J03A 2H08A 3Q85A 2OE2A 1XRPA 3WIBA 3ENVA 1L8XA 4DIKA 3OTGA 2ZCJA 3V9AA 4LEIA 2GBLC 1HYHA 3HN7A 3ZZ1A 4E4YA 5EHIA 3L7KA 4YCAA 2WF7A 2BWJA 1UBHS 3S2FA 2GTPA 3CLRC 5GAJA 2QJWA 1Z25A 3FTPA 4AX4A 1J0CA 4HPJB 3BWCA 2QZSA 2W6QA 3RVKA 2I7TA 4TWJA 1BMFD 1F6DA 3CNBA 3KYJB 4CYMA 3BSWA 3RG8A 1BA3A 1IY1A 3ND5A 5K3CA 3FPKA 2H65A 3K9LA 4UMDA 3KXIA 3MHPA 3PWKA 4K87A 2FFBA 2KJQA 2J5BA 1C81A 1H0KA 3GIWA 2YCBA 1BJKA 4Q05A 4F91B 2DT5A 1XA4A 4IDPA 4PYJA 3BZUA 3ZD8A 2TYSB 1IBMB 3NB0A 2O50A 4OHOA 4FYMA 4BCBA 3P1JA 2JD0A 3GY0A 5TPZD 2IZ0A 1E6CA 1KI8A 1Y1PA 5A05A 3V4RA 3HCWA 5BSWA 2YNMD 3IAM1 4G89A 4RK5A 1XQXA 2RHMA 1DELA 4MLPA 5GPBA 3FTNA 1V9LA 4HMQA 1QAMA 1J8MF 3QFTA 4RMGA 4MW9A 4I8DA 5BV7A 3EVBA 3A1WA 2Y2VA 5KYWA 2O1EA 4CN8A 2JJ2A 4ZO9A 4KAAA 4N7MA 1Q5PA 3FKSA 1J09A 3HLKA 1OTHA 3WQHA 2VG8A 2XA1A 4Z8YA 4RTSA 4HGQA 3B12A 3ESCA 4GYJA 2Z2ZA 3AVWA 3CM0A 5JRZA 1UBJS 1ADJA 3ZDDA 4ZO7A 3RAEC 1WY7A 2B25A 2NV0A 1MHPA 3HU5A 1WDWB 1V8BA 2B83A 4H3KB 5A1TA 4OM7A 4WCFA 4KN8A 1CUYA 1JFSA 4EO4A 3SKVA 2WA1A 4UAVA 4EUSA 4BO3A 1SUSA 3KAQA 3WKBA 1UAAA 2VOEA 2BFFB 2C4HA 1GYPA 2VAWA 4GP6A 4H31A 2IHKA 5AW3A 3QW2A 3O84A 5I4IA 3DE1X 5KUTA 2UU9B 2V9ZA 2AWOA 3OJEA 5AK6A 1EVZA 2FJPA 2OORC 1X1RA 3MCUA 3K9WA 3DE4X 2H0QA 2R25B 1IN7A 1U3CA 4ZO6A 2JJMA 3WDMA 3GJ8A 1Z7BA 4EGFA 2X2FA 1TUBA 2QSJA 2AQKA 1G1MA 2JLBA 4EY8A 1UXIA 1JKJB 4FYIA 2BIFA 4O2LA 3RU7A 4P58A 3PXBA 4RVUA 521PA 3SZGA 4C5CA 4TSRA 2VOJA 5L3RA 3UMJA 1TCUA 1OIXA 1NDUA 3JYOA 2E2WA 4A0SA 5IJ9B 4OQZA 1KIFA 2BP7A 2YIJA 5EMKA 1PLLA 1RLJA 5JCZA 2YINC 4GR9A 4X3PA 1RXSA 3WHIA 1RPZA 1KHTA 2XSZD 4RV9A 1RJGA 1EWYA 1FYDA 1JU4A 1OILA 1ICIA 4I3FA 3TTYA 2WSBA 4EK9A 3L7OA 5DX8A 1B76A 2VYVD 5BWNA 1PHRA 1N2CE 1ZW6A 3CLSC 3QMMA 4FNAA 4U02A 3H75A 1T8UA 4DMRA 5I9LA 1L4LA 2J3QA 4EFMA 4ZPJA 1WOMA 4QOIA 1HZZA 1SC4A 4Z53A 1V5IA 5DMXA 3VGPA 2B4TO 2ZSEA 5K0GA 2PUBA 4X97A 2GK6A 5FPKA 3MBIA 3WLPA 4HNSA 1RWWA 2XDWA 3VNVA 2GBFA 2V7EA 4BL5A 5CDSA 2Y9MB 4L85A 1VL0A 2P8SA 4LYYA 1U2RA 5K5EA 3BHMA 4L5CA 2XYHA 3GRRA 3P45A 4L76A 3QLTA 3QVOA 4U1RA 4I55F 4A15A 1V2HE 1LDMA 1XCPA 4GYYA 3WK8A 3MLEA 2GM4A 4BO9A 4BS9A 1BU8A 4FI3F 1CR4A 1JX6A 1NLUA 1M2VA 1Y9EA 3OURA 2PD4A 1UFVA 1U9JA 1F8XA 4L2IA 4IEIA 4P38A 4L78A 4UM9D 5JAQA 5HQ3B 2RKWA 1XCBA 3GT0A 3CF0A 2UYCA 1UINA 4U3JA 2NU7A 3DLIA 4DCCA 