1Y7IA

Structural and biochemical studies identify tobacco sabp2 as a methylsalicylate esterase and further implicate it in plant innate immunity, northeast structural genomics target ar2241
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
258
structure length
258
Chain Sequence
EGKHFVLVHGACHGGWSWYKLKPLLEAAGHKVTALDLAASGTDLRKIEELRTLYDYTLPLMELMESLSADEKVILVGHSLGGMNLGLAMEKYPQKIYAAVFLAAFMPDSVHNSSFVLEQYNERTPAENWLDTQFLPYGSPEEPLTSMFFGPKFLAHKLYQLCSPEDLALASSLVRPSSLFMEDLSKAKYFTDERFGSVKRVYIVCTEDKGIPEEFQRWQIDNIGVTEAIEIKGADHMAMLCEPQKLCASLLEIAHKYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords salicylic acid-binding protein 2
publication title Structural and biochemical studies identify tobacco SABP2 as a methyl salicylate esterase and implicate it in plant innate immunity
pubmed doi rcsb
source organism Nicotiana tabacum
molecule tags Structural genomics, unknown function
total genus 75
structure length 258
sequence length 258
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1y7iA00
4G4IA 1TIBA 3TGLA 1A8UA 1LZLA 1BS9A 2H7YA 3HZOA 4ZGBA 4C4ZA 3D59A 1GGVA 1DTEA 1MU0A 3D2BA 4E15A 1Q0RA 3GROA 4PV7A 4B7ZA 5ISMA 4MEAA 4X85A 1O6GA 5LZ4A 4QDOA 4MEBA 2XUHA 1ZGCA 3FOBA 4E11A 2DCMA 4E46A 1H23A 3LIPA 2VSQA 4ITVA 1THTA 5AIAA 4AB1A 4UBKA 5AH0A 3FYUA 2IITA 2QJRA 4BE9A 2VJBA 2JEYA 1XZDA 3WKAA 1AUOA 4MJ3A 3DOIA 2J3DA 3H2JA 3BF7A 2XT0A 3E4DA 1ODTC 5JZBA 4Y2QA 3ANSA 2XQJA 4DMKA 1EH5A 1ZICA 3QPCA 1EDBA 2OQVA 1EK2A 4Y2SA 2HU7A 5FDFA 5FV4A 4BB0A 1FFCA 1IUOA 3V1MA 2XUJA 1J1IA 2FUKA 1CIJA 4UBLA 5ALFA 2FX5A 5CT9A 3JYHA 2HU5A 2JGEA 1DINA 2JGJA 4BRSA 5K3FB 4ZI5A 1MX5A 3IUJA 2AJDA 1U8EA 1AQLA 5BOVA 2J4CA 1I6WA 2BUCA 4W9RA 1GQSA 1CUEA 5AK4A 3B3QA 2XUKA 2ZJ6A 2UZ0A 1XLWA 1P0QA 2ZJFA 3OC0A 5HK8A 3ICWA 4LHEA 3O9VA 2WFLB 4OPMA 5DYYA 3VISA 2Z8ZA 1EINA 3AZOA 1XZMA 5JIBA 5IVHA 1ZJ5A 3IDAA 3WJ1A 5ALIA 4FDMA 4UBIA 4FLFA 3N2ZB 3BXPA 5AM5A 5JAHA 3HLKA 1YS1X 2PX6A 4X00A 5JADA 3A2MA 5H3HA 3EQ8A 3DYIA 4CG1A 3OTQA 4OSEA 2WJ6A 4OD0A 1PJAA 5AICA 5LYYA 5ALEA 3QITA 1JU4A 5AP9A 3QMMA 4M0EA 2PU7A 3G9XA 1R50A 2GBCA 1EDEA 1CUJA 1WPRA 4NVRA 1RWQA 5AOBA 4ZXFA 5ALRA 4BVKA 4P9NA 1CUDA 2HM7A 3HYSA 4C4XA 3ZLTA 1C7JA 1XRQA 4N5IX 4WY8A 2QXUA 3JWEA 1T4MA 3A2LA 5AI6A 1JT2A 3PE6A 3I2KA 3I1IA 4FFWA 3Q8WA 5HQ3A 1TQHA 1XLVA 2XE4A 4U2FA 2QR5A 3U1TA 2EDCA 1HDEA 4B82A 1ZD4A 5JYCA 4GEGA 4ZRDA 2E3JA 3PUIA 2OXEA 3ZLVA 3G0GA 4BAUA 1OILA 5AKIA 2JGIA 4FKBA 3E3AA 4FTWA 2ACEA 4BDSA 1LPPA 3I2IA 3H18A 4HS9A 1UK6A 2ONCA 2HRQA 2WHPB 2W6CX 1ZD5A 3P2MA 2JF0A 3R3ZA 2G4LA 1RP1A 2XMBA 3LLCA 3IUQA 2HA7A 2JGKA 3KSRA 1BEEA 1XZJA 4N8DA 1IZ8A 5JZ9A 2DSNA 1BN7A 4GLBA 5AM0A 3JW8A 4MYDA 4CCWA 5EHQA 4OU5A 3DKKA 1MPXA 2Y6UA 2HA3A 2WQZA 2XUGA 5KWJA 1LGYA 4PSCA 4G4GA 4OB8A 2XQIA 4X7BA 5C8XA 2XUQA 4Y2YA 4E14A 5BV7A 5FXMA 5IKXA 3H2IA 3QBJA 4QDTA 3FVTA 2O2IA 4Y2VA 2QOEA 3I6ZA 4Y2JA 3F8SA 4LYDA 4FNGA 1GKKA 1QZ3A 4X6YA 2PUJA 5JD5A 1W1IA 3FNBA 4X90A 4UFOA 4QE3A 2H7XA 4FLEA 5A7HA 4H7FA 5CT4A 5HF6A 2HFKA 4Y2UA 2AXEA 4GI1A 4WFJA 5JD4A 1VXRA 2DHCA 5YASA 5BWCA 5K3FA 4TVKA 4BDTA 5ALVA 3F97A 4YX9A 3WZLA 5I7UA 1SC9A 1EHYA 1GXSA 1ORWA 3FYTA 3AZPA 3IVMA 4IO0A 4DNPA 1J07A 3WL6A 1JMYA 1CQWA 4AMZA 3RLIA 1E8NA 1N8SA 2WFLA 3PFBA 1EX9A 4J0DA 3WYNA 1QIEA 4WDQA 2CB9A 4BCBA 5CH5A 1QTRA 5T4HA 4A16A 2WUFA 1TRHA 3L1HA 2PU5A 1E5TA 2Y6VA 5DLPA 1XRRA 4BBZA 2DR0A 5JAOA 5AI4A 4WCVA 5JASA 5AM1A 3I1YA 4LKOA 1YCDA 2HA2A 4IQ4A 3WWCA 5ALNA 4J7AA 2X8BA 4RGYA 4BC0A 5AK5A 2WG0A 5ESRA 4LXIA 3H0CA 4HXGA 3C70A 2O7VA 3WK5A 4EY7A 3DJYA 2OG1A 5ALWA 1U4NA 3PI6A 3H2HA 3FCXA 3M81A 1UOOA 3DKRA 3R3VA 1W75A 3HEAA 1H2XA 3WL7A 1LPBB 2WU4A 1EI9A 2Z8XA 2XB6A 3W2TA 2OGSA 2XI4A 4EHBA 4A5SA 4GW3A 3G0BA 4YPVA 5FLKA 2DQZA 4V2IA 4J03A 1X2BA 1VA4A 2I03A 4UUQA 1IUNA 1FFEA 4BATA 5ALOA 5CW2A 4BTVA 2WG1A 3QPDA 2XUDA 2HHAA 3BE8A 1EK1A 4G4JA 2VQ6A 4U2BA 1UKAA 3WWDA 3WWPA 1A8SA 2BGNA 2CEKA 3H1BA 4LXGA 4AMYA 3VDXA 3ICVA 4AO7A 4FNMA 3PUHA 2O2GA 3STTA 1QGED 2I3DA 1QE3A 4UBNA 3MGAA 2XUIA 1E3QA 1EDDA 4PF1A 3O4GA 3WLAA 5DJ5A 2P8SA 1JJFA 4I3FA 2HL6A 2PSEA 2EEPA 5K5EA 2QUAA 4G1FA 5ALKA 3VJKA 4B83A 2PSJA 3RK4A 3TJMA 4G9EA 4EBBA 3GA7A 3R41A 4OYLA 4LXHA 1P0MA 4U2DA 2WIDA 5FPQA 3D3NA 1CQZA 1RYYA 2JIDA 1D07A 4RPCA 5HFNA 1SCKA 3O9MA 2YASA 2PVSA 2ZVDA 4H7HA 2PPLA 1G5FA 4JUIA 3MVEA 4BVJA 2QZPA 2WG2A 5K3AA 2WILA 1A88A 2AJCA 5AKYA 2XMDA 1N5MA 5I9IA 2AJBA 1UKCA 5K3DA 4UFPA 3F96A 3M83A 2B4KA 3Q0TA 1ACJA 1BCSA 1UXOA 2C0PA 2GBFA 4MWTA 3HACA 4BVLA 3FCYA 3DLTA 3WK7A 2QUBA 2QXTA 1VZ3A 2VAXA 5CMLA 4ZV7A 5K3CA 1XQXA 2QMQA 4K5QA 3C87A 4GECA 1F0PA 4UHCA 2WKWA 5AKHA 3H2GA 5LZ5A 4EZIA 4BYMA 2D5LA 2ORYA 2VATA 1QIJA 4OCZA 4MXDA 1E8MA 1GKLA 1LPMA 1XQYA 2RONA 1H2WA 2PBLA 2WTNA 3STYA 1JJBA 3F98A 1SFRA 5EHZA 5ALJA 4C88A 1UT6A 3C45A 4ROTA 5DYTA 4Y7DA 5DNUA 1XZHA 2VT6A 4TPKA 1CUCA 4YASA 1R9NA 2PSFA 1YB6A 4MQMA 2QS9A 2XUPA 3GELA 4F0JA 4X94A 2QRUA 5DYWA 1QIMA 1LBTA 3V1LA 3IBTA 4AZ3A 3C5WP 3EF3A 4X93A 4X97A 3T4UA 2B20A 2ZYHA 5FUMA 5ALSA 1MAAA 4OB6A 1G66A 3EQ9A 2FJ0A 3A2NA 1L7AA 2WHQA 3PFCA 4DIUA 1VXOA 3ED1A 4B0PA 3QPAA 4QDZA 2Z5GA 1EA5A 2HU8A 2BUAA 2YYSA 4N8EA 1F6WA 2ZYSA 4MYSA 1MTZA 