1Y7IA

Structural and biochemical studies identify tobacco sabp2 as a methylsalicylate esterase and further implicate it in plant innate immunity, northeast structural genomics target ar2241
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
258
structure length
258
Chain Sequence
EGKHFVLVHGACHGGWSWYKLKPLLEAAGHKVTALDLAASGTDLRKIEELRTLYDYTLPLMELMESLSADEKVILVGHSLGGMNLGLAMEKYPQKIYAAVFLAAFMPDSVHNSSFVLEQYNERTPAENWLDTQFLPYGSPEEPLTSMFFGPKFLAHKLYQLCSPEDLALASSLVRPSSLFMEDLSKAKYFTDERFGSVKRVYIVCTEDKGIPEEFQRWQIDNIGVTEAIEIKGADHMAMLCEPQKLCASLLEIAHKYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and biochemical studies identify tobacco SABP2 as a methyl salicylate esterase and implicate it in plant innate immunity
pubmed doi rcsb
source organism Nicotiana tabacum
molecule tags Structural genomics, unknown function
molecule keywords salicylic acid-binding protein 2
total genus 75
structure length 258
sequence length 258
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1y7iA00
1XROA 3WK9A 2BAGA 2BUCA 4OYLA 3DJYA 4UBLA 4QNNA 2PPLA 3CXUA 3JW8A 4FFVA 1LPAB 2XUIA 1QIEA 1T4MA 2XQFA 3FYUC 5HKBA 4JUIA 4YPVA 1D07A 4JYPA 3ANTA 1HDEA 5ALWA 5DYWA 2RAUA 3G7NA 2Y6VA 1R50A 5A6VA 3HRHA 4QA9A 2HA6A 5HK8A 3VVMA 2XMQA 4GI1A 1CUIA 2HA2A 4BAUA 1QIHA 4C4YA 2OCLA 5HF5A 4U2DA 5FOQA 1ZJ5A 3ZWQA 3VDXA 1U4NA 4FFWA 1WB6A 4J3JA 1HLGA 1YCDA 4GDMA 1LPOA 1AMNA 1UKCA 1E8NA 5JIBA 3C6XA 2DSNA 1ZGBA 4DYHA 2HFJA 4AN0A 4DNQA 3R0VA 2HM7A 5I9IA 1TQHA 2P8SA 3B12A 3FYUA 4BZWA 4ITVA 1UK8A 3A2LA 1LNSA 4XWGA 3RARA 5FLKA 5EGNA 5AM3A 3JWEA 2WHRA 2VAVA 1WPXA 3QYJA 5ALNA 3WWEA 1RYYA 1WCYA 4U2FA 4HRYA 5YASA 5ALFA 2PSJA 1MAHA 2G4LA 3C8HA 2D5LA 1BROA 4IH4A 1ZI6A 3DNMA 3X3HA 4Y2XA 3FYTA 1WPRA 1E5TA 3KD2A 4EUSA 4DNPA 3Q8WA 1BN7A 2W22A 3STXA 2DHDA 5H3HA 