4UU8A 3SFTA 4FCTA 4IDDA 4LXIA 1MVNA 3KLMX 4FFPA 1T25A 1XN4A 4HVTA 4BPBA 4NBNA 5DWQA 1PDOA 1TU0A 3LDUA 4HN4B 3KVOA 1PG2A 3HDJA 4JBIA 3ZN2A 5BUSA 2VBGA 3E7WA 3ZXXA 4B4UA 2EG9A 2EKDA 1PDVA 2PKQO 3FB4A 2JFPA 2I2CA 4OHZA 4YDSA 4PX9A 2GTHA 1SNYA 1LVHA 2V65A 3UAXA 3L8FA 2PKWA 1NZDA 2VK2A 4IJMA 5BSGA 3EJWA 3F5FA 2JGNA 1YJBA 3H97A 1HDOA 3K35A 5BW8A 1RM4A 3FVTA 3H19A 3VZSA 5F3WB 1K4YA 1NUPA 2O7RA 1B3BA 2HBQA 1QE3A 5LR6A 2IEYA 4Y1EA 5E3HA 2V7UA 1SURA 4RGYA 3A1NA 4XPZA 4E5NA 2J6HA 4D74A 1EHIA 1BXGB 1A8SA 4X1IA 4ERNA 1PDWA 4AZWA 1GLNA 2L82A 3GUUA 4J3JA 3OJFA 3F8TA 1I80A 2H1LA 1FU8A 2GEVA 3M89A 1ZK1A 1OJ7A 3P0RA 1HNXB 1DKUA 5JZVA 5MFPA 5FBZA 4URUR 5UKDA 3GJTA 2ETXA 2NGRA 3TZHA 4D1YA 3EGVA 4OX9B 1E5VA 2WIJA 2ZZNA 4G65A 4I6EA 1WKBA 5IRCD 1K7SN 1NMZA 5AHOA 2A35A 4XW2A 1VCMA 1YR7A 1ACMA 4ASUA 2W22A 2CVFA 3ROEA 2IXGA 1V4NA 1C0PA 3OKFA 4ZOEA 3WOHA 2VDOB 2OFOA 1X1QA 1J33A 2FN7A 2Q21A 3EFOB 5LP6C 1UUFA 5LC1A 4LPKA 4BATA 4RZ3A 1E32A 4JVSB 2WJYA 2Z09A 3GLKA 2WVAA 4QJ4A 2EZ8A 3GJYA 3B70A 3GXBA 4NHOA 4NJMA 2HT1A 5KX5F 2FX2A 1Z6PA 3AM5A 3IUQA 3VO1A 5AUOB 2AHOA 2NYRA 3NHAA 4DKJA 2OO3A 3DBHA 1CUXA 2X1VA 1N2JA 2R9VA 4IIVA 1QP7A 1F2UB 1JJAA 2YHIB 1VKZA 5EWLB 3WWEA 2VS1A 4LBWA 1H0HA 3WK5A 1AKVA 1DO0A 3NPMA 2GI4A 1OBVA 3WK4A 5LU8A 4EG7A 2RHTA 3JX9A 3RYFB 1IYZA 1Z34A 1E7YA 1X19A 2R1VB 5BRJA 2BGTA 2C2XA 1RCUA 3PT5A 2EF1A 4CKXA 2F1JA 3N2EA 3IQHX 3HXLA 4LHWA 4ND1A 4AICA 1G3MA 1BMFA 4RK0A 1RI3A 1IM8A 3DE2X 3KXDA 3A1DA 4QQ8A 1BX1A 3NHJA 1NBWB 3LLMA 3MOIA 3QLJA 3QG1A 5EQDA 2PANA 3ILSA 5IT5A 4U6QA 1PR1A 1L7OA 2QTFA 1T3TA 2GZ3A 5DULA 1GRQA 5HEKA 3FJ1A 3MK31 3S68A 3DCYA 3VMFA 2AUTA 5IAAA 4BVEA 1E2JA 4CODB 1XU4A 3N8DA 1GNPA 1YS4A 1VDMA 2GAJA 2WDZA 3FRHA 3HU1A 3PNSA 1E2DA 1NN1A 2I7XA 3R3ZA 5FAKA 5LD2B 4JVOA 3EBOA 4KODA 1PZNA 4KK3A 5TPZA 2KSQA 4BNUA 1FFXB 4FQ5A 4CCAA 4UOEA 1FDTA 1CJTC 5AJHA 3UHPA 4XYMA 1G1AA 1I6KA 2KS6A 2MU1A 3MSXA 4BGUA 4Z4FA 3ORSA 5DDIP 5LWHA 4L3VA 1EDZA 2WU0A 3LFUA 4DIFA 2J32A 2ZSHA 4BFLA 3NATA 3VZBA 4ENSA 3FFXA 3OHSX 2EDCA 4DWWA 2ES4A 2JFQA 1CYEA 3BK7A 1U0FA 3SC3A 4WKNA 3F47A 3H16A 1YUMA 3B8EA 4ZK2A 2I65A 1AV7A 2PJRA 2DWQA 1C1XA 2V3WA 3AMVA 4ZYWA 3IP1A 1E9DA 3LGXA 1YR1A 2AWNA 3L49A 2PZBA 4NBWA 4BWFB 3ITEA 1IXYA 4RK4A 3F6YA 1PR6A 5EGNA 3G2MA 3A6JA 2JZOA 4ZCTA 2YWBA 3W8FA 4B6GA 