1QIGA 2BGRA 5A71A 1UZAA 5LZ9A 2OQIA 3E0XA 5E2IA 4UPDA 5CRIA 3HRHA 4HTAA 1UK7A 1JKMA 2PSHA 4FHZA 2RI6A 4QDXA 4TGLA 1KEZA 2CMFA 2XMZA 2BUBA 1R4ZA 5CBKA 5AM2A 3VVLA 2C0QA 2XMRA 5AOCA 1QO7A 3A70A 2NW6A 2B9VA 3IURA 1VLQA 3IIIA 5HFAA 3QM1A 1ORVA 2R8BA 3AIMA 1H2ZA 1HBJA 1R1DA 4C6HA 5HKBA 1VOTA 3WIOA 5FP0A 3HSSA 2HIHA 2GZRA 4W63A 5I8PA 1BEZA 4L9AA 1NX9A 2XLBA 1MO2A 3SX4A 2IIVA 3T52A 1ZGBA 1GPLA 1KU0A 3C8HA 3S2ZA 5HF9A 3I6MA 1YA8A 3U0VA 5ALDA 4CIAA 3R40A 4X3CA 2CJPA 4DGQA 2X76A 2QT9A 4RE5A 3MUOA 4QWMA 2HA0A 4DNQA 1DWOA 3DNMA 5K3EA 3WKEA 5CT5A 4NZZA 1LBSA 5T4BA 5LZ7A 3W9UA 1DT3A 4AN1A 1WB6A 2XQGA 5ALLA 4GWLA 3UUFA 5AKGA 3O0DA 1CVLA 5C7YA 4JH0A 5FKJA 1ZI9A 5ALYA 4DLNA 4UHDA 1CUXA 1DX4A 1IZ7A 1AC5A 1LPOA 5ALXA 3FLEA 3BF8A 1XZCA 3DCNA 4AXBA 1ACLA 3WKBA 4EA6A 4DSZA 4N5HX 4B0OA 5A6VA 4AO6A 1Q84A 1HLGA 3IA2A 5AHXA 4XVCA 1S8OA 4AX4A 2OCKA 3LP5A 1AMNA 5ALPA 3R3XA 3WQHA 1CUIA 1EB8A 4CG3A 1YB7A 1NU6A 1YASA 4QNNA 1J2EA 5E4TA 1DU4A 5FPPA 3WL8A 3GBSA 1Q0ZA 3BDIA 1HPLA 1P0PA 1EXWA 4U2CA 4M0FA 1AGYA 2XUOA 4B9EA 2C4HA 5AK6A 4Y2XA 2VT7A 4X6UA 3HXKA 3G7NA 1AURA 2HRRA 1OXMA 4EY6A 3YASA 4MQLA 2I3ZA 5J3JA 3CXUA 1QO9A 4Y2RA 4PO3X 3STVA 1GQRA 3L1JA 4I4CA 4H7EA 3NOXA 1CV2A 3VVMA 5HF5A 2D0DA 2X5XA 3RARA 1ODCA 3QVMA 1XZGA 4Q3LA 3IUMA 1YSCA 3DOHA 4Y2TA 4AO8A 4OU4A 3C8DA 1F8UA 1BRTA 4UHEA 3IB3A 4IH4A 1CRLA 3DD5A 1C7IA 1ISPA 4DSAA 2GYVA 5EIHA 1VE6A 4W1SA 3VKFA 5CXXA 5A7GA 2O2HA 3CN9A 1HL7A 3QYJA 1IVYA 2B61A 2V96A 4J0GA 4D9JA 5IH7A 3WWEA 3GUUA 4KE9A 4QA9A 2Y1KA 5D3ZA 5AKLA 1PFQA 3AJAA 3BDVA 1FSSA 4YK7A 1XZFA 3ZI7A 5EI5A 1BCRA 1CUGA 1UK8A 3BWXA 3ZWQA 3O95A 4Z49A 1CUWA 5CTAA 2XUAA 1QTIA 2C58A 3G0IA 1BROA 4H7IA 3N0TA 2O7RA 2VEOA 5AI5A 1WM1A 3SWWA 3S8YA 3ZV7A 7YASA 1IMJA 2BKLA 1DWQA 5A7FA 2C5GA 2WHRA 3KOOA 3NWOA 3KWJA 3BIWA 3FYUC 4G5XA 3C6YA 4QZVA 1ODSA 3B5EA 4EY8A 4WFKA 5KBYA 1VE7A 2PSDA 4P93A 4Q05A 5AKXA 4W1PA 1UWCA 4OUKX 1K6EA 2PKYX 2Q0XA 2XMGA 3H1AA 2PL5A 1WHTA 1J06A 2W22A 1XKLA 1DWPA 1VA5A 3FSGD 4KE8A 5AKEA 5AM3A 4AQDA 5SYMA 1ZOIA 4KR0A 1SCQA 4XJVA 5C8ZA 3QZUA 1XFDA 3WA6A 3FLBA 1FJ2A 3VJLA 4NMWA 1K63A 1JU3A 5T4EA 2C7BA 2WIGA 3UMJA 3X3HA 1DQYA 4WFIA 5IVKA 1WOMA 1LNSA 5AI9A 2ACKA 3GFFA 3R3UA 3FSGA 5DNVA 1QJ4A 4X92A 5ALHA 4UHFA 1QFSA 1Z68A 4PNZA 1CUBA 4BAZA 3H04A 3NGMA 3AZQA 2JGMA 5EIAA 2AJLI 4KEAA 3CCBA 5EGNA 4LYEA 1AX9A 1CFJA 4AN0A 4P08A 4JEIA 4DM7A 1USWA 1LPSA 4HAIA 2GYUA 4L72A 4H35A 3FLAA 1SOMA 3PICA 5HKAA 1QFMA 4KAAA 1B41A 1WB5A 1L7RA 2WHPA 2LIPA 5EHXA 1TCCA 5HCUA 3G8YA 4JNCA 3C6BA 3HABA 5AKZA 5JAPA 5IVIA 4AZ0A 2V98A 1N5RA 4BP9A 5CH3A 1UOPA 3WI7A 4C87A 4BZWA 1FFDA 2EDAA 2IX9A 5LKAA 4Q3KA 4S0XA 2CZQA 1EB9A 1H2YA 3G02A 2Y2UA 1BN6A 1W76A 5CT6A 2J3QA 3C6XA 4UBMA 3VJMA 4PSUA 3I2JA 2BJHA 5LIPA 2G63A 2XMQA 3WK4A 4UBOA 4HXFB 5DTJA 1H22A 1JFRA 2OGTA 1CR6A 4JYMA 1TKRA 2RGUA 3RKSA 5FRDA 2OCLA 1ZIYA 5ALGA 4PQEA 5LZ2A 3BIXA 3H2KA 1R9MA 1XRLA 1T2NA 5CH8A 5E4YA 4KYVA 3G0CA 3D7RA 1FFAA 5LKRA 5CT8A 4DNFA 1XQVA 2VAVA 4J0CA 5ALUA 4Q82A 3VXKA 4UFNA 3TRDA 3AFIA 2R11A 2WJ3A 1QIKA 1R3DA 1VKHA 5C8VA 3QMWA 4A23A 4BZZA 5AKKA 4FBMA 3D2AA 3M82A 1LPAB 4EB0A 2WFMA 4ZREA 1W52X 1MT3A 4QDUA 1ZD3A 2XUFA 3IUNA 3FWHA 2WIJA 3F67A 3OURA 2CBGA 4DMCA 4GXNA 3W06A 3ESAA 4KE6A 4HRYA 3GZJA 4J0HA 1AZWA 1TCBA 1ZD2P 1F0NA 3DQZA 3LCRA 3ANTA 3K6KA 4B80A 4HRXA 3HC7A 3W9BA 1K5PA 1CUFA 1ZJ4A 1U65A 3IULA 2VA9A 3HJUA 4OB7A 5A2GA 1E66A 1HKHA 4DNOA 4BTLA 3KD2A 3H19A 1WCYA 1JMKC 1W4LA 1QONA 3ZLUA 4DMHA 1VZ2A 5EFZA 3HI4A 2YH2A 2HADA 2BAGA 4QEKA 4ETWA 2QJWA 2ZJ7A 2WM2A 2HA4A 2VJCA 1ETHA 1GPNA 2OPHA 1MNQA 4W1QA 5KWIA 3OG9A 1ZIXA 3OOSA 1XRMA 1XZLA 2CKMA 3O4JA 4C4YA 2V9ZA 3AIOA 3D4LA 5CURA 2XMSA 1L7QA 4KAJA 3WWOA 2HA6A 3QMVA 3TEJA 4U2GA 4J3JA 2V97A 4WY5A 5LZ8A 3LIIA 3RM3A 3DDUA 3E1GA 4HZGA 3EBLA 4H7KA 4P92A 3V1NA 5AJHA 3QH4A 1N1MA 2FJPA 2DHEA 3FAKA 4FMPA 2OCGA 4DMFA 3I2FA 2BFNA 3STUA 2OGZA 4BCDA 5AI0A 5BWBA 2K2QB 3L1IA 5KREA 4IH1A 4B6GA 2OCIA 1BE0A 4RE6A 3STWA 1E89A 3WIBA 4J0IA 4PW0A 5EHNA 4X95A 4CG2A 3WK6A 3R3WA 2WSLA 2H9YA 4XWGA 2AJ8A 1EVQA 1CUVA 4UHBA 1XROA 2WFZA 4F60A 2ZSHA 1XZEA 4CCYB 4BCCA 3C43A 3KWFA 1MAHA 2ZYIA 4EY4A 2DFPA 4HVTA 3NUZA 1Y37A 4FFVA 3F9CA 1QIIA 4BE4A 4H77A 1O6FA 5D7BA 4PSDA 1XZBA 1DQZA 4WDRA 1X70A 2ROQA 4O08A 3WJ2A 4FWBA 1AKNA 4N8SA 4C01A 2I78A 2VF2A 3C5VA 4IHAA 2WJ4A 4F21A 1P0IA 2WLSA 4X91A 1LLFA 3D2CA 4L3WA 4EY5A 1MX9A 2ZYRA 1YS2X 1LZKA 4UHHA 3O4IA 5HZGA 2DQYA 1CPYA 2WU3A 3AUKA 4NS4A 5T4FA 5A62A 2QVBA 3KDAA 1A8QA 3DL7A 1JI3A 3H17A 3EQ7A 5DTIA 1XKTA 1W6RA 4FLMA 4H7DA 2ZSIA 2OLEA 4IH9A 5JD6A 5AO9A 1THGA 2JGFA 4GDMA 2XLCA 4F5ZA 4X71A 4Y9SA 5AKJA 1NU8A 4GBGA 1OCEA 4CIBA 1XZKA 1YAHA 1G4HA 1Y7HA 3BJRA 3ILSA 5DWDA 3BL8A 1YA4A 4K6KA 5ALMA 4LIPD 4H7JA 2WIFA 4XX1A 2PM8A 4KRXA 1E8DA 1JJIA 2VTVA 4CFSA 3G9TA 1Y7IA 2Y2VA 3WKDA 1QOZA 3R3YA 2DHDA 2H1IA 3MUNA 1G42A 2WUGA 1MJ5A 5JAUA 1Q83A 3AIKA 2WUDA 5AK3A 4GHWA 3OPMA 5K3BA 1U2EA 4ARAA 4C89A 4U2EA 1CUSA 1CUAA 3DEAA 1YR2A 1HQDA 4QLOA 4UBJA 4WJLA 4ZV9A 2OAEA 1QIDA 1EVEA 1WB4A 2VJAA 1KU6A 1A7UA 1ZI6A 4B85A 4KRYA 4ZWNA 2Z3WA 2J4FA 2BCEA 3PF8A 2GBGA 1CLEA 3FYUB 4Q34A 3EIOA 5AI8A 3ZPXA 4QWWA 3ESDA 1XLUA 3R0VA 5C81A 1TK3A 2H7CA 4B81A 