1MU0A 3WK6A 5KWJA 3D5EA 1MNQA 1JMYA 3W06A 1CUAA 3Q0TA 5KWIA 4YASA 2XI4A 2WG0A 5AKYA 5DWDA 3ZLUA 5JASA 1GT6A 4K2AA 4OB8A 4V2IA 5C8XA 1XQVA 1FFAA 2VT7A 5LYYA 1PJAA 4WDQA 2JGFA 2JIDA 3FSGA 3QVMA 2V98A 4B82A 5LLSA 1HPLA 1ETHA 1O6FA 5HK9A 4G4JA 1YSCA 3WK7A 1EK1A 2CKMA 4W1RA 2XMGA 2VATA 1W4LA 1GQRA 1BEEA 1CQWA 3TRDA 1MPXA 2ZVDA 1ODCA 2J4FA 1LBTA 1SC9A 3OOSA 4Z49A 1A88A 4UBNA 1CUSA 2PX6A 1GPNA 3G02A 4WFKA 3FLAA 3LS2A 4U2EA 4MEBA 3A70A 3BJMA 2VA9A 3I2HA 1VOTA 1CR6A 4LXHA 4CCWA 4INZA 3QBJA 4EY4A 4AMZA 4ZI5A 3QPDA 2VTVA 1YAHA 4KJXA 1HQDA 5D6OA 1J1IA 4QZVA 5LZ9A 4U2BA 3DOIA 3P2MA 2PUHA 4A5SA 3V9AA 1FFBA 4NZZA 3A2MA 4CG3A 5FUMA 3W04A 2HA3A 2WIKA 1ISPA 1IUNA 2C58A 3PFCA 3N2ZB 4UBJA 3T4UA 4BB0A 3IUMA 3WZLA 3G0BA 1XRRA 2C0PA 1XQYA 3HI4A 5AK6A 2XQGA 1LPPA 4RE6A 2BKLA 1JJFA 2X8BA 3FAKA 4OB7A 3BDIA 1DWPA 2QUAA 3C43A 1H2XA 1XZJA 1CUYA 5CH3A 5KBYA 1XRPA 2HFKA 5JAPA 3O4IA 2V9ZA 1LPNA 2C5FA 3I1YA 5EI5A 2AJDA 3VJKA 5IH7A 3F8SA 2OGSA 4DM7A 3CN7A 3WL7A 1CQZA 1Q0ZA 3WJ2A 3WYDA 1G5FA 4RPCA 1MAAA 4UBIA 4DMHA 2X76A 1GKLA 2B61A 5E4TA 4QDTA 3WQHA 4E14A 2WM2A 1BEZA 4BBZA 1YA8A 2VJBA 4QLAA 1QJ4A 3UUFA 2XUHA 2OLEA 2XT0A 3M81A 4EY5A 4H7HA 1HKHA 1L7QA 4CG1A 1JI3A 2BGRA 4BCCA 1JU4A 4FMPA 3I2FA 1EVQA 2QUBA 1X70A 3IA2A 3I28A 1VXRA 3HC7A 2VEOA 4O08A 3WA7A 1XZAA 1VZ2A 2XB6A 2FX5A 4GEGA 2HADA 3SK0A 1XKTA 1E66A 1EDDA 2DR0A 1EI9A 4IQ4A 4KEAA 5ESRA 2Q0XA 1PV1A 4LKOA 3RK4A 4PNZA 3WYNA 4NS4A 3E3AA 2JGLA 3D0KA 2ZYHA 4GHWA 1A8SA 4B0PA 5LZ2A 3R3VA 1T2NA 4QDUA 1QZ3A 1VLQA 3WWOA 1N5RA 3NUZA 5F4ZA 4KAAA 4B85A 2BCEA 4C87A 4TVKA 3R3WA 3QPAA 1CUEA 4Q05A 5AOAA 4Y2RA 2DQZA 3F96A 3PUIA 3IIIA 3BL8A 5LKRA 4N5IX 3C6ZA 2EDAA 5HQ3A 3G9XA 5JD6A 4AX4A 2G5PA 2OPHA 2ACKA 4C4XA 5CMLA 2WJ3A 1BS9A 1JJBA 1XRMA 3IUNA 4IO0A 2XQJA 1DX4A 1IZ8A 1B41A 3H1BA 4CIAA 5JATA 