4ZOLF 4DCSA 1RAHA 3KJZA 2D1RA 1YA8A 4RGBA 1QORA 1AXGA 1MQSA 3GO4A 4J7UA 5KNDD 4WFIA 3JR3A 2R6FA 4PONA 1GN8A 1N7GA 3K6SB 3GJ7A 3GOQA 5DYTA 3SZRA 1XYVA 3WNBA 1TCAA 4GT1A 5TC4A 3BFVA 1YDGA 1CERA 3A1SA 4FT2A 4JBGA 3R3HA 1WMEA 4MXDA 4QXMA 4RSMA 3HXKA 3I58A 2UVDA 4X8HA 4F6RA 4KN9S 2XKJE 2RH9B 4MQ6A 3NHRA 4OFZA 1KJJA 3AR4A 3UK0A 3ZWNA 5HSGA 4F1WA 1ID8A 1XCMA 3GR6A 4HFJA 4OJNA 4O3MA 4EYEA 4GSKA 4BXOB 1I24A 1AZWA 3OZGA 4LGYA 4ZQHA 3UJ7A 4GXQA 3AP1A 4RXMA 3K0EA 3OPYI 2OZEA 5JS1A 4O4LF 1HOXA 4L4RA 4N39A 1LXCA 4QOHA 3C5HA 4E07A 4UU0A 3HUEA 2CXSA 3ESXA 2WUFA 2R79A 3EDRA 3KZXA 4YN3A 5TEWA 3NKVA 4JJ8A 4N18A 3V80A 4B8WA 5BV2P 3SF0A 4YECA 5JC8A 1TLFA 2HQRA 2OPBA 3BD6A 4TYQA 3AKZA 3TLXA 1QZTA 2G09A 3QBVA 4ZKDA 3G23A 1OT5A 3W5CA 1OFGA 3RSCA 1A69A 1A9QA 4M0MA 1SM4A 3HZRA 2Y67A 3MCVA 1XHEA 5JALA 3K71B 3B8HA 1GTRA 1DBIA 3VNRA 1BFUA 1UMCA 2AFHB 4IZIA 4YRTA 4JEMA 3GVHA 5JSFA 1YCDA 4GE3A 1ZGGA 3IMCA 4MINA 4FEEA 2CYAA 3UH0A 3Q7PA 4P80A 5I8WA 2BI7A 2ZGVA 5ITZA 5C8YA 5B4UA 1E7QA 1YHNA 1WDLA 1L3CA 3JWPA 3MUFA 4MCHA 3SI7A 3I30X 1SWWA 5CM9C 2J41A 3V1TC 4A27A 4ZQFA 4DA7A 4HTAA 2PFKA 2EJTA 2KI5A 3BE5A 1QH9A 3I0MA 4O5AA 2NSHA 3TB6A 3NQ41 2RGUA 4ARZA 4PF1A 4ARUA 4M2LA 5FL7D 2B92A 1XQ6A 4TV8A 3RWBA 1LPBB 5AFSA 3I4FA 1RACA 2C9CA 2CHUA 3KM0A 1L5OA 2IDJA 1Y34E 4KFUA 3O8BA 3AFOA 2WU3A 5L3SA 1Q84A 3VDRA 5DXFA 2GOYA 2HDHA 2Y3IA 3E22B 3V4FA 2DHQA 3PHGA 3ZJ4A 3OFVA 4I3GA 1T35A 3MTDA 3QLVC 3RS3A 4LF7B 1C7FA 2YYSA 3HJCA 3QY0A 1Z83A 4FFLA 1KIAA 4W99A 2PBRA 1D3AA 2OHVA 3FSGA 4REQA 3FPEA 2OGSA 1FA9A 2ARKA 4MGIR 3MLAA 4I4TA 2HKIA 4L5BA 5JLAA 3DQQA 2VJKA 3PGKA 2UV8A 3PXXA 2G7MC 1WEHA 3MWDB 4PFKA 4R01A 4EOGA 3FSRA 4JOQA 1WUJS 3KVYA 1M7HA 1RCTE 2HJ9A 3ZDYB 4RMJA 4MGZR 3RARA 4YROA 4Z99A 4CV1A 4NS1A 4UKDA 1T5DX 4LXXA 1FQJA 3UXMA 2FN8A 3H2JA 3HB1A 5ITVA 3A27A 3WLAA 3RAJA 1W7AA 1OFTA 1NQXA 1GR1A 3IODA 4JP5A 1QYXA 3ZZUA 5EXEA 2CSXA 3IIIA 5JVDB 4ER6A 1LZKA 3DHEA 4M21A 3OZBA 3WRYC 4KXYA 3I53A 3H7IA 5I9SA 1VJ1A 4YJFA 3U4AA 5L45A 2YUIA 5KOYA 1AURA 1OTYA 1FLAA 3QU5A 1N1DA 1SXGA 4CKWB 1K88A 1NW5A 4Q3OA 3HUUA 1KVTA 5DYYA 5E1BA 4ZHQB 3WGVA 2J3DA 1RI5A 3RADC 1KARA 1SK8A 1RZUA 3M2PA 4TSFD 1W44A 1Z4IA 2BGNA 2IPOA 1A9PA 2Q62A 3EH2A 1HTBA 1P6QA 4E6PA 1PK8A 2YDYA 1ELOA 1HE8B 3DF7A 4DUYB 4EG8A 3UXYA 3LTNC 1SKQA 1KJYA 4L07A 