3UUEA 5D6OA 2QTBA 3B12A 3DL4A 3G0DA 3I2HA 5HF8A 1WPXA 2ECFA 1K8QA 2GZSA 2RAUA 3V48A 5AIBA 4INZA 1FFBA 1QLWA 4BRZA 2WTMA 2WIKA 4OYYA 4K6HA 1MNAA 4RNCA 2G5PA 2Z3ZA 4I19A 1VJ5A 4FBLA 2JEZA 5E4JA 4H0CA 1XRPA 1M33A 3WA7A 2GBIA 1CUHA 2GYWA 4DTCA 1WHSA 2RHWA 3I2GA 4BP8A 3M3DA 3STXA 4H18A 2JBWA 4Q3OA 1UK9A 4KACA 4HXEB 4W1RA 5ALQA 2G5TA 3DYVA 4JYPA 3W04A 1IUPA 3FBWA 3K9BA 5LP1A 1DX6A 1QIFA 4BAGA 3ESBA 4B9AA 5AM4A 2RIPA 2QM0A 5EIEA 3LS2A 3G9ZA 4CI9A 4G9GA 1CUYA 6YASA 4MWSA 3WK8A 3V1KA 3CN7A 4CCYA 3BJMA 2HFJA 1SCIA 3OM8A 4K6GA 3FVRA 3K2IA 1XRNA 4J0KA 3PF9A 2VJDA 2PUHA 1XQWA 3D0KA 4G8CA 2XQFA 1BU8A 1XZIA 5IVDA 4G8DA 4DYHA 2HDWA 3I28A 3WZMA 5JZSA 3ESCA 5JARA 3WK9A 2RHTA 5DNWA 4B84A 1UOQA 2CUTA 1UFOA 2YXPX 3CCCA 5D3KA 3V9AA 4L0CA 4Q1VA 2XMCA 2JGLA 5SYNA 5AOAA 4K2AA 3WKCA 1LPNA 5FOQA 1TAHA 3AINA 5HK9A 3AILA 2OAGA 4M0MA 3C6ZA 2WUEA 1MN6A 1XZAA 2HA5A 5JANA 4KE7A 1MX1A 1DT5A 4G8BA 3WYDA 4BC1A 1CUUA 3I6YA 2QKYA 2ES4A 3SK0A 4XIIA 4X6XA 3W05A 1PV1A 1ZI8A 5ALZA 4FOLA 5JATA 4KJXA 5LLSA 1GZ7A 5HQ3B 1X2EA 3PDCA 1UKBA 2XDWA 2C5FA 1GPKA 3D5EA 1CEXA 5JALA 4QLAA 4KAFA 4EUSA 1GT6A 5ALTA 3WMRA 3G9UA 3O4HA 1C4XA 1YAJA 3KXPA 3DS8A 3A6ZA 4J0JA 3SC2A 2XQKA 1B6GA 1K4YA 1R88A 1TCAA 3WL5A 1CUZA 1QIHA 5F4ZA 4Y2PA 5CXUA 4ARBA
chains in the Genus database with same CATH superfamily
4RK5A 1HE2A 2IZ1A 4CLEA 1LF0A 2B8WA 2ZAIA 3IEXA 4G4IA 4DUYB 3GUCA 1E9RA 1A8UA 4FKZA 4IIJF 5ECWA 1BS9A 4BO4A 4EI8A 2X8JB 3AK4A 4CLOA 3CVXA 1CW2B 1E18A 3CLUC 3DB2A 4CKXA 2AFIB 3V6MA 1Q0RA 4S04A 5G2OA 5JRZA 3GROA 4LDZA 5DSZA 3TNDA 5CFZA 2PIAA 1BHO1 4YUVA 4MPPA 2NU9B 3X0DA 1QHYA 1R10A 3R6DA 4X66B 2HNKA 1O6GA 4E09A 2NUTB 5CNIA 1TT5B 1VRCA 2IUFA 1JDBB 3PNSA 3PWZA 2X9VA 3K6RA 4LHVA 4LY0A 3LFHA 2WKRA 4PR3A 1N6NA 4GGOA 2E4XA 1NW5A 2GSWA 5EHGA 3TO5A 2JKYA 1UWVA 1NN3A 3RIXA 1YDMA 4OHCA 1Z0SA 1BFDA 1ATIA 3CEAA 2AN5A 3RS0A 3WSTA 1SGWA 1LY1A 1RW4A 2VOEA 4AB1A 2OHVA 3FYUA 4H60A 4BE9A 5JAMA 4MW5A 1JG4A 3B70A 2NTJA 1L7OA 1MJNA 1LX7A 3FROA 4PG8A 4MJ3A 2IV2X 2I99A 2V7TA 5DP1A 1KPIA 2XB2A 5K6AC 1N6IA 2DUNA 2QTTA 3I4CA 1VYVA 4Z7NB 3D7NA 1Y4DE 2FFQA 3E4DA 5JJ5A 5K6TA 4IZHA 4EJSC 1ODTC 1TQ8A 3C3DA 1ZPDA 2YMLA 3ZV4A 1X7XB 2QRQA 3EEQA 3MS7A 4Y2QA 4CMHA 1ZICA 1DC5A 2PR2A 2X5OA 5HX7A 3GZNB 2UVPB 3OZSA 2H08A 4N1AA 3VNSA 1L5FA 1ST3A 5KDOA 1D2GA 2HV8A 2BEWB 4M8LA 1ZNQO 2W71A 3KOZA 3N8IA 3GPLA 1FBNA 1HE3A 5B58T 1E9SA 3VNBA 3N87A 3BZBA 3AUSA 4BNJA 2IYYA 1KWKA 1F2TB 3FETA 8GPBA 3DVQX 4HDMA 2F4NA 1EFPA 2NX2A 4NV0A 1O57A 1AE1A 4Q1CA 1OFUX 2HJ9A 1JLSA 2XUJA 3WDSA 4Q4JA 3T7AA 4DZZA 4JYZA 2C8JA 2FX5A 1FX0A 3LQ1A 3PYLA 4YNBA 2IDMA 1PS9A 1LK5A 2UYYA 3KJEA 4J2TA 2H1OA 3D8UA 2B4TO 4IG4A 5DM70 3BMXA 4U6NA 5A04A 1Z4NA 2HU5A 2ZRHA 1DINA 3F3MA 3Q7IA 5COQA 3LY9A 4WASA 1SD1A 2YW2A 2YIJA 4BRSA 2OBNA 5K3FB 1KSHA 3OBBA 3HN6A 1VGRA 2QX8A 3DOUA 4FYMA 4KQXA 5C5EA 1KEWA 1JXMA 4JCCA 3VHRA 2JH3A 4E33A 5JUWA 1JH9A 2DJ5A 2GM4A 2QRJA 4YY3B 2Q8NA 4ZCQA 3LCMA 4W5NA 3KYBA 1LSUA 5LU8A 1L4HA 2WW8A 4OLAA 2FH5B 2P5TB 3GNLA 4C7XA 3BULA 3JQ7A 1GQSA 4JT8A 3LP6A 2ATXA 5A9TA 2XUKA 3B1YA 3GJ7A 1JTVA 5TMPA 1U7UA 4L9WA 3NAMA 2HUPA 1PQWA 3OZRA 6CHYA 1SIWA 4LVOA 4CEHB 1DV2A 4EA9A 3NJRA 1YI0A 4MQUA 4U02A 4F7DA 4LHEA 1R5BA 3O9VA 2GPJA 2WFLB 4KR3A 2C04A 2OT3B 5K0GA 4N47A 3SC4A 5CA0F 2R1ZA 4WLEA 3THWA 4ZZ0A 5GTDA 3QVVA 5LOVA 2BFPA 2W93A 2Q5LA 4U0KA 1YQXA 5E6RA 1G59A 1CZUA 3HYLA 4N65A 1T1IA 4WZBB 1ZJ5A 1WR8A 2GN6A 1WEKA 3IDAA 2XBMA 3O2JA 3WJ1A 5ALIA 2UUOA 1Z5VA 3R23A 4EITA 5SZIA 1D8TA 5IK2D 3KJXA 2ZK7A 1DP4A 1KA9H 1WKBA 4IJWA 1M5UA 5EVCA 5JAHA 3GJ8A 1NVAA 2PX6A 2BKVA 3KJQA 3MF4A 4IVRA 4JU9A 2FNAA 5ARBA 3SQXA 1C2YA 4M9SA 1PHRA 5JADA 1H85A 4M98A 2PEYA 1T10A 4WPGA 5H3HA 3U3DA 5HDQA 1TTHA 2WSIA 2NYAA 5JY1A 2NYVA 2V0CA 1J5EB 1RAIA 2GD6A 1MA3A 3OE5A 3P0RA 5D00A 3VR6H 1I5OA 2YQ5A 4NJMA 1D6JA 3NG1A 1IQPA 1ZS9A 2PH1A 4KP7A 1QDUA 3KWMA 4OD0A 3ID6C 3F5MA 2AFVA 4MOWA 4JVOA 5BN3B 4LZLA 1T1EA 1KKMA 3R7WA 2I1VB 1QGOA 2VUHB 1O9GA 3SFVA 5IXSA 2OBLA 1G8SA 1U1EA 1OA1A 2M32A 2WTUA 4BJ6A 3BRWD 3KDSE 1QGUA 2C98A 2Q5EA 2QTGA 5BW6B 4EI7A 4HRVA 1SC1A 4PE5B 4XDGA 1SUFA 3AGPA 2X0RA 2Z98A 4BV8A 3FIJA 1R50A 3RTGA 1E3TA 2B8TA 2HBZA 3D4BA 1WPRA 4IFTA 1NLMA 3GA0A 1Q44A 3GJ0A 3K4QA 1E0AA 1E2HA 4FDTA 4MAFA 4QUEA 4EATA 1YJAA 4LFAB 3FOAA 3G13A 1EU1A 2B6HA 1CUDA 4GMDA 4GX2A 1TFUA 4OA8A 4R81A 3UVEA 3ROQA 1B00A 1Z5NA 4OHBA 5CM9C 5CNKA 3RREA 4C4XA 2ZSAA 3FTNA 1A1VA 3VTAA 3QLJA 2RIRA 1C7JA 5L40A 1G6HA 2QXUA 2FXIA 3L9WA 4XA8A 4H27A 5G40A 1J25A 3EPRA 3A2LA 4MP6A 3EVTA 1RKQA 5AI6A 5ARDA 2QD4A 4KDRA 2NO5A 4JUBA 5FT9A 4RZHA 4KITB 5I4IA 1KI6B 1HK7A 1XCBA 1SOUA 3AERB 4TMVA 3ZW9A 1CIVA 3FTEA 3IVXA 4RENA 4QSMA 1IG0A 1Z6TA 2FHPA 2JLQA 4CTKA 1IY8A 4XI9A 2QPAA 3FD8A 3FCSB 4U2FA 5E9AA 2EJUA 4PLWA 3GLHB 4GLFA 2WHYA 1H0HA 3GT3A 2IBMA 1C1XA 2QRZA 3PX2A 1F8FA 1QAOA 1YIDA 4YWHA 3TTTA 1ZD4A 5HJ5A 1VIVA 3ENWA 4PS0A 4ZU6X 5JYCA 4ZRDA 2MIIA 4B2LA 2Z4RA 2W2TA 1HT1E 2E3JA 4A27A 4ND1A 2HTEA 4KXLA 4NZPA 2XUZA 3QVSA 4JBIA 3V5NA 2GETA 4JJ8A 3GXBA 1G7RA 3CUUA 4BQPA 1B16A 2OILA 4DV2B 4GYKA 5GJVC 1OILA 3UUWA 5AKIA 4IEFB 4DC0A 4FTWA 4HAZA 1KNQA 1NHWA 1XL1A 3GLRA 3CX7A 4A8HA 1AN9A 4RIFA 1O3YA 1O95D 