1E8DA 1UK7A 3H04A 2PKYX 5ALIA 1A7UA 3DKKA 5AICA 1W6RA 4PSCA 3GFFA 5A71A 3PICA 4Y2PA 4B80A 2GYUA 1H2ZA 1KU6A 3G0DA 4EY7A 2ECFA 3G9TA 3PE6A 1GGVA 2Y2UA 4IH1A 5ALJA 1KU0A 2RI6A 3H2KA 5HCUA 5ALOA 4QEKA 4Y2SA 4UBKA 3OTQA 3G8YA 1Y7HA 4G9EA 1JT2A 2ACEA 4G4GA 5AI9A 4G4IA 4BZZA 2VT6A 5EHQA 1XRNA 5HKAA 3D2CA 2QXTA 1FSSA 3M82A 5KREA 4XJVA 4CG2A 4OU4A 4X71A 1XZIA 2J4CA 3HSSA 1IZ7A 3H2HA 3S8YA 4LYDA 5CH8A 4OD0A 2HU7A 4FDMA 3MUNA 1KEZA 1AKNA 4X6UA 3I2GA 3WLAA 2IIVA 3WKAA 2BFNA 3O0DA 5ALEA 4BP9A 2CBGA 3WKBA 3G0GA 5ALDA 1K8QA 1ACJA 2XUOA 4DTCA 4MJ3A 3IBTA 4IHAA 2GBCA 1ZIYA 4AB1A 3C5VA 4MWSA 4HXGA 1QIGA 2JEYA 2WUFA 4H35A 3EF3A 2GZRA 4BCDA 4Q3LA 5JADA 5K3FB 1LPBB 1OXMA 2WJ4A 3D3NA 4HAIA 1K5PA 3R40A 2PBLA 4EBBA 2H7CA 2PSHA 3G9UA 5A7HA 2GYVA 3C6YA 1LPMA 4B9AA 2VSQA 5FV4A 1DT3A 1FFCA 2QTBA 3H2GA 2JGJA 2LIPA 1GPLA 3VVLA 3FCYA 1ZI8A 3KWFA 3ICVA 3TJMA 3NWOA 2PSDA 3YASA 4LHEA 3CCBA 3WWCA 1UKAA 1C7JA 4OB6A 2CMFA 1MT3A 5AOCA 5K3EA 5AKHA 5CT4A 2V97A 1ZI9A 4G8BA 5J3JA 1L7AA 3BF7A 2HA0A 1W1IA 1W76A 4K5QA 3F67A 2ZYSA 1FFDA 5CRIA 4B9EA 1XZKA 3STYA 3STVA 3ANSA 2O7RA 3CN9A 3WA6A 4B81A 1ACLA 4AZ0A 3L1JA 4UHEA 1QLWA 1R1DA 5JANA 3QPCA 4BRSA 4DMCA 1U2EA 3DL4A 4HZGA 1QIMA 4ROTA 4CCYB 1CPYA 6YASA 1VA5A 4UBMA 4H7FA 5ALQA 1W75A 3WK4A 1QIDA 3FBWA 4B6GA 1VA4A 2OQVA 3WL5A 1VZ3A 2QJRA 3M83A 2G5TA 2WUDA 1XFDA 5CT6A 3H17A 4BATA 2XUKA 3ESDA 1DWQA 5JAUA 2CB9A 5ALHA 4KACA 2RGUA 1F6WA 4PO3X 4X7BA 4FBLA 3IB3A 5E2IA 3T52A 4W1SA 5DNWA 1Q0RA 4JEIA 3PDCA 5I8PA 2IX9A 4MWTA 4A23A 1RP1A 5CH5A 3FYUB 1YA4A 5LIPA 1JKMA 3V1LA 1AQLA 2C4HA 1CUFA 1JJIA 2VJAA 5AKKA 4G8CA 4OU5A 4Y2TA 1OILA 2RONA 4FOLA 4KAFA 1JFRA 4WFIA 2HHAA 5AM5A 2AJ8A 1BU8A 2QM0A 4J0DA 1WB4A 2RIPA 1CVLA 3D2AA 5AK4A 2JGIA 2WIGA 4G8DA 5AI5A 5ALUA 4CFSA 1Q84A 1YB7A 1YS2X 3DL7A 4RNCA 4AO7A 3FLBA 2WG2A 