2FSPA 3SQMA 1U8AA 1E77A 1JZQA 4FX5A 3H8JA 3G2JA 4YT5A 3WV5A 3ZVKA 4GBMA 2CBGA 2JFXA 3DOCA 2O2JA 1ZMTA 1D0VA 1SVLA 1T6XA 2QLLA 4EPYA 3CLUD 3CVJA 1NBOA 4Z8XA 3VR5A 4XD7D 1V1RA 1Q0TA 1NPDA 5CBPA 4RCYA 1NBIA 3VPHA 4QBFA 3AERB 3ENQA 5FPSA 2CHQA 4OJMX 1JVNA 3WJ1A 3H84A 1G3IA 1ZJYA 3K0FB 1R16A 4NI5A 1Y6RA 3IVMA 4IHJF 1LGYA 2QAGA 2EFCB 4C0KA 1S2MA 4LDNA 1V5EA 1H6AA 2P2CA 4MAMA 4KSBA 4YRBA 4BZPA 1P1KA 4ZARA 3CB2A 3DUWA 4QXRA 3I5AA 4MYHA 2CC2A 4B40A 3VZQA 3OLVA 2HADA 3NBFA 1PZEA 1XZKA 2I55A 3B53X 3E1GA 3FNRA 4DJTA 1VPWA 1KDVA 3U26A 2P8JA 1H8EA 1OH5A 1Z5OA 1U7ZA 3FUXA 3JQAA 3B3GA 4LJ5A 5K2OA 1Y81A 4C0AC 2A88A 4HWRA 3OOHA 3DEYX 3R5XA 4MWTA 4KXFB 3UUGA 2JGRA 3QSGA 4RTMA 1Y1SA 5AW9A 2DFNA 1PJ3A 1DQRA 2Y0PA 2IPNA 5SYAA 4BU0A 1Y7TA 3I9LA 4X64B 4IBOA 2Q3BA 5IBQA 4A8JA 4EQ6A 2CDRA 4FB4A 3JVIA 1SOMA 4D99A 5EXPA 1JE1A 4S1PA 1U0GA 3M8KA 4BJHB 2G25A 3CE9A 2J45A 3SIRA 2DLDA 2DU8A 3CUUA 3P5BA 4N0QA 4A2PA 3FDZA 1N6NA 3QVMA 2YYYA 4D8TA 2I76A 1SBTA 3WBJA 4KXMA 3AUAA 3HJTA 5JH7F 4NU0A 3AILA 4GZLA 3A9SA 4KE6A 1TLLA 2GBIA 1FCJA 2YQZA 3C8ZA 4JJFA 1XRJA 4GX0A 4REOA 2NUAA 2QENA 1O03A 3TX6A 1ODSA 2Y1DA 1M2EA 2HJSA 1J07A 3MMSA 1T4GA 4JITA 2E5LB 1A4RA 2QG9A 1P0IA 2YHBA 1L9KA 1JIQA 2Z4TA 1YQGA 1HG0A 3AY3A 3M5CA 4B87A 1LW6E 4B46A 2GMWA 1Q77A 3A6DA 3DVLA 4GS5A 1THGA 4V02A 1GGNA 1Z2OX 2DULA 5I9BA 4L8YA 5KNDA 4F2WA 1L8AA 4I6GA 5CLFA 5IN4A 3PFBA 1MQAA 4H3SA 3UQYS 3FOFC 1ZVQA 4WCFC 1R0XA 3S6JA 1R5OA 3K16A 1Z82A 5FTNA 5ALGA 1PJ4A 4GP7A 4PFSA 5CRIA 3BWXA 4G63A 3ZE8A 2P9EA 1BCRB 5JECA 1XMQB 1SOAA 1UP7A 5JOQA 4I5FA 5DGDA 3CWCA 3GD7A 4KXQA 3N87A 3EZXA 2PLNA 3SJCA 2NP7A 3Q1KA 1P61B 3JAMA 1Q3TA 1RYHA 3A0UA 1EGVB 5CVDA 4M8IA 4MWSA 3RASA 1ZUNB 2AA3A 4H1TA 4LMRA 2A7XA 2WTUA 4IR7A 1ZI6A 4BNMA 2G8LA 3ETDA 3O3NB 2FZ5A 4XLTA 4DIDA 4DQ0A 5B4TA 1Z9BA 1JECA 1ENZA 2GF0A 3EE6A 5EYPA 1J8VA 1AQLA 4TLEA 3ETLA 4Y8VA 2G71A 4C06A 5F7JA 2FKNA 3HKDA 2V7QD 4F3RA 3ZYCA 5ALUA 1DC6A 2GN4A 4G26A 1NNI1 2AW5A 2VWHA 3QKUA 1U99A 4MWOA 4B17A 1UBNA 2ZJ5A 4FZ3A 1PZFA 2GAOA 2W4QA 1JEDA 1KEWA 2YZ7A 5FUQA 2Q27A 4TTJA 3QXCA 3SAJA 2Z08A 2IEBA 2O1SA 3CF6R 4DDHA 1ZFNA 1GQFA 4OGFA 4HSGA 3AF4A 3M3DA 4E5UA 2V0CA 2I71A 3LA6A 1I9CA 4YGYA 4DBLC 2LDXA 2Q5IA 5KOJA 2LCIA 3WGGA 1DEAA 3EVNA 1HZZC 3IHTA 1IBSA 1U9CA 3TOVA 2X0FA 4MKIA 4I55A 5DI3B 2X1LA 