1TGYA 3FNRA 4L0QA 3RR2A 1XRJA 1ZD1A 3HP7A 3EA5A 4GX5A 4XX0A 5GINE 2PRJA 4PQRA 2ONCA 3NHPA 4AYTA 2WHPB 1E77A 1P1CA 3RTEA 5KQRA 3OE7A 4RK4A 5A1TA 3NPAA 1YL7A 2CLFB 4E5YA 3KVVA 3ASUA 2FE1A 3LDGA 2RBEA 2G4LA 3LTEA 1RP1A 2XMBA 3R3ZA 4NOLA 5CLQA 4YP1A 4CR8A 5J4KA 3C1UA 5F1KA 3IUQA 3M9LA 1NLYA 1XJ5A 4EPRA 4KMOA 3T06B 3PXBA 4YP5A 1I51A 1BEEA 1I14A 1WSWA 1OLUA 1PS8A 3OQIA 2B3TA 2IHJA 4KN8A 5C1IA 4XWOA 5B1SA 1T9BA 3ZW8A 2DSNA 2PBRA 4GLLA 1OZAA 4GLBA 3FPLA 1T3SA 5H02A 3FTDA 3TSCA 1ND6A 5JVDF 4C0KA 2A92A 1NLZA 3ONDA 1VSBA 3S2YA 3KELA 4QXPA 2QAJA 4R9SA 5H83A 2J5XA 3PWKA 4FU0A 2HCTA 4KQ6A 5IZ4A 1BX1A 2FWIA 2H2WA 1RIIA 2WQZA 2O3QA 5DW3A 2XUGA 4DLTA 3LGAA 4K9OA 1FSGA 4RTQA 4I9UA 1VBKA 2IODA 2BD0A 2CLMB 4XQ9A 5IYZB 1ORRA 3BICA 4Q9HA 5EZYB 5TXGA 4CL3A 1NF2A 1RZRA 5IXYA 1GR0A 3MTQA 2XQIA 3CW2A 3QE3A 3ZHOA 1FLDA 1Y82A 3HU1A 5JSQA 1Y9ZA 4U3JA 3MJEA 4OI4A 4Z3DA 4LDQA 3KKZA 4EFLA 2GA9A 3ZCRA 1FTQA 3IIMA 2R4QA 3JXEA 3RUDA 2B21A 2I1QA 3VH4A 3OZBA 2A0FA 2AF3C 4TX1A 2PUVA 2L82A 1HNZB 2WVHA 3RBXA 4BLQA 4ZPXA 2DY0A 3H2IA 3TIVA 4BMSA 3QBJA 1A8IA 1P2TA 3EXIB 1UAGA 3QVUA 4LDAA 4QDTA 4I9NA 4ZKDA 2D1FA 3RAEC 2B35A 1FF9A 3T7RA 3N2GA 2WNSA 3Q5EA 1E2BA 1TEXA 3OQ1A 4UW9A 3HB1A 2RGYA 3WMEA 4HGRA 1HO3A 4Y2JA 1EHCA 2Q4DA 4LYDA 3REFA 2X0NA 2MSEB 5F51A 1IZZA 1O77A 1T6ZA 2AE1A 2Y4OA 4MQFA 1SWWA 2Z58A 3I8SA 2FWBA 4TTQA 3CH5A 4GZMA 1GQYA 5G0WA 1M8PA 3A05A 1RWMA 2JD2A 4G1MB 4ZJZA 4N0QA 1LV8A 4PONA 3QG5A 3DZBA 5BT9A 2FJUA 5KTNA 4X6YA 4IJQA 3UBMA 3FPHA 9MHTA 3VR0A 1QX4A 2IEBA 3IR5A 2PUBA 3GUHA 3LKDA 1WQ3A 2OZLB 3M3HA 1MRSA 1HZJA 4IIFA 4RH0A 1C4OA 3FA2A 3VFDA 4RWEA 2E1PA 4B76A 1A4UA 1GAJA 3WGVA 4LOIA 3C3JA 4E7OA 5KI6A 3ND8A 5KTRA 1M1XB 2VTEA 3WBBA 2OGWA 4H7FA 3ROFA 1JR3A 2Y77A 4RVNA 1YT5A 2C9DA 2J3MA 3L1VA 4CMIA 2EEZA 3CW9A 4KU4A 1E20A 2IH2A 4AT1A 3ZZ1A 2HI0A 1P7CA 1HLFA 4MIYA 5B57C 4MQEB 1KOGA 4Y2UA 1F2UB 2AXEA 3WLKX 4JQOA 2PZKA 3ZNOA 4TKVA 5L3SB 4HAUA 1G21B 1SXGA 1WF6A 2HX1A 3NDIA 5YASA 5TIIA 4DRZA 1WX1A 4KRGA 2FZLA 2YFKA 2OO5C 4WUVA 5HQTA 5ENDA 4RIIA 2E85A 4PNHA 4UUAA 5IBPA 1AO3A 2VBFA 3N2KB 3P9NA 1Y6FA 1ORWA 1NDHA 3OKCA 3AZPA 4OXNA 2R1TA 2X0IA 3G2QA 1D6SA 3KQVA 4C0LA 2RJ3A 4BE7B 5B30A 4C03A 3ZCXA 1JAHA 3EZGA 3H5OA 1B14A 3AC0A 2Z4SA 3GCWA 4G2NA 4W5TA 1EBBA 3F9IA 4Q4CA 5H3CA 4NCBA 4QAQA 2QTRA 1H5QA 3M4NA 2XXJA 3AB7A 4OJTA 3RLIA 1WETA 1EEXB 4RKRA 4EF5A 1QVWA 2ZTVA 4WAUA 1L8XA 1HG0A 2M9MA 5JJBA 1W73A 1LSSA 4TYMA 5AVVA 1DC4A 1EX9A 1O0SA 1PZNA 1YR1A 2POCA 3S68A 1P5FA 1QIEA 1TL7C 2C4VA 4MS3A 1I9GA 3Q2KA 2CB9A 4YMUA 4BCBA 2FQQA 3AP1A 3BRSA 1L4NA 4ND6A 3UYLA 4JEMA 4BNLA 1EKXA 1NBMD 2PDAA 2WUFA 5D1HA 1O94D 1WUYA 4OQZA 5DGCA 2G28A 1M2VA 1P18A 2NMVA 1NUHA 4H6VA 1ID1A 1DIHA 1WD5A 2J7PA 2PU5A 5DNEA 3WMWA 1EXVA 3BK2A 2C82A 4MGZR 1XRRA 4M0CA 2GXAA 2VHTA 2VR1A 3VR4D 2P9HA 2DR0A 4IV0A 5FFMA 4BBZA 5I7FA 4ZFNA 5JAOA 5HRUA 3QNMA 4FHCA 1FUYB 4WCVA 5JASA 3ETCA 3BMCA 4NQZA 3F2VA 3IRUA 3LQFA 3Q6IA 4F84A 3MOGA 2JIZA 2P67A 1WUHS 1TF5A 1UMKA 1F20A 3EQZA 1T24A 3KS9A 4L4RA 4FFSA 1U7DA 2TYSB 3GLIA 1P4RA 3KHSA 3HN7A 3EG9B 1VHQA 3W1EA 5CDFE 3RBVA 1XP5A 5AK5A 3UM9A 3VM6A 2CXNA 1SPBS 4CKEA 1U8ZA 4ZZIA 3ULKA 1CKEA 1JI0A 2ZXEA 4JBXA 2IQIA 4CV1A 4HYQA 4BZPA 1Z13A 3K71B 3H5TA 3MMZA 4G09A 3C70A 4NZOA 3ZHUA 4AJ4A 4EPXA 1D1TA 2C61A 4UXJA 1KQFA 2I71A 5FAKA 4U9UA 2DR2A 3DBOB 3IUBA 5FQNA 2BE7A 2CVPA 2FETA 2ZB8A 3C7KA 4RXUA 3GU3A 5EQFA 4ZT2A 1E7MA 3Q7TA 3QPVA 3W5SA 3H2HA 4DDWA 3M81A 1D4ZA 2ICAA 1RQ7A 4JITA 4PZ0A 2CNOA 1Z0AA 1W75A 4BLVA 1BX0A 5LMNB 4GL2A 2A59A 4HDRB 4IAOA 1H2XA 1I2BA 2QZ4A 3B6IA 4DLKA 4KN5A 4MKRA 1JB1A 2WU4A 3T12A 4YAIA 4RULA 1DL5A 1RPNA 3GK3A 4DLAA 2Z8XA 4F6RB 3TG8A 4OQDA 4CKCB 4MIEA 5SZJA 1GPJA 5CPBA 4OQ4A 4EFDA 4M0DA 3IA7A 4NARA 3M4XA 1S2DA 4ZVKA 3E9YA 4F4UA 2VUSA 4JVNA 2V9PA 4EEXA 1IPHA 5FLKA 2DQZA 4GOLD 2RHCA 2VNKA 1KO7A 4O0MA 4QGHA 5LQSA 3CS3A 2PVPA 1E0KA 2AVNA 1JDVA 1SIBE 1TK9A 2FMFA 2I55A 2O8EB 2B2NA 2AC7A 2ZUBA 3K4PA 2O8VA 4MW4A 1YRBA 4X1YA 1ZNWA 3DBIA 5BP7A 3RGWS 1E4EA 4DIMA 5BWMA 1GTG1 2FSVA 2GCIA 3MB5A 4L5BA 1SD5A 4NBKA 3RHSA 2YCBA 3GCXA 1WXDA 3RUHA 3TZBA 5ALOA 2VJYA 2WG1A 5IASA 1ULUA 1VFPA 2NTNA 3D7MA 2HSJA 3L7LA 2FPGA 3H84A 4IKEA 2Q9BA 3DBHA 4D9FA 1H2BA 4MKGA 4PPQA 3HJFA 2VQ6A 2AG6A 1MW8X 5C3MA 1RYDA 1Z56C 3GFVA 4ALIA 2AOUA 2C1ZA 1EWYA 5E0OA 1ZGJA 3COZA 5B55A 4LJYA 4MRRA 3T94A 2ABWA 1BH2A 1MA0A 3W4KA 2FZVA 4IRXA 1T4GA 2XIJA 3HWWA 2F8LA 3RWMB 3UWDA 4RJIA 1WVMA 4P34A 5B6IA 1QGED 1FLNA 1G9XA 2HH9A 3D6JA 1PX2A 4Q7KA 1X1RA 2C0CA 3ZH9B 2P3SA 3I6QA 1Q50A 1BWSA 3T1YB 2AYXA 5CP8A 4V39A 2YXDA 1P0FA 4GAEA 1T43A 2XUIA 1U8YA 3HZZA 3O8QB 1E3QA 1SO8A 1BDBA 3QGMA 4K40A 4RAQA 3OOEA 4WOBA 4I3HA 3WLAA 5JH7B 4M1OA 5GADl 3HH8A 2BGGA 1R0ZA 1ZXLA 2EP5A 2R6JA 3NGXA 3NV7A 3PTAA 2FRXA 4AJOA 4R6XA 3R0ZA 1I3KA 3W5IA 1OBVA 2TRSB 2PBFA 2YZKA 5E7IA 1C14A 4KXFB 2EBHX 1YRLA 2PPVA 3MRVA 1HXHA 2OUKA 2PRKA 3O90A 2I2FA 3WIEA 3VJKA 2HHCA 3J7TA 2E89A 1VGVA 1HDXA 3IPCA 1MF7A 3KU4A 1QCZA 1AKYA 1PGNA 3AESB 5DHSA 2BGTA 2P4EA 3LA8A 1RQXA 4TQAA 1ZAYA 1TYBE 2CXUA 4S1VA 3K9HA 1WDLA 1VBNA 3ZXUB 4YBZA 3ZHBA 4KGVA 4OYLA 1BMQA 4RA9B 2G09A 4MR7B 4V02A 5D51S 1T2FA 2H8KA 1WXXA 1OQAA 1P0MA 3KVYA 