3ED1A 1EB9A 1TCBA 1GXSA 4BRZA 4X91A 3TGLA 2ZSIA 1EB8A 3C5WP 5LZ4A 5EHXA 3G9ZA 5IVKA 1UKBA 4K6HA 4TPKA 4N8EA 3PF9A 2WHPA 3DLTA 4GECA 1CUCA 4FKBA 4DGQA 1XZFA 1XRLA 5T4FA 2J3DA 1DQZA 4AO8A 2QOEA 5FPPA 4CCYA 5DTIA 5AM0A 5SYNA 1BN6A 3PF8A 2PM8A 1DTEA 4QWMA 1O6GA 4BC0A 4H7EA 4H77A 4EY6A 3K6KA 4QDXA 2XMRA 3LCRA 3AIOA 4CI9A 4OUKX 2QZPA 3FVTA 1USWA 2HL6A 2PVSA 3MGAA 1AUOA 3HLKA 1YR2A 3KWJA 4L0CA 3BE8A 4DNOA 1K6EA 1XZMA 1GQSA 1J07A 1XZCA 1MO2A 4X93A 2BGNA 5CT8A 1TRHA 2BUAA 1G4HA 1IUPA 2XUGA 1XZBA 3AJAA 4LYEA 1R4ZA 1CFJA 3SX4A 1EVEA 3HABA 5A2GA 3AUKA 4TGLA 3PUHA 4C88A 1LZLA 5C8ZA 3L1IA 1LGYA 3DCNA 5JD5A 3ESAA 2WSLA 3WKCA 4UFNA 2FUKA 5HF6A 5AH0A 2VJDA 1A8UA 1E89A 4DMFA 3HYSA 5JD4A 3H2JA 5I7UA 1ORVA 5IVHA 5AI8A 2PUJA 4L3WA 1JU3A 4BDTA 4Y2QA 3WL8A 4FNMA 4ZV9A 4E46A 4X85A 4AO6A 4UHHA 4KAJA 2AXEA 2WFLA 3IUJA 2OXEA 1VKHA 4UHFA 3SWWA 3B3QA 1EA5A 4X00A 1XZEA 3OPMA 1QGED 1K4YA 3OM8A 3W9UA 4E15A 2YH2A 2ZYRA 5BV7A 1UK9A 5AKGA 2EEPA 1QO7A 5AI0A 1SCQA 2HU5A 3VJMA 3DQZA 3WIBA 2QMQA 3D59A 5EIHA 4LXIA 3GZJA 2HDWA 4X94A 5AOBA 3W05A 2H1IA 1YASA 4RE5A 5A7GA 2HA5A 2ZYIA 1Q83A 2HIHA 3V48A 4UBOA 2WFLB 2OCKA 3IVMA 4I4CA 2I03A 5ALRA 5K3CA 2WTNA 3ZI7A 3AZQA 2OQIA 5A7FA 4FWBA 3UUEA 2Z8ZA 1CUUA 4YK7A 1UK6A 3QH4A 4G5XA 2FJPA 5ALVA 2WQZA 3GELA 5E4YA 1CUJA 2ZJ7A 3O9MA 2OCGA 1JMKC 5CW2A 3KDAA 4GW3A 4XIIA 4U2CA 1SCKA 2ONCA 1TIBA 5D7BA 1H23A 5JZBA 2PSEA 2ROQA 4AQDA 1CUHA 1E8MA 3WK8A 4DLNA 4BVKA 1Y37A 4YX9A 3AFIA 3ESCA 1XZDA 5FRDA 5BWCA 4PSDA 4BC1A 1N8SA 2XMDA 1SOMA 2ZSHA 4P9NA 5AKEA 3R3YA 4BVJA 3W9BA 5ALTA 4MQMA 3H19A 3ZPXA 4MXDA 4QE3A 3ILSA 3O95A 2R11A 4NMWA 3F9CA 1AZWA 1ODSA 4KYVA 3HEAA 5FKJA 4PW0A 1ZOIA 4HXFB 2Z3ZA 2XE4A 4EY8A 3A6ZA 2WTMA 3I6ZA 1IUOA 3WMRA 4GXNA 3OG9A 4H7KA 1ZD4A 3BDVA 4FLEA 3JYHA 1UXOA 4J0KA 4LIPD 4B0OA 1Z68A 3D4LA 