4HH3C 3QXSA 4CGZA 1VLQA 5H81A 2NV2B 5CYPA 3OE5A 2FF5A 1NQVA 1Z0IA 5FTJA 1JQEA 1PL7A 4JB8A 4PLCA 1I4OA 1P4GA 4E13A 2CZGA 1BCSB 2BFPA 3CUSA 2FDXA 5FL7A 3RC1A 5A04A 3B6ZA 3PR3A 3KL4A 4U7FA 2BONA 1JG1A 1U0TA 3PUXA 4BGEA 1JWAB 1EFDN 1FDIA 3QX8A 2YICA 1L4NA 3NJRA 4CLXA 3RRNA 1QRRA 4KK4A 4OQNA 1QTIA 4AM8A 3W3AH 1IZ7A 3CLTC 3NC0C 5IJZA 3CQ9A 4X5OA 2FRXA 5AOAA 1ZGCA 1R6TA 2R86A 3AUJB 4BLPA 2XZPA 1PO7A 4FGUA 4R81A 3TFQA 3TQOA 1M9NA 1T5SA 5EZYB 1J9GA 1L5ZA 3IT3A 3EGDB 3NONA 4B44A 2V1UA 4JUIA 3S99A 4CU5A 3QVKA 3NVAA 1M34E 1NRWA 4GXNA 2P2NA 1UM9A 2RC5A 3LGSA 1R4ZA 4XLLA 4BQNA 4HQNA 4L7VA 1KP2A 1K8XB 2GN1A 4U39A 3M70A 1WAMA 2FWPA 4KV7A 4EX7A 3QKTA 1MOZA 3G8DA 1PYOA 5CT9A 3KUUA 2N42A 3CS3A 3UK2A 5KSOA 2J09A 4HDNB 3R5TA 1FFAA 1H23A 3UMRA 5BWMA 5ALZA 1PHPA 3WE7A 5JSUA 4A8PA 1RNLA 2V0NA 2MINA 2QI9C 4S1OA 5J2TF 5DNYB 1UK7A 4MUFA 4RJIA 3RIXA 1YRWA 3WNCA 2N47A 4FUQA 4BVHA 5JMTA 3G8YA 3PUKA 3MWFA 4GBGA 5ILQA 6REQB 3L9XA 4M9UA 4PZDA 4C04A 2PUCA 2DPMA 3UHOA 1WQ1R 2A5DA 3QUSA 4FDVA 2ORIA 2ACKA 4E30A 4IO1A 4XIYA 2X5JO 1W5BA 2XUKA 3C45A 4LOKA 3LPAA 2C97A 5IJAA 2Q2VA 3SXJA 3DDUA 3COJA 4DREA 1DEXA 3LP5A 3C3PA 3F6SA 1F2TA 2XDQA 1ZVMA 1GAWA 1LEHA 3IX7A 2JARA 2RI1A 4PZYA 3A1TA 4UD6A 3UMCA 1CUSA 1ZMOA 3R41A 4O4JB 5EIXA 1M7GA 4LQ4A 4YUXA 4FMPA 2GFHA 1ZH2A 4TSFA 5FBWB 1W0JA 3BB3A 3RIEA 4FHFA 4CQLA 3L0BA 4INZA 3CT6A 2P1DA 2IZ7A 1Q21A 2ZRPA 3RRJA 2Z95A 5LZ5A 1JHZA 3WDLA 1IONA 5ERYA 1W4CA 3L0DA 5BYJA 2AOUB 5HE8A 1MJHA 3RAGA 2IHTA 2AMYA 2ZI3A 4Y6PA 5IBPA 1QP8A 3PIIA 4WEOA 1QF9A 3DP7A 4E5VA 1QBKC 4BYGA 3HBMA 3LKBA 4XD2A 4L4SA 1XU9A 3T54A 2PZEA 3PQEA 5THQA 1DCKA 2P40A 3O5AA 4QPCA 1I1HA 2YWGA 4GQIA 2GFIA 4XD7A 4DM7A 1JG7A 3E5RA 4EPTA 3E7DA 3I3SR 4QYXA 2R6ZA 2OGWA 3DWIA 4JC4A 1ULHA 4C4ZA 4ESOA 4YP6A 2P27A 2OG2A 1XP5A 4M9ZA 2IZOA 3AHFA 2B98A 4KOAA 4Q4LA 3MPUA 2RGEA 4Z3KA 5BY2A 2BKAA 1TVCA 2A4KA 2NXNA 3F9CA 2OHXA 3FFTA 2PSJA 2VP2A 3FD8A 3F98A 1J00A 1PW7A 3JZMA 1O2DA 1X7ZA 3KJGA 3OA0A 5KQLA 3BGVA 2G1PA 4BUZA 3BQNB 4YRKA 3HUTA 2QN3A 1YQDA 1KVRA 1BS1A 1XTQA 4RPGA 5A2QA 1TK3A 1PQYA 3A06A 1P2UA 2GUWA 1X14A 1C29B 3DMYA 3JD0A 3KNZA 4UEQA 4E51A 3TGPA 5LYJF 2UZ4A 1GA4A 2YN2A 2VJQA 3KYCA 3HS3A 5IAOA 5KCZA 4FEGA 5KYXA 3DD5A 4LXUA 2OCIA 3T9CA 1QIGA 2QQGA 1ZJ6A 1H66A 4HAVA 4QSHA 5REQB 3LSTA 5KYYB 1FNMA 4J0KA 