2I4OA 4LXHA 13PKA 4QEZA 4LBZA 1U0HC 2R68A 3G5UA 4J4HA 4KXWA 3VHLB 4OGLA 4UM8B 3PXGA 3D3NA 3F7MA 4F9FA 7MDHA 1OLXB 2JASA 3ON5A 4LBVA 1OH8A 4OHFA 2SICE 3EDOA 4D8TA 1SCKA 1ZRMA 2NU7B 4E4YA 7MHTA 2O1EA 3WYGA 2ZVJA 4YJHA 5BN1A 1YRAA 3SKYA 2JAPA 2F3PA 5EYPB 2L17A 1CBUA 4D96A 4ZIRB 3CG0A 4Y3UA 3ADDA 2A5YB 2QLNA 4D43A 5CG1A 4ES6A 3PKZA 3GRAA 2VRCA 2R44A 1R0RE 3A11A 3LVBA 4N5MA 4TOIA 5ER9A 2PUTA 3OLQA 4DZRA 5FWXB 2PX2A 2QVLA 3MVEA 1IBMB 2QZPA 2WG2A 4AMUA 1TM4E 2AG0A 3Q8XB 1MJHA 2DZDA 2ZB2A 1N5MA 4ZXPA 1WCXA 1L5LA 4AUMA 4NCHA 4W7SA 4POOA 2XDYA 1W44A 3A27A 3IP1A 4WMLA 3P9PA 3VHXA 5DNYB 4AI6A 1ACJA 5KOHA 4HLUA 3E84A 4EYQA 3QFSA 5FNVA 4V1CA 5EERA 2HWUA 4EOGA 3NJ8A 4ZMSA 5D3MB 1N1EA 2G07A 3W78A 1HG1A 4RK6A 3FCYA 3QXCA 5KOJB 1EUDA 2QXTA 4JGBA 1LXCA 4R0NA 5IWCA 4W8HA 5J2UF 3NB0A 4P3PA 4K0KB 1XQXA 3KEFA 4HWKA 2RARA 4YO8A 5JE8A 5H4GA 1QFZA 3C87A 2P6RA 1U2TA 1WW3A 1F0PA 1S7CA 2UZ3A 1MXFA 4P4SA 1WMAA 4B87A 5IJ9B 4KR2A 5BVHB 2PANA 3CB4A 3L3BA 4DUGA 3D3JA 3UW3A 4HF7A 1JILA 1YKFA 2JLAA 3H2GA 3DT6A 3I0MA 3KSMA 4KPFC 4D4JA 4EZIA 5B7QA 4BYMA 4YRNA 1MAUA 1G98A 3K0BA 1TYDE 4XUGB 4E5UA 2C5HA 4OCZA 1QHIA 4C0QC 1JHUA 4R1PA 3D9QX 5I4KA 2WVGA 4EQZA 1DUVG 2V03A 3BBPA 3IDQA 3TOSA 2OSBA 5EA2A 4NC9A 4ER5A 4G1UC 5EJEA 5FI1B 4MVJA 3UMFA 2G5GX 2WOJA 4ZVVA 3DB1A 5I6DA 2FK7A 2G77B 1FU7A 5KNBA 4JJIA 1SFRA 1PLLA 1UBHS 2F9FA 5ALJA 3GG9A 3H0KA 3OZTA 3L7CA 4FFLA 1DUSA 4N41A 2NP6A 2ECPA 4GC5A 1JH8A 5DYTA 1QP4A 3QOWA 1VLLA 3JAKB 5HZMA 4BNDA 5J58A 1XZHA 1YBVA 5AJUA 2VT6A 1QHXA 1X42A 1W36C 3PC3A 3IBYA 1XDWA 2Q3JA 1IBCA 4LSWA 4CV0A 4CKBA 3P45A 4YASA 4HN2A 4Y6RA 5I45A 3UMBA 1GU7A 1KI2A 3GELA 4ZI7F 3RVQA 1E6EA 2X0KA 3IV6A 4IYRA 5AQEA 4M8KA 2E4WA 5B1HA 4NDAA 2RAFA 1QIMA 5F76A 5H59A 5CB6A 4P31A 3ZJUA 1Y1KE 4U7GA 4UZFA 1VI6A 5E7JA 1RVDA 5FL3A 4B73A 2NXJA 4CEJB 4YUAA 3MT9A 4KN6A 2HOQA 3CF4G 2VDQB 4EHLA 1C1YA 5EMJA 5JNVA 3BMQA 4HYEA 1GQFA 3OJLA 3BWEA 4MGIR 5F1PA 4Q9IA 1SULA 1J9EA 3LWDA 1RHUA 2FZEA 3OZCA 3PFFA 5E6UB 1ZKMA 4D3FA 5MN5A 2WYIA 2VH5R 3EULA 3B20A 5AVYA 5C7IO 5A5GA 5EQTA 4HVLA 1GU0A 1DEHA 5E1MA 2ZLBA 3CF2A 3ZE2B 4DSOA 1MAAA 4OB6A 2BELA 4EB6B 3TKAA 2FJ0A 3CLRC 1GT91 3C74A 1KYTA 4N6GA 2WHQA 4IKOA 1Y8QA 4MO9A 1C3OB 1FDUA 1Q7CA 2P69A 3K94A 1QGZA 1UUFA 4G5RA 4DMRA 3QF7A 1UXHA 1RWKA 4D4MA 4HZUA 1ZZGA 1EA5A 2BLNA 2HU8A 2JI8A 4NMLA 1P80A 2P0AA 3PTLA 1GPUA 1Y0BA 4JR2A 2IDZA 4NMMA 5A71A 2VT2A 3LBIA 1YZFA 4BOYA 4CM6A 4YV7A 4DR4B 1BO6A 2R47A 4PCVA 1RJGA 1N25A 1DBIA 2O6HA 4RNDB 5LZ9A 1Z6ZA 4ZN6A 2OQIA 4FDVA 2H59A 3FOZA 4EHDA 1ZINA 1NQTA 4CQMA 2CL0X 4M1SA 4UPDA 4RX1A 4XAQA 3TL3A 5IZCA 5DKFA 4XPIA 1XAHA 2VJLA 3WV4A 1PVDA 1UK7A 4IS2A 4C4OA 4QBHA 5JXGA 1SVKA 1K1EA 3TEFA 4C21A 4TGLA 3V3KA 3AVYA 3C1AA 3ENVA 4C22A 4PVDA 4UM7A 1FFXB 4QHSA 1GV0A 1KEZA 3SN6A 3NHMA 3HBAA 1WMSA 5D5PA 3MRSA 2ZB3A 1JYFA 2XMZA 3SR0A 1COZA 4FPXA 1RJWA 3AL3A 5HXAA 3CGWA 1A4IA 3ZCSA 1XNRB 3C4VA 1MXHA 2QZZA 3FHJA 4H6XA 4MRNA 1OWPA 3PDUA 4J2HA 1QO7A 4WJZA 1G8GA 2B37A 3BC1A 3FPGA 4EL0A 4IV5A 4KNYA 2GKSA 3C8MA 1GPBA 1MVLA 4DLRA 3OHPA 1NTRA 3ZY5A 4AW9A 3U40A 4EL5A 2OC4A 2P6NA 1RI2A 1U2PA 2FPLA 3EK2A 1TJNA 1GGMA 1RBQA 3LWZA 2X5KO 1R6VA 3R5TA 4RK0A 4RHUA 3K0SA 5CHYA 2A58A 4WKNA 3U80A 4W7IA 4ZT7A 3KKPA 4PICA 2WA1A 4LRQA 1XRSB 2AI2A 1KXJA 3EMDA 5CYFA 1E2KA 5FP0A 2EFJA 3ZS8A 2PUCA 4YS6A 3MTAA 1RQGA 1Z2OX 3DWFA 3LBYA 5HS6A 4DW8A 8ABPA 2XZOA 3THXA 2AKEA 5TF0A 2OWDA 3WSWA 4LC1A 3WLSA 2O1XA 2YYYA 2FOLA 4P54A 3E70C 4ZMRA 4XDYA 1GUFA 3LSYA 1D6MA 1DMRA 1ZGBA 3FVWA 4KYTA 3MFQA 3C8HA 3R0XA 2X7XA 1WHSB 3KLOA 4HFMA 3L46A 1VPTA 1TI7A 2I7VA 3OCCA 4G67A 4A2WA 4E5VA 4I7EA 2QAGB 2XA1A 3MWEA 2NZVG 2D54A 3QXXA 4OJYA 3TQRA 3U0VA 3AEUB 1P7YA 2PZAA 4KBFA 4CMCA 1XZ8A 2E4YA 2P78A 3B6EA 4QU0A 2CJPA 4MV7A 3HFSA 4K7JA 1N2IA 2RB4A 2P2SA 4DGQA 1NUQA 3KM0A 4EG0A 1JALA 1GRVA 3JWPA 4RE5A 4PNEA 5BMVF 4Z3OA 1SQ6A 1S3IA 2X14A 1ECGA 4QWMA 5DM1A 1H69A 5GM2A 4NR0A 4OQMA 1VIDA 3VYSB 1C50A 1I4TD 3IJRA 4HNAB 4WGFA 4WI1A 5TY0A 3V8VA 2VF5X 1RHJA 3LQRA 2ZZKA 4PGFA 421PA 5CT5A 3B13B 3VH3A 1CHDA 3CJRA 3H87A 1M34B 1P1HA 2PX3A 1A5AB 1Q22A 4IMIB 4IYJA 4JUCA 4MP3A 5D5HA 4BFWA 4AJEA 2Z2JA 5B1EA 1D5WA 1OR8A 1YKGA 3PPVA 3LUBA 2EP8A 2O3TA 3IP9A 3NHWA 3I45A 4YAEA 4TUYF 3UUFA 4EG1A 4P7KA 3I9MA 3W6NA 3JRXA 1U2DC 2A5DA 2IYZA 4FOTA 1WXHA 1V3VA 4Y6OA 3SBDA 1KJWA 4UAUA 1H8ED 1ZI9A 1DDGA 3RANA 4DLNA 1N5DA 1ZUNB 1IL0A 2VQEB 1PZGA 621PA 1U3GA 1OFHA 1U1IA 1AC5A 3PK0A 3U44A 1LPOA 3K3PA 2VBIA 4PN3A 4K28A 4Z2AA 3O38A 4G89A 4HQRA 3S0JA 3H5LA 4XQ0A 4YH1A 3RC9A 1IN7A 1XZCA 3DCNA 4EI9A 4FDLA 4TQGA 3ZH2A 3TOZA 1YFLA 1PR9A 1YXMA 3BXFA 4Q00A 4NV1A 3WKBA 4DPLA 1NVDA 4B0OA 3AVWA 1AUQA 4JZKA 1XMJA 1QK5A 3MT0A 5DFAA 3U3KA 1NWHA 4AO6A 4FYIA 1FMTA 4WZZA 3IA2A 4JWTA 5CEEA 3UBTA 4J1TC 1KIMA 1XQ1A 3DXXA 5BUZA 4WK2B 1VLVA 3WGMA 2QIOA 3JALA 1L4UA 1FS5A 1BQ3A 4QYWA 4UEWA 4LJ9A 3S3TA 3I9OA 1Q1NA 2ZRFA 4Q01A 5HTKA 4PTYA 1KGSA 5KJEA 3JQAA 1CUIA 1EB8A 4DJFC 3A1EA 4BEWA 2PRZA 4MB6A 4CG3A 4KAXA 4LOJA 5AVWA 2D00A 1YB7A 4P35A 1NU6A 1S3FA 4ML3A 1K86A 3KUCA 4S24A 4JA0A 4BO5A 4QNNA 1J2TA 1C9KA 1AXRA 2H2AA 3AUTA 4GOKA 1GEEA 4BX8A 3CZPA 2AIRA 4S1PA 4BNFA 3GGOA 2WRZA 5DCLA 3DBVO 4BYGA 5JSZB 