3QM1A 3HZOA 2OG1A 2O7VA 3C87A 2Y6UA 4BE9A 3GBSA 2H7XA 2O2HA 5JAHA 5AO9A 4ZWNA 1I6WA 5C81A 1WHSA 2C0QA 3R3XA 4A16A 2PU7A 4KE8A 5JARA 5AK3A 3WJ1A 1E3QA 3O9VA 3F97A 4W1PA 3HXKA 4X95A 4KE9A 1L7RA 4Y2VA 1AGYA 2NW6A 4KR0A 4Y2YA 4ZXFA 5AP9A 1TAHA 1MN6A 1XQXA 4JYMA 4Y2JA 4DIUA 4J03A 3WI7A 5ALKA 3MUOA 2WJ6A 4ZV7A 1GPKA 1C4XA 3EQ9A 2QR5A 5JZ9A 3KOOA 3C70A 3I6YA 1QFSA 3DEAA 2CZQA 4RGYA 3PI6A 4DSZA 2O2IA 2G63A 4DSAA 4OCZA 4FHZA 1ZGCA 2GBGA 3R41A 1QOZA 3C45A 2QVBA 7YASA 1J06A 3IDAA 5K3FA 1CUBA 2JF0A 5DYTA 3R3ZA 4QLOA 3GUUA 4GWLA 3H0CA 5AKJA 4ETWA 5ALZA 5EHNA 4OYYA 3W2TA 1CLEA 4X6XA 1THGA 2QS9A 4PQEA 2I78A 2WLSA 4BP8A 4BE4A 2ES4A 2I3ZA 2XLCA 4UFPA 3D2BA 1QO9A 2JGEA 4OPMA 5EFZA 1VE7A 4WY5A 5ALMA 2Z5GA 1YS1X 5HZGA 2FJ0A 2XMSA 4BTVA 4J7AA 1QONA 2VAXA 4XX1A 5CURA 3V1NA 4FTWA 1NX9A 2CUTA 5DNUA 2WUGA 5EIEA 4MEAA 5FP0A 3HJUA 2OGZA 2BUBA 3C8DA 2GBIA 1CV2A 3BWXA 1XZHA 1TCAA 5SYMA 2OGTA 2DCMA 1LBSA 3OC0A 4G9GA 1FFEA 1VXOA 2BJHA 2C5GA 4N8SA 3GROA 5K3BA 3I6MA 5HFAA 4X6YA 2Y1KA 5K3AA 4I3FA 3DOHA 3E0XA 2WU4A 3MVEA 1F8UA 3S2ZA 4PF1A 3G0IA 4KE7A 2AJBA 5ALPA 1ODTC 1NU8A 3G0CA 1W52X 4C4ZA 5ISMA 3I2KA 3EBLA 3F98A 5FXMA 1QIJA 3UMJA 3CCCA 4B83A 3AIKA 2VJCA 4E11A 2WHPB 3R3UA 4C89A 1NU6A 3K9BA 3E1GA 4WFJA 1DU4A 1LPSA 4X92A 3K2IA 3C6BA 4H7DA 2PL5A 5AKIA 5IKXA 1HL7A 2OCIA 1MNAA 1CRLA 1WB5A 1H2YA 5AKXA 5ALGA 2X5XA 1WHTA 3RM3A 1CUVA 3AZOA 5CT9A 4QDZA 2Z8XA 1QIFA 3KXPA 4BYMA 1FJ2A 3WKEA 1P0IA 1MX5A 4HRXA 4K6GA 3WWDA 3FOBA 4Q1VA 4AMYA 4Q3OA 1MX9A 4J0IA 4W63A 3RLIA 4D9JA 2AJCA 3V1KA 3IUQA 2XUQA 1UOQA 3E4DA 2JBWA 5C7YA 4LXGA 1WM1A 3N0TA 1EDBA 1XLWA 1N1MA 4UHBA 4Y7DA 4ZREA 5AK5A 2EDCA 1P0PA 1ZIXA 2QJWA 5AJHA 5AKLA 1VE6A 4ARBA 4QDOA 1BCRA 1G66A 3A2NA 1MJ5A 5LKAA 4W1QA 2AJLI 2PU5A 5D3KA 2XUJA 1DWOA 5JZSA 3AZPA 5AM4A 5LZ5A 2WILA 1QFMA 3WWPA 4U2GA 