5KJFA 1A8QA 2HLHA 3L5KA 3FPLA 1DI0A 1VMEA 2I29A 3OO1A 2A0YA 5JTTA 2I3AA 2HMUA 1JFLA 1NYRA 4OO3A 4RESA 1MC4A 2H4ZA 2IYVA 3REOA 3T52A 5FHQA 4M83A 2GYYA 1HH4A 2AMJA 3PITA 1H9CA 1FUIA 2E4XA 3M9WA 3K1TA 1S5PA 4OHMA 4WZBE 3LNTA 4WBXC 1CQXA 1P4RA 1VJRA 2Y93A 2X5XA 2ERCA 5C7IO 4XUDA 3JSXA 1BMTA 2XRZA 2HGSA 3SWWA 3AL0C 1P4AA 2WP8J 3B36A 2NNLD 3NU1A 3QELA 4WNIA 1TQ6A 3P4YA 3TL6A 3LHSA 3ZI0A 1CS0A 1JSCA 2Q4DA 3KUDA 4GZ3A 2FTKE 5CVCA 3RREA 4DJ5X 3I2FA 2VLBA 3ICEA 5AMXA 1UJ5A 1YIDA 3MXTA 1WPQA 4MQFA 3E9QA 5CDUA 4NBUA 1I4EB 1JLRA 3L7AA 4KNWA 1S3FA 2CCJA 4IH1A 5FWXA 2D4AA 2B1IA 5CX1B 1V37A 3W8NA 1MRZA 4X1KA 4ZOLA 3DULA 3L8YA 1GZDA 1DE0A 1O6ZA 1PKXA 1J2TA 3DV0A 3CRVA 4WN9A 5EKTA 1E2GA 3WWDA 1WD5A 4BGVA 5KNCH 5J4KA 4DQXA 4ZOQI 2O8EB 1X8XA 1DXYA 3HYSA 4HNRA 1KE1A 3UUWA 1X70A 5JFOA 2GYWA 4X3OA 4C7KA 3FIUA 4FGZA 3M81A 4LAFA 4PICA 1OKKD 1VE6A 1EDDA 4BNLA 3BMXA 3TPFA 2HOQA 4V0ME 4BV2A 4OLBA 1X15A 2YHSA 1DLIA 3R0VA 4A2WA 1B15A 4DA0A 2R8XA 1LQUA 2JGKA 1JG6A 1MPTA 3EF3A 1EFRD 3HY6A 4WESB 4MV3A 1C8VB 2EGUA 2IYFA 3RBZA 3NOOA 4O4LA 3KTOA 1RPAA 1QU2A 2VP3A 2IF0A 4HS9A 1TO2E 2F3PA 4FHZA 4YO7A 3H2GA 5TVKA 3RYHA 4ID3A 4AUNA 3DE0X 2D5IA 5F1OA 1VE5A 2DUWA 3KHSA 1R8JA 4QGFA 5KEIA 4BP3A 3UPTA 4D4LA 2W2PA 3PF8A 2V7QA 4NH0A 2FEXA 2C9DA 2H2DA 4MR8A 3HA5A 1FJHA 3N2GB 4RM2A 4ND5A 1DSSG 4PG7A 1N34B 1EFAA 2XYGA 2IXFA 3GDHA 2XXJA 5DX0A 3PHCA 1X80B 2ORWA 3G8CA 4KX3A 5ES4B 1WU8A 1UC4B 3AP2A 4ZMBA 4ENWA 4PSVA 1UOPA 5CNJA 1MGPA 3GUHA 3FBWA 1DAEA 1Y6QA 2WKWA 3MLBA 4MYSA 3OLQA 4GMFA 2LVBA 2Q5JA 4R6WA 2YY5A 3IA2A 5ENVA 1KL7A 1OIWA 2CF5A 1M76A 2YVKA 3ZWVA 4BTVA 3DOFA 1KK0A 3M7IA 2OWDA 2AEFA 4XGNA 1QYCA 2B1QA 1UBMS 2FR0A 1WPRA 1X38A 4DLRA 3ZKWA 5T4BA 5BNTA 5C81A 1J24A 4FS8A 2X15A 3EXHC 1SH7A 4U7WA 2Z6AA 3ICWA 3BMQA 4MW2A 3I0ZA 3NT5A 2O5RA 2II6A 4QTYA 1XZLA 1S2GA 5KSZA 4HZUA 5IVHA 4M53A 4QGGA 4Z2YA 3V6LA 4KP7A 5EKUA 5CNMA 1FDRA 1Z2DA 5LMZA 2OWEA 1NLYA 1V71A 1P75A 4EJSA 5DNUA 4GPBA 3U3RA 3WQBA 3EAFA 2ON6A 3W2TA 5JJKA 2IXDA 1MAVA 5T4EA 1USGA 3ZDXB 4CNQA 1Y5RA 4F4JA 1DTSA 2BFNA 4YB8A 1CZNA 1BG6A 3BDAA 4OPMA 3WFIA 2IP4A 4NBKA 4BO5A 4HDRB 1H2AS 4E4TA 2FPKA 3G2HA 1GNRA 4B3CA 3IKMB 2P5TB 1NXOA 1DMSA 2ZRAA 3FFWA 3MOSA 1T2NA 3P0IA 5FBLB 5KKAA 4CMJA 4HVLA 5K6AA 4NEGA 1FVFA 3ZGNA 4HDSA 1ZHHA 2IY7A 2VUIB 3RUHA 1QFZA 