1E2MA 1JR2A 2XT6A 4ARZB 2XTJA 4M9ZA 1Y3FE 1SHLA 1ZA1A 2EWMA 2P3OA 3BTOA 1NULA 4DXDA 2GD1O 3CNEA 1DIGA 1M7HA 1T4DA 4Q15A 2IDKA 3OE4A 4Y6GB 3I0ZA 2MWMA 3ZDEA 1XVIA 3BE6A 1GG5A 2BSAA 1MBZA 1OBOA 3JS5A 2J1LA 3LPNA 4NYMQ 2Z6AA 1HPLA 3LW7A 1P0PA 2GEBA 5E1OA 2KW5A 2AFIA 2Q07A 3SQDA 3G79A 2V6JA 2FPRA 5J5CA 2JFFA 4KIJA 1Z6GA 2VPIA 2NU9A 4RJ2A 3H05A 5E3IA 1KDZA 2HJVA 4Y9DA 2QT0A 3EDQA 4O3MA 2HEIA 1IBSA 3D6UA 3F4LA 5KTMA 2XCUA 4IMRA 1AGYA 1S5PA 1NJ8A 2Q50A 4EUHA 3QBTA 4RD0A 1J8QA 1TT5A 5AK6A 2NUTA 4M7PA 1WLYA 3FIUA 4Y2XA 2VT7A 3UWKA 1VLHA 1LVUA 1ZFNA 2WD8A 3EVDA 3FB1A 3G7NA 4S1WA 1RPAA 1U7TA 2Z5VA 5CA1F 4RIHA 1KQGA 3GEIA 1EGVB 4U8HA 5KTSA 2XZTA 2PT9A 1B6TA 2PK3A 3R7FA 5BW8A 5IWAB 1M0EA 3AWDA 2UYGA 5THXA 5TV2A 4PS1A 2M2IA 5EJ8A 5I01A 4O2BF 5DHRA 3TBFA 4E5SA 4E6PA 1OZHA 4R8LA 3CRVA 4YC7A 3VAYA 1JR3D 5K99A 3O8OB 3UHPA 2Q3FA 1GTSA 5E9JA 3QJGA 4BV9A 4R68A 4YRKA 2XZLA 4OSPA 2I3ZA 4PIVA 4RCYA 2KBFA 5IJAA 5INTA 3QP9A 2WAXA 3WOHA 1Z2NX 3QKRA 4FE3A 1F12A 2KS6A 1WZNA 1EUCB 3Q3CA 1YUMA 1FUUA 1KARA 3WTCA 2QQFA 3ZU2A 5FWNA 1QP0A 1SUEA 2UXBB 4Z9XA 2FN9A 4PO3X 3R9IA 3STVA 1X7XA 3CWCA 1A4XA 1GQRA 3M70A 4H4CA 4I4CA 2G5CA 3NOXA 1CV2A 3GZNA 10MHA 2UVPA 3ENNA 4JJFA 3TLZA 3OZWA 4HDSB 1LC3A 5DIZA 3RARA 1ODCA 2C9CA 2BEWA 4E7PA 1O9HA 3QVMA 3QKTA 5FBRB 1TRKA 3UIEA 1XZGA 2DBQA 3EIQA 4Q3LA 4BWVA 1UMBB 3E22A 3PUXA 3WL3A 1AHPA 2JANA 1ZG3A 4F93B 5TLSA 3KOYA 4I2VA 5GY7A 3FSRA 3E0QA 3TIFA 2IYAA 4YJ2F 1S6YA 3AUUA 1XP8A 3MD0A 1BRTA 3DVRX 4UHEA 3UJ8A 2PFSA 3MJ4A 2PR7A 2IHNA 1MGPA 1SIOA 2GJAA 4QUAA 5C1OA 2R00A 1W85B 4BXOA 5ARCA 1OIWA 3EHEA 1K7EB 1ISPA 2LUOA 1NMSA 2QM3A 4FEAA 1Y63A 2MINB 5G1OA 1ONSA 2GLTA 2GYVA 4H1VA 5A9SB 4MW9A 1IXYA 4U7HA 3D8TA 4NK4A 3TRHA 5IN5A 4PFJA 5FA6A 3E05A 4AKSA 2NN3C 2WTEA 4GPD1 3T3HA 1WY7A 3VKFA 4B33A 4OQLA 1YFJA 5F12A 4S2EA 3SD7A 4J0GA 3LKBA 3T15A 5TJ9A 1NQUA 3IUPA 3UXEA 3ECSA 2WNHA 4CTOA 1FNCA 3IMCA 1SZCA 2FY8A 2I7TA 3FDXA 3GJ3A 4DN6A 5SV2A 3W8FA 5IPFA 2GLXA 4D9MA 1VMAA 2JK1A 4U9IS 5KWSA 2VF8A 2B83A 1PFQA 2WB4A 4EB3A 3AJAA 2DWQA 4IDNA 4U0JA 2YN4A 3KZKA 4CEHA 5CITA 2FLKA 4QOSA 1I4LD 5EI5A 1CUGA 2A94A 5BSUA 3WGGA 1YONA 1JDNA 4YXFA 2CHFA 3SVZA 5ENVA 3U4AA 2MMGA 3G7SA 4RA6B 5L3ZA 4JQZA 1IJBA 5ED4A 2GQ0A 2XUAA 3DZDA 3H6GA 4NDNE 1SWVA 4FQ7A 3AR5A 3M6LA 1QRAA 4UNQA 3DO8A 3B1WA 2CNWA 4NESA 2G25A 4WZBA 1SXIA 2O7RA 2IP4A 3DE5X 4JP1A 5FHRA 1YJ5A 2XWBF 2Q0HA 3UT0A 4CL2A 2F55A 1SUBA 3S8YA 3ZV7A 2GM5A 5AXBA 2QTVB 1W2WB 4Q6BA 2PZLA 1SU8A 2WHRA 3LL4A 1O97C 4ZHQF 3MAAC 2J9RA 4YTEA 3EFEA 3HXPA 4LG1A 1ZL2A 2MYUA 4BVGA 2ZBFA 5CDSA 1BWQA 5F5XA 4D4LA 5L45A 3JVIA 2H1WA 1JECA 1BW9A 1X3LA 3GJQA 4O5AA 3E5MA 2R85A 3D8RA 4FS3A 4QPZA 4EY8A 1OY1A 2A8YA 4NG5A 2W43A 2R1VA 2GDZA 4F5EA 5HBRA 5C5IA 5KQPA 2FWMX 1VE7A 2W2PA 3H1PA 5C1PA 3Q41A 5I3ZA 3A7EA 3GQBB 1E3SA 4KQWA 1AVTA 2FRDC 5LXTF 4Q05A 3OZXA 3MFYA 3JYLA 5DWQA 2CK3A 4AZWA 4PLCA 4CETA 2FPPB 1NPTO 2TMKA 1UWCA 1SC6A 2X41A 5BN3A 5HUQA 1K6EA 3LQKA 3AQIA 4I55F 1I6LA 2Q0XA 5EXXA 2WM9B 2FW1A 3CX6A 2IS1A 3G2KA 1GQ2A 1K6MA 3DFUA 3K9WA 1J06A 2WU1A 3THXB 1E2JA 1DWPA 1QNLA 4G25A 3FOCA 3P2EA 5JBIA 1U8UA 1BD4A 1TX4B 3SIRA 5HFJA 4OX9Y 3HCFA 5SYMA 3AUJB 4D44A 5FTLA 3A32A 1TZJA 4UUPA 2D5IA 3HB0A 3KT3A 4JSRA 1LA2A 2CFOA 1Y4SA 5L7WA 3BFJA 2F1KA 4BO7A 3UHOA 4HWPA 1HTTA 4LDPA 4P3NA 3FLBA 2LTAA 1Z3IX 3GJZA 4I9HA 3O8RA 3R44A 1K63A 1XMPA 2ZATA 1YZQA 1C0LA 2H5IA 2OM2A 3EPJA 1IPFA 1B3BA 2JEOA 2IOHA 3P9KA 4JJ6A 1NNLA 2Y1XA 3SBXA 2NPOA 3G2JA 2C7BA 3FMGA 3L07A 2N42A 2VK1A 1D2EA 3M4JA 3PQ6A 4QBFA 4XCXA 5KNDH 2GT1A 4N3GA 3S1SA 3OJ0A 2ZJ2A 2BJWA 4U5QA 4UM5A 1AG9A 3B3FA 1GL3A 1QYVA 3TCNA 4RHTA 3HKEA 2YMQA 1LNSA 4AG5A 4B8YA 1J39A 4W6QA 4EJFA 3DDNA 3R3UA 2QV7A 1QJ4A 3BE4A 5P21A 4GQIA 1KEEB 3AY3A 4UOZA 3IHTA 1HC7A 2FAXA 2R87A 3DXZA 4FMCB 2BZSA 1UEIA 1X80B 1L6IA 2J3HA 3P0EA 3T7CA 4ZVOA 4CTJA 4V0MA 3GLHA 4IXNA 2G7MC 2PZJA 4I9FA 1U28C 1KYQA 4ROSA 3O9ZA 5FWDA 1P73A 3V8NA 2BZGA 3AZQA 2X9LA 4WXHA 4OL0A 2A1UB 3CCBA 3O8BA 4DLUA 4LYEA 1P45A 5EGNA 5BN5B 4BHTA 4HX9A 5JS1A 4DJDC 1HQKA 1Z0FA 1Z0ZA 2P41A 1JA1A 3UJCA 2G17A 3BB4A 4X20A 1AT1A 3GQVA 5B6JA 1NT4A 2R62A 2AGVA 4KG7A 5MHTA 2H85A 4HO1X 1MQSA 1OH6A 4EYEA 5KTYA 5AVKA 1B8NA 3FLAA 3HR8A 1EXDA 3VKGA 4BMNA 2Z8YM 3EAQA 3WBFA 3DM9B 2ZU0C 3BGSA 3PICA 1MB9A 2NT4A 1B41A 3OTGA 4CGYA 2Q7XA 2WHPA 3S2EA 1N7HA 2F00A 1M3SA 4PIMA 4PPYA 5ER6A 2P9JA 2OP0A 5CLHA 1TCCA 5HCUA 5CYPA 3HFGA 3ZTWA 5EHXA 1T5DX 3F2IA 3C6BA 5DULA 3HABA 1MC1A 1DHTA 1SHZA 3D43A 4KHZA 5AKZA 2HO5A 3WDKA 3PJEA 4OGFA 3NBFA 1JNYA 1KIAA 4URHA 2XKJE 2J0QA 3E9ZA 4D25A 2JI9A 1SN7A 3DHWC 4OMCA 4TKMA 3LPCA 5CH3A 3JTEA 1EUQA 1YKSA 3LT4A 1PV4A 4C87A 2GPYA 2XKAA 1H6DA 4KO2S 2FFBA 4MVCA 3ZZMA 4BZWA 4DRXA 2IK8A 3HSYA 5DLDA 2XZPA 4YRBA 2HIMA 4NQRA 3I09A 1R4NB 1FQWA 4YAFA 1IM5A 4PO8A 2IOYA 2IX9A 4YCDA 4J75A 4LX8A 2WYVA 4S0XA 5IT4A 4DXAA 1K7FB 4RTMA 2PA3A 1USGA 1CQIB 5FFNA 1P62B 2P9ZA 3BL6A 3NM4A 4YMSA 3G02A 5I47A 1GSOA 2NVWA 2VP5A 1WU7A 3OF5A 1WXGA 4JUFA 5CJPA 3W8EA 2I6FA 2PUAA 2WPNA 1XKXA 2D2FA 4RETA 5B3JA 4BLSA 5GJCA 1GL7A 2IYUA 5DBHX 5ILGA 3FPJA 3FFTA 4IHQA 3WGYA 1DAPA 3COWA 1KO1A 1Y4AE 1OAOC 3IXLA 3OO0A 4WTOA 5GONA 4DMMA 1Y3IA 3X1XA 