3KT3A 4MUKA 5SICE 3W2FA 4B3HA 2C95A 5JNSA 3E61A 4Y2JA 3UGQA 2L18A 2G9NA 4ZYLA 1MORA 3E9NA 2ZOSA 3OZSA 2FB9A 3W2GA 1ZBDA 3CH7A 2I62A 1Z4LA 5EPEA 4UCFA 5FJIA 3SEQA 1AQJA 2DLCX 3K2BA 3ND6A 2IOQA 2P3OA 4PC7A 4QELA 4RWZA 7GPBA 2Q0SA 1T5IA 1QH8B 3BFXA 3L4BA 4LHXA 3GIDA 1NY5A 1NMEA 3PQ6A 3BGSA 2XV1A 2B6NA 2HU5A 4LC1A 3TQFA 4IL5A 5TS2A 1XAHA 1G2IA 1QIEA 4OGKA 3PEUA 1XDUA 5E0OA 1QRAA 3NHSA 3KLNA 4QOGA 4CM8B 3BRCA 1U98A 1KQOA 3SF8A 4JSRA 4TT3D 2ENUA 5AO9A 3HFRA 2OUIA 2NSYA 3LPDA 4ZV7A 3V7NA 1JMKC 2AMLA 2H54A 1CS4C 2GETA 3ZE0B 3IP6A 3N70A 3TRDA 2WJWA 5ES3A 5LXTB 2GRJA 3Q7RA 3TIXB 4DPLA 3KEMA 2AJTA 1XFAA 1G8KA 2IPLA 3IOBA 4NABA 3ZPXA 2BKVA 3FNQA 3W7BA 4HH4A 2A84A 1HLGA 1W8DA 2EQBA 3A3KA 1YKSA 2JEYA 4MYCA 5KYNA 1PFUA 4W8HA 3G5LA 1A9YA 2Z2KA 2ZS7A 2QLFA 4RQBA 1R9GA 4LN1A 1G8JA 1T3LA 1THMA 5HRCA 3OZRA 1UBRS 1CV2A 1Z3IX 3R3JA 4EW3A 1ZNYA 2QQ0A 3ESAA 4QJBA 4KKVA 4XSGA 5A6SB 2X4GA 3WZ2A 4I7EA 4AJJA 2PRIA 2NUTA 3RYIB 4AU1A 5K03A 4TMTA 2XKKA 5MGNA 2NTNA 4WZAA 3TI9A 1H22A 3Q8XB 1VIYA 4A6DA 3NP7A 5EXDA 5GONF 2MWMA 3NFRA 3EGXA 5KJCA 4GSLA 5AM3A 4UQLA 1H6BA 4N3CA 4E09A 2DUNA 2NQ8A 3ZHZA 4UM7A 1YZLA 3DAFA 1E2NA 1AD2A 5LIPA 1KI1A 4TVSA 4P0QB 3BBLA 3ZQKA 2J3IA 4FR2A 3E7FA 3NBZC 4LY6A 1OX5A 5F4BA 2RJNA 4G0XA 1ACLA 3ASUA 2QAGC 3DZGA 4ER3A 3U4QA 5ADVA 1R18A 3H42B 4U00A 5AJZA 3UJCA 2HHJA 1MLDA 3ACBA 3L7YA 2BFEA 3SCZA 4DTCA 3U3OA 1MEEA 3VI4B 1K75A 3B1FA 1D04A 9ATCA 4C4AA 3TK1A 5BXYA 4F4FA 2WKPA 3BH0A 3W5SA 1F2DA 4WKCA 5I7UA 3ZZNA 1Z7YA 2B36A 3N05A 4YJGB 2GSDA 4F6LA 1C50A 421PA 3H7AA 3PQ8A 5HJEA 1T1SA 5L4LA 4ZWNA 3QUTA 4ZZ1A 3OUTA 4RQTA 5JNTA 1DBRA 5HFNA 3G82C 2RGBA 3NBYC 3NT2A 4QGBA 4YCNA 5HKAA 3O3CA 3G0DA 1VL6A 3WP1B 2J0QA 2ZT8A 2C42A 2Y9PB 4Y67A 5E7QA 5JH7A 1T9HA 1YO6A 3MUEA 4WY2A 4DV2B 4A8JC 2Q5QA 3OJCA 3ML1A 2BHRA 4LJSA 4YI3A 1X74A 2GZSA 2RB5A 5DJ5A 4ZK6A 1Z4QA 1A8IA 4EMTA 3U17A 1RRMA 3EAQA 4J43A 4X66B 1V48A 4FZVA 3M6VA 4LUCA 2FJ0A 1R15A 2ZS8A 1W30A 3Q88A 5MF6A 3SHVA 4QYMA 2W00A 4PFQA 1J8FA 5JD5A 2ECFA 5FUMA 5EUCA 4MDHA 2QL9A 3RF7A 3SM3A 3P9RA 4H15A 4YCMA 5DGTA 1VLMA 2PRYA 4UBMA 1KH1A 2QTWB 1H6DA 5D5QA 4N8EA 1ODFA 3CBQA 3QVGB 3E9EA 3HACA 1EUCA 2C82A 1U8EA 5CU7A 3REGA 5CVUA 5ALFA 5FXMA 3LZ6A 1J39A 1KI4A 5LM3A 3CEMA 3EIEA 5E4FA 4RKRA 4WOKA 5KKCA 5EHZA 3DBIA 2C7BA 3F1LA 3D3WA 4LGCA 4CPDA 3DONA 3JPYA 4IMJB 2IYZA 2VEDA 4BAGA 4BMYA 3SR4A 1D7AA 1MAAA 1OD6A 3JQ7A 1CQPA 2CUNA 5E3IA 2JGDA 4AWXA 2VAPA 1M54A 4LQDA 1BA2A 1XKLA 3RQSA 1IULA 4DRYA 5L95A 1N3IA 1L5HA 3RTDA 1IJKA 1CUWA 1ZAKA 1TMKA 4EPXA 1E5TA 2FWJA 1SZJG 1XPOA 5C35A 1T3ZA 3NIGB 3ITDA 3S5UA 1WBJB 1IK4A 4NZPA 1FPQA 2Y68A 1LH0A 2O3SA 3DG9A 1JKIA 1JDBB 5FNVF 5B64A 2O14A 1A1SA 1G21B 1QK5A 3H83A 3EVEA 1AGXA 4BASA 3QEJA 3QEOA 2PU5A 3R20A 3MNFA 4KJZA 4HVCA 3ILVA 2R60A 3JSAA 1WCYA 2ZRHA 4MR9B 5DBFA 4CDMA 4BFWA 3KQPA 4F4UA 3VKHA 3BGDA 4X8OA 4OJQA 3BULA 2D7DA 2FQXA 3KPJA 2EZUA 3PPIA 4JJGA 4C0BA 4F56A 3I4CA 1E6KA 1P2SA 4B79A 5JMOA 3I5XA 4KR3A 4BNTA 5A4MS 1S2IA 3AM3A 3LOQA 2DR3A 3HC7A 1PEKE 2IOFK 4KH1A 3NALA 4KVFA 1E1DA 1SUEA 2HBZA 1EEHA 2FPPA 4CKBA 1T9BA 2YV2A 4AZSA 3UCEA 4L8VA 5JUWA 3D1VA 5CEJA 3C3CA 2AGVA 3V8VA 4OHVA 4JP1A 3H04A 1YA4A 3BIJA 4ADSG 4G56A 4N41A 3Q7EA 4FI3C 4O29A 3T7EA 4BMVA 2G70A 4P31A 3MWYW 5HVNA 1SKBA 1S0UA 3WGMA 4LISA 5GJWC 3UKJA 1T8SA 4JSYA 2NP6A 1KMHB 1K97A 2KM1A 3MJSA 2ASEA 1FUUA 3L2OB 4RLHA 1QG4A 5DCYA 3A4VA 2A9KA 4YWJA 3RFFA 4DCGA 2G7ZA 3AVUA 4YO8A 3UAVA 2OAQ1 2VYCA 5BRNA 2CL7X 3MT8A 1DJNA 4B8ZA 1PK7A 2BT4A 1NASA 2EJWA 2Z8YM 1UPAA 4MVJF 1P9RA 3PNBA 2A30A 2EHJA 3TQCA 5CD9A 1O58A 5J2TA 1XMOB 1YOVB 1CIVA 3PE4A 3NNNA 2QJFA 3OETA 3QKRB 4GWKA 4BVLA 5ICCA 1ZD3A 1AB5A 2OSVA 3Q5GA 4CM4B 1SCNE 2OHHA 1YZUA 4CM6A 1B23P 1LX6A 3GYGA 4O5OA 1O8CA 2PXCA 4TT8A 3S2SA 1I2ZA 5DLDA 1EBBA 7ADHA 4PS1A 4WBNF 4ALLA 3PTAA 2HIMA 3Q6NA 4XVRA 1HTWA 1E2LA 1K7CA 2JAOA 3Q12A 4DAOA 3E48A 4ZZ3A 1FVHA 5EQFA 4E1AA 1DC4A 1D4FA 4F9EA 3UGJA 2ECPA 2KYRA 1THZA 1KQPA 1S2LA 5TQ2B 2J9FA 3ZX4A 4EEKA 3QOYA 3ZUGA 2ZUVA 3U40A 1TECE 5IH7A 1YFJA 4OB6A 1ZA1A 4L5JA 1KYWA 2KMLA 2NPIA 5F1YA 3K8OE 1JPVA 5E3JA 3V5NA 5AWFC 1CUBA 4IG9A 2GEBA 4ZJYA 2XCSB 4FM9A 3B6MA 3DE7X 3U5ZB 2RCNA 4KBYA 4HGYA 3RGGA 1WXHA 3D6HA 4RMHA 5EMLA 1O96B 2O4CA 5EHNA 2C9BA 4BNKA 1IFXA 4L0QA 1ZA2A 2EBFX 5BQFA 1GGJA 1PLKA 1TI7A 1LVUA 2JLAA 3ELYA 2FK8A 1YBVA 1T5LA 3UTCA 1LS1A 2R1TB 5F3DA 3USZA 3WDKA 4ZCQA 3BN3A 3HU3A 1J70A 2OD9A 1C7JA 4RX1A 2ZYRA 2UKDA 3LWZA 2LW7A 4X61A 5HZMA 1IBCA 3U4HA 1EIWA 2NVUB 1RAIA 3ASYA 2GZ2A 4YV7A 3H9CA 4WNAB 2F67A 4BMSA 3L6RA 2ALJA 1BGXT 4LOHA 4YMWA 3P97A 5BN5A 4P1ZA 2R6AA 3A7EA 4ZT4A 3S2GA 1N7IA 1SXJB 3H1TA 3LE8A 1A9OA 3B52X