4GKKB 2FFRA 1G8PA 1BKDR 3HG7A 4N39A 3I2JA 4AKIA 2ZTMA 1ZXBA 4BNHA 2PS3A 3IYLW 2FXVA 1BJKA 1VL8A 2G63A 1QHFA 4DUGD 3I83A 2NZ8A 4F85A 2REQB 5IJ0B 2I33A 2MU1A 4AIRA 1EP2B 2A9RA 3AU8A 3N0VA 5DTJA 4C05A 2OGTA 3JWGA 3L0SA 1CR6A 1MLDA 2R3SA 3AI3A 3JVVA 3DOOA 1TTTA 1X7WA 2R79A 3H9UA 1U2RA 1N5IA 4JYMA 1MW9X 3KCQA 3EXIA 3AFNA 3MNFA 4URYR 4RPKA 4M1WA 1Y1RA 3CX8A 3SKXA 1HORA 2YRWA 3O7MA 1OKKA 3UMGA 5FOSA 2TECE 2F8SA 1JQBA 1KY5A 3E3NA 4MVJD 2B4AA 3AVVA 2D2VA 1OW3B 1CULC 4G5GA 1Z83A 1US8B 3NHFA 3PZRA 1Y5IA 2QRLA 4LRYA 2YZ2A 2J41A 1UBCA 5KNBD 2OCLA 4UMDA 1X7YB 3AX6A 4ZEWA 3QTTA 4HCJA 3AHFA 5ALGA 2AZXA 1V9CA 2G72A 2YN0A 1XA0A 1CQXA 2VYNA 1XNGA 1M0SA 2XDAA 1E2UA 5J2TB 3BIXA 4FYWA 1DJQA 1T0PA 4KI0A 4GRIA 4TRMA 1KETA 3CX3A 3KD3A 2JD1A 4KYVA 2OZLA 1KVSA 3CVYA 1P4SA 2B0JA 2BI4A 3G0CA 3D7RA 2D0OB 4EPYA 5LKRA 1WV0A 1VHJA 3WXBA 3DW3X 1P5JA 2DKNA 4R1SA 2VAVA 3GV0A 4J0CA 5ALUA 4FSXA 3AV0B 3CVJA 3C14C 1CJKC 4US0R 3A28A 2QN1A 3TRDA 3K5WA 4JEHA 3WGHA 5BSFA 2R11A 4R41A 3O26A 2WJ3A 1IATA 1GHTA 4V38A 1SJ9A 4YLGA 2WDPA 1HE1C 4MQEA 1U7WA 1UPAA 1VKHA 4GPTA 1ZRNA 2IZZA 4RY9A 1H6CA 4Q3EA 4DDVA 4HTFB 4L0DA 5L3SA 1G21A 4KVGA 1K3TA 5E2BA 5LUAA 3QOYA 1H0SA 2A35A 5IKOA 5LBTA 1V6AA 3H8VA 3Q1LA 1GZUA 4W9MC 1DSSG 1IFXA 1JFTA 4BGDA 4CHGA 4UQOA 5JDIA 3FKSD 3ZVLA 4TRNA 1YULA 1RBZA 1VLJA 5CLLA 1ZR4A 3ILVA 1TUBB 4ZREA 1OXKB 4NENA 1MOZA 1MT3A 1W52X 3L5OA 1DC8A 4H15A 4YQZA 3UK2A 5BQXA 1ZD3A 3PNMA 2J9XB 3LSTA 3NWPA 3WFIA 4B9EA 2JJMA 3U61B 1NT2A 2CCGA 5F3DA 2BH2A 3LXMA 1N2OA 1Y8RA 4P22A 3T95A 1DAFA 1GKYA 1T2EA 1U0SY 3BGDA 2WIJA 4YHHB 5DYGA 5FV7A 2RAVA 2BONA 4RABA 1RAEA 2YS7A 3MM4A 3E81A 1D09A 1TYCA 1QG6A 1O95C 3O8NA 2HMYB 2H2GA 1RI5A 1WA5A 2P4SA 4TMYA 4HRAA 3ZXSA 1Z17A 2ZWOA 4RKQA 5AT1A 1XE3A 5IS2A 1HYBA 2RI0A 5KMGB 5LVAA 2DCUA 3JSAA 3LCRA 1JDBC 3CLSD 3QHPA 5E6SB 3ZWKA 5EZQA 2IS6A 2AW3A 3K0AB 2IGBA 3CY6A 3Q0EA 4XUDA 4EO7A 5D85A 2AFHA 4EABA 2FR0A 4LS3A 1YQGA 3X1MA 3LTNC 1DFGA 3FSEA 3CF4A 3H11B 1VGQA 1DOHA 1H6BA 4RTJA 1TM7E 4EHFA 4UXHA 1Z35A 3MC1A 3T3NA 4ZT5A 3SYNA 4PLZA 4D8UA 5K2MA 3F74A 1QWSA 3X1JA 3DG9A 1HKHA 4IQ0A 1ZOSA 4BTLA 3B38A 2GS9A 2YJ5A 3KD2A 5C52B 4LVCA 3H3JA 4LDJA 4TMTA 1HGXA 4GR4A 4L5YA 1W9MA 4DIKA 1JMKC 2W83A 2VZ9A 2AA3A 1KRWA 3CZCA 4C7OB 3MS4A 3IDOA 3KYIB 3ZLUA 4CDGA 3ZDCA 3M0EA 1Z2PX 1QHEA 4XYBA 3R3HA 2YVUA 3NW9A 4KI7A 5EFZA 1WU8A 5FAXA 2BEUB 3E82A 2EERA 1SQGA 1TU4A 2EKDA 5K1ZA 3HB9A 3S5JA 3VSAA 4AWXA 2Q28A 2HADA 5DI9A 5KAMA 2H4WA 3QMPA 1VM6A 3ETGA 4RK1A 3HNRA 4JIMA 2FR8A 4L85A 4WKCA 4BEVA 2QJWA 4P4NA 3EVNA 1C3VA 3K1JA 3SYKA 2PS9A 1GYPA 2XNKA 4DCUA 4DGSA 4RVSA 5JQGF 2PJRA 2DFKB 4HV4A 5I5EA 4HDRA 3D3WA 3DTVA 4Q1EA 2PBZA 2WA2A 4W6ZA 2EOAA 3B3GA 1HWYA 4HFRA 4WZAB 5DN9A 2NUPB 2BFDA 3W3AA 1I2CA 4QPDA 1FZQA 2P9GA 4NNOA 1WULS 1KJQA 3DLCA 3DJFA 4N7JA 4LNAA 1F8GA 4ZOLA 5JR3A 1BGXT 2IPLA 1S2NA 3OLVA 3HBJA 5HCNA 1WY5A 3OG9A 3OOSA 1GGNA 2QRMA 3RAPR 2AXQA 2BGKA 4FVTA 3RYCB 4CM8B 4Q02A 1OREA 3D4NA 3IPAA 2CKMA 3O4JA 2VYQA 2VWHA 3RNOA 5L3QA 4P4GA 2FPOA 3FMOB 2WDZA 1SK8A 4OGKA 1VJDA 2Z2KA 5EXSA 2OYRA 1L7QA 1K92A 4KAJA 4CUKA 3HXLA 1HQCA 3SVLA 3RQIA 1IN4A 1C8BA 1CY6A 2XE6A 1PJQA 1SA0B 2W9XA 2VS1A 3HB7A 1BIFA 4CDMA 1VL6A 2Q5IA 3R3JA 3LUDA 3ZHVA 5JWHA 3PNBA 3K4HA 4IZ6A 721PA 1MB2A 3AYXB 5I7VA 2V97A 4OUDA 3QFRA 2G08A 1NBAA 1EEHA 1MO3A 2LDBA 3RM3A 4LI3X 1KORA 5D87A 3DD1A 5JEEA 5DB4A 4BU1A 4LV5B 1MB4A 4MVYA 3HN2A 1SKMA 2G9UA 4UZEA 4IUYA 4IGIA 4TZTA 3C5HA 3LRPA 1Y5NA 4M86A 1IOWA 3L4BC 4IDFA 4MV3A 5FO0A 2W8ZA 3OOHA 3ORYA 1X0VA 2KQUA 3AETB 4M1EA 1Z34A 4ND7A 4KDFA 4X61A 5F33A 4DMFA 1BC5A 3I2FA 2IQ5A 3OQHA 3FBTA 4N03A 5I8ZA 3CB2A 3R7SA 1PL0A 3IVCA 1EE1A 1V11B 4JLSA 4FJ0A 5T41A 2PGIA 3IQIX 5FQOA 1UBEA 1AUXA 1GITA 1TEHA 3LFUA 2DC1A 3KZ1E 3NCTA 4YJFB 5HIMA 3RYHB 3HS3A 2ZIEA 3U49A 5KREA 4IH1A 1SVLA 4NU5A 1TZCA 2MT9A 1BE0A 3C8ZA 3W2IA 1DO0A 1T8WA 1Z8DA 2QHXA 3I9V6 3O8QA 4BN5A 5BRJA 2OZPA 1F4LA 4N7BA 2UZIR 2VZEA 4OYHA 4K87A 5CVEA 5JH7A 1SC4A 1NW8A 1Z7WA 3T3GA 4C7KA 1RM5A 3DO5A 4RSHA 5JNLA 4QFDA 3WIBA 5AVXA 3ELUA 3W2GA 2G36A 4PW0A 5DM0A 2Z6QA 1JQLB 3SYMA 2YV5A 4IMJB 9ATCA 2CN1A 3ZS9A 2PA0A 2IU4A 5EHNA 5KHOC 4CG2A 5K0EA 1MFPA 3MOSA 4PLPA 1VSVA 2N0SA 3R3WA 3WK6A 1XU9A 2CF5A 3K96A 4O4LF 5MGNA 4KR9A 2ZI4A 1LLUA 1E1KA 3C5CA 1T5IA 3OZVA 4CR6A 2N75A 2WFZA 3GAFA 4EFMA 1GVNB 4IFEA 3DMYA 4JLBA 1BYUA 2ZSHA 3C5EA 3OJXA 4N3NA 4CCYB 4BCCA 4BX0A 2DP4E 3O47A 1FQJA 1MHPA 1CQPA 2O2YA 1JSLA 1FTYA 3JWIA 3KWFA 3NBAA 3OCJA 3IAAA 1PT9A 4ZCRA 1G5QA 2GF9A 1Q6YA 1DOAA 2M6RA 4RA9A 2ZYIA 4MR7A 1KJIA 4D4KA 1O94C 3HBNA 2DFPA 2VKTA 4HVTA 2EFGA 4IIJA 2BP7B 4FNAA 2YWRA 1Y37A 1FX1A 3FKJA 1ZGAA 2H4JA 3DBRB 4WHMA 1OLXA 4NYJQ 2PUWA 3AF4A 3AF0A 4ZYUA 4US2R 2NU7A 2EFCB 3PNKA 3QHQA 6ABPA 4EB8A 4OG2A 1MT0A 3FFAA 3TLAA 1RXUA 5EYPA 4JROA 1YL6A 2X5NA 3TUJC 3MSCA 1MG0A 3NFYA 2DH6A 3JQFA 1SU6A 3SHVA 4PSDA 1S2LA 2NV0A 1XZBA 1DQZA 3EWSA 4QUJA 5EPUA 3RRMA 1JA0A 1FS4A 2HY7A 1X70A 2ROQA 3CFYA 3NBQA 3NEYA 2XXBA 2SHKA 2PMEA 3WIUA 2XD4A 2ZSDA 3W77A 3K7EA 1KR5A 3DTTA 3G23A 2XCTB 4C01A 2VF2A 4JYAB 1VTKA 2IXBA 1C9MA 9GPBA 4X8OA 4V0OA 4ZO7A 3OF3A 3AVXA 4A26A 4HPWA 3SP1A 1ZOLA 4WZ6A 4X91A 1LLFA 2AQKA 5JWOA 1CTQA 2A0YA 2ZWMA 1EVYA 3T3PB 3ZD8A 3WICA 3RRYA 5IABA 3GYBA 3MJSA 4O1HA 1TTQB 2GZ1A 2ZPUA 4ZTBA 1QLJA 2GPAA 1MX9A 3F6CA 2QN6A 1LZKA 1SUPA 1VPWA 2R8ZA 2HWWA 4D0GA 1X0XA 2NVUA 2QL7A 2DQYA 4PZZA 1GGHA 3O8CA 3AMVA 2GAAA 4IDBA 4R0MA 2JAOA 4RLHA 1NW3A 2X1LA 3I1JA 1PR2A 2Q5OA 5T4FA 2IXAA 5BVHA 1XTSA 3I92A 2NV2B 3IEKA 2W90A 3JQBC 3K1AB 2OE2A 2Q3BA 1RIFA 1HEIA 3PLNA 5JHGB 3I42A 3C8UA 3JQDA 1D1PA 1XVVA 3K1TA 2EL9A 4L3VA 5CJJA 3WGKA 1QYIA 2ZSIA 4LRWA 3VMFA 2OLEA 4YRPA 4IIDA 4MTCA 1EFDN 1YTUA 4DLSA 4RVCA 3L7YA 2H16A 1CJMA 3K30A 1P77A 1IK4A 3DEZA 3NORA 1THGA 2JGFA 1ECJA 1KBQA 2IL1A 4TKZA 4GDMA 2XLCA 5DBOA 3IMGA 2RJNA 2HZ7A 4YECA 3IBSA 1NR7A 3ZJVA 2COKA 4AKEA 4G36A 2CUKA 4JP2A 4I36A 1H3FA 2XA9A 5DTRA 1ECBA 3NHLA 2XWPA 3PL1A 1YAHA 2D7DA 1PYGA 3LRTA 1L5ZA 1GV1A 1J2YA 3T7TA 3OZ7A 1AF4A 3E9DA 1BRMA 2FEXA 3JAKA 1CDDA 1TC2A 5TEWA 5K8CA 3TSZA 3KVRA 1KDTA 4AP9A 3D81A 2YXBA 3C7TA 4A10A 1YA4A 1Z07A 4K6KA 4XH9B 3BZUA 1W1UA 4LIPD 4NYIR 2WAMA 5ALMA 4D98A 4FDUA 5K3OA 2IJGX 4MW0A 4EYOA 1G20B 3I39X 4XX1A 3G8DA 4BQRA 1YF3A 4KMRA 1TM2A 3K70B 3KTDA 3SC2B 4PC1A 5C34B 4D9GA 1KHTA 1VFNA 4B3HA 5K9ZA 1NUSA 3SHFA 2CHUA 4CEJA 2GCEA 1VC2A 2KE5A 3QSGA 3LLVA 4UNNA 1VHTA 1JTFA 2QL5A 4K9DA 4XB6B 1RI3A 4J6EA 1Y7IA 4LF9B 1FU4A 1IBLB 3WKDA 1FNNA 1QOZA 2ID9A 1U0OC 2J7KA 2QGFA 3CTPA 1NZJA 3R5HA 5E6UA 3JATB 3RLFA 3DPUA 2C03A 4F9TA 2RC6A 1MJ5A 1PI3A 1Q83A 2O7NA 4FSHA 2F8TA 4R1NA 1SVWA 1ZA2A 2QW8A 4EX6A 5TPZA 2YZMA 4CIDA 1TK2A 1XMVA 1ZEMA 5EJAA 1KQ3A 2AWNA 4GZ5A 1NDQA 4U7FA 3UAGA 2EBUA 1DO2A 1M2OB 1QM5A 2FPMA 2N1BA 3HDVA 3OU6A 3UUGA 3DEAA 3HU5A 1VB3A 1YR2A 4EG7A 3A7DA 3LUKA 4KDEA 5L8VA 4U9HS 1FQOA 2Q6VA 4UBJA 3Q9LA 5F7OA 4PPFA 3N5CA 1WDTA 2PS1A 3IIJA 1MO4A 1DFHA 1OXSC 2OAEA 3HQ4O 4TTSA 3LPDA 4R8RA 3T35A 4G1BA 1UDWA 2WEKA 3MRTA 3WGUA 4YGXB 3OTWA 2WHEA 3LWBA 1WB4A 3U4QB 4AS1A 1JIXA 3BILA 1KU6A 3LOQA 2FSHA 2BFEB 1V25A 4MRVA 5DN6D 1FVHA 1XNHA 3TLMA 5HP4A 1CJVC 2ZBGA 4LZNA 4ZWNA 2AF4C 2QG4A 2J4FA 2BCEA 2OESA 2C2ZA 5F23A 1V5FA 3D7LA 4N3AA 1RLIA 3N7TA 4YCAA 5JDCC 3QUTA 1NM5A 4UCQA 1OWLA 1Q92A 2ZJZA 3ONVA 4OXIA 4UEOA 5E8JA 3U09A 1P2GA 2NT3A 1CLEA 3LM8A 4M53A 5AI8A 4M55A 1DG9A 1ZIPA 2EVWX 1DXQA 1FFXA 4PYJA 1XLUA 3LBFA 4AURA 2EW1A 1PQUA 1TK3A 3LECA 2O8NA 3M1IA 4LJKA 1E9CA 4B8ZA 2ZJAA 3UUEA 1M8FA 4UMFA 1PJCA 1QVZA 5D6OA 4E21A 4RY2A 3DL4A 1Y98A 2PGLA 4KO8A 3G0DA 2YWGA 2XB8A 3FAZA 1CRQA 1WPXA 4PCLA 4ZU1X 2K5UA 1XCPA 1XXHE 3JQ8A 2C42A 3E7PA 2EQ5A 3WGTA 3QF4A 4AZTA 3C7CB 2GZSA 2RAUA 5B5SA 4C4PA 4DBLC 1CVIA 4IJUA 3AR7A 1E79D 4INZA 4YJ3F 4YJGB 5EXDA 3ZKWA 2X8WA 2EW8A 2H92A 3SF0A 3UMVA 5C1DA 1E3WB 5GVSA 1QLWA 2QM8A 1SKYE 1OFTA 2JPDA 4BRZA 4Q9KA 3UB3A 5LQNA 2WE8A 2EGUA 1WUJS 3C3AA 3GLQA 3EEIA 3CIOA 2V7EA 2XHEA 1ONPA 1A97A 1MNAA 1JFFB 4MARA 4XB2A 4KX3A 5TQVA 3LV8A 2B30A 2G5PA 2Z3ZA 1RTTA 1OYVA 4I19A 3FJYA 3THOA 4CN8A 4O4HF 4DM3A 4DSUA 2XADA 1JP7A 1SHJA 5JCOA 4US1R 2HPVA 4D4HA 2GGSA 4HNGA 1WABA 2IWHA 4ZZ1A 1EVIA 2WJVA 2I9KA 4NJEB 3VO1A 4F4CA 4BWYA 4F12A 2CFIA 1XRPA 1M33A 1K97A 3UAOA 1NX6A 3NYQA 4WA8A 4X7RA 3C7DB 1WHSA 2VQ3A 2CMDA 3F78A 1PFWA 2RHWA 1V1RB 3EVFA 4Y6QA 4H17A 4PLYA 1G6KA 5L3VA 1RYBA 1W48A 4Q3OA 2OB1A 3E53A 1RLUA 3ISTA 3IUYA 3PXAA 3A9RA 1E2FA 1OMOA 2INGX 2WVAA 4WCFB 5ALQA 3RV3A 1SMKA 1U7XA 2JJ1D 4NSNA 2CVHA 2CYCA 1ZCAA 5C31A 1TM1E 1L6RA 3DYVA 3K0CA 5C8DA 3W04A 1IHPA 3EUAA 3FBWA 3GRPA 4HNAA 1QPGA 2JDIA 2WC1A 1ZMRA 5CGZA 5EEHA 4BAGA 1KZ9A 1U3DA 2UYQA 8ATCA 3AEQB 1GTL1 1DRWA 3IH5A 2P27A 4LZAA 4QPCA 1ZK1A 2W4MA 3AW9A 4OHKA 5AM4A 2RIPA 2I8AA 2FPIA 3HP4A 5IVHA 4EG3A 1HX7A 1A0OA 1E4YA 3EFBA 4O3FA 3TL2A 4CI9A 2YOGA 2R5FA 4OJNA 3SZRA 3HDHA 4MWSA 2J9FB 4ZZ3A 1QU2A 4PLVA 4C43A 5DHTA 4OOEA 5KYYA 3O93A 3CN7A 3VOSA 3JR3A 4BWFB 2HFJA 3WLEA 5DP2A 3JPWA 4L5JA 1ZUNA 2I3AA 1FZTA 3ANMA 1TNDA 3PUZA 2PT6A 1ISGA 3WE7A 4GP9A 1SUIA 1ZKDA 3FVRA 3PD7A 1R64A 2V7WA 3K2IA 1PS0A 2GASA 2LCIA 4PRYA 4PX2A 4D46A 5HE9A 1Q2XA 2H4YA 5BSEA 2HGZA 2X86A 2CXTA 2R7NA 4G8CA 4DL9A 5MN4A 4I5DA 1KYXA 4RLQA 4ZQBA 1F51E 3I4LA 4QUGA 2JFVA 5I7AA 2XZDA 3UYKA 2W6QA 4KUHA 3PSAA 1OGJA 5G02A 1I30A 1E3IA 1YZHA 2HQOA 5FBQB 1BSVA 4B47A 5JZSA 1D1QA 4QTUB 2A0UA 3KFLA 1P81A 3PE4A 2O2XA 4BO8A 3VU9A 4B84A 3U3JA 1QU3A 1UFOA 3M9WA 4K1LA 2YXPX 3F6SA 2XGGA 2DECA 1Y5RA 3EHDA 1DDIA 4ODIA 1DAIA 3D7SA 5D3KA 3V9AA 4L0CA 5CUQA 2GWRA 2D1RA 3GEDA 3RADC 2EQAA 2XMCA 2XYQA 2I2CA 3OEHA 2WSBA 1RQ2A 2VAWA 4H3SA 1TZBA 4IIVA 4R9RA 4E13A 3FW1A 4EUEA 3ZBTA 1P7PA 2PJZA 1YJBA 4P38A 1RC8A 1NJSA 4M21A 1RZ3A 4GLJA 3HI6A 4QGGA 4RFVA 1M2KA 2WBLC 1VYTA 2DOKA 5ILQA 3WNZA 3ZR4B 5IUJC 3OQNA 2JJQA 1JKIA 2GK7A 3WX0A 4XASA 4ARZA 3VNAA 4KQJA 2JVJA 1EM8B 4E5DA 2L2QA 2WABA 2CDRA 3AI2A 1YHZA 4M0MA 3F5FA 5CG2A 2JL1A 2WUEA 4JBGA 4LVNA 4QX6A 1MN6A 2XXAA 4INPA 4WOCA 3RKRA 3TZCA 4NICA 2ZI9A 4NU6A 3WNQA 1XTPA 4ANFA 2YKGA 4KE7A 1MX1A 1CJSA 4AJLA 1XTIA 4AMGA 1CUUA 4JY7A 4UZSA 2DXIA 1OIXA 1XK7A 1C0IA 2QKYA 3INYA 4MJLA 4PLHA 4PYNA 1VL0A 4DMGA 1S3GA 2MYNA 3CIFA 3W05A 2EARA 4EZEA 3LHIA 3P7MA 5ALZA 1LDEA 1QH1B 4FOLA 3U4DA 1XTTA 3AFGA 2ZJ8A 5JATA 4ZAWA 1HOXA 4F2GA 3A1UA 2BMFA 3P9RA 4C0SA 3CNNA 2HAEA 2V7QA 1J8VA 3PDCA 2UVQA 4JEUA 3V4LA 1KYZA 2BHNA 4PGHA 1JZTA 1RABA 3ROMA