1QIIA 3H1AA 1Y7IA 2JEZA 4WJLA 3FWHA 1AC5A 3KSRA 3H18A 5FPQA 3STUA 3I2IA 5D3ZA 1S8OA 4FBMA 1CUWA 4XVCA 1VJ5A 2HRQA 2ORYA 2WFMA 4KRYA 5K5EA 4FLFA 3I2JA 1A8QA 1HBJA 2I3DA 4ZGBA 4OSEA 5EHZA 5DNVA 1QIKA 1CUDA 4ZRDA 5LZ8A 2DHCA 4J0CA 4UUQA 3ZLVA 2VF2A 5T4HA 3L1HA 4Q3KA 1UWCA 3WL6A 4AZ3A 3WKDA 4B7ZA 4GBGA 2Y2VA 4W9RA 3BIXA 4BVLA 3FNBA 1N5MA 2CJPA 5K3DA 4I19A 4BCBA 4J0HA 3O4GA 5LP1A 2GYWA 1TCCA 2WIDA 2XMBA 5AI6A 4BAZA 4M0EA 3GA7A 3DKRA 1ZICA 1R3DA 1X2EA 1ZD5A 3EIOA 5ALYA 1H2WA 3WZMA 2H7YA 4EB0A 1XQWA 1X2BA 1GKKA 5T4EA 4DNFA 3I1IA 3NOXA 2XQKA 2DQYA 4S0XA 3VXKA 4ARAA 2XMZA 4L9AA 5HF9A 5ALLA 3SC2A 2JGKA 5DYYA 2XMCA 5FDFA 5DLPA 3O4JA 4MYSA 4MYDA 3QMWA 4M0MA 4X97A 1UOPA 3ICWA 2QKYA 1LZKA 4AXBA 5CTAA 3FCXA 1ORWA 1TK3A 3FSGD 3LP5A 4UPDA 5HFNA 2J3QA 4UHDA 2RHTA 2O2GA 3EQ8A 4BTLA 1OCEA 1UT6A 3LIIA 3QZUA 2B9VA 1QE3A 4P93A 2GZSA 1UFOA 2B20A 2HA4A 4UHCA 3FLEA 4HTAA 3LIPA 2OAEA 4Y9SA 1XLVA 4FNGA 4KE6A 2E3JA 3B5EA 4H18A 5DJ5A 1R9MA 2DHEA 5CBKA 3O4HA 2WUEA 2V96A 5E4JA 4JH0A 1YAJA 1UZAA 1J2EA 2RHWA 3IULA 1SFRA 4P92A 1EX9A 1BCSA 1B6GA 2XDWA 4GLBA 4BDSA 1CEXA 1F0NA 1XKLA 4EA6A 5C8VA 1AX9A 3V1MA 2XQIA 4HVTA 2IITA 3RKSA 4J0JA 3U0VA 4H7IA 1CUZA 2R8BA 2ZJFA 1EXWA 4NVRA 1EHYA 4BAGA 3TEJA 2OAGA 2K2QB 4Q34A 4UFOA 3VISA 4N8DA 2UZ0A 4PSUA 2DFPA 2C7BA 5T4BA 3AINA 3QITA 4MQLA 3BJRA 1DQYA 5HF8A 2YASA 1AURA 4H7JA 3D7RA 4X3CA 2WFZA 3WIOA 3PFBA 4B84A 3ZLTA 3HACA 3FVRA 4P08A 3OURA 2WKWA 2VQ6A 2WHQA 2HU8A 5AKZA 3DD5A 2ZJ6A 1R9NA 1RWQA 4WCVA 4F21A 2XUAA 2Z3WA 3DYIA 3ZV7A 5JALA 4C6HA 1U65A 2QRUA 3EQ7A 1P0MA 1EDEA 5JYCA 2B4KA 5JAOA 3NGMA 2WIFA 5BWBA 1DT5A 1EH5A 5IVIA 4HXEB 1IVYA 3VJLA 4N5HX 1EINA 3DDUA 3DS8A 2WG1A 2QT9A 5AIAA 4K6KA 2XUPA 1TKRA 1IMJA 2XUFA 1XZLA 3BF8A 1K63A 4C01A 1P0QA 1ZJ4A 4QWWA 4AN1A 1R88A 1QTRA 5EIAA 1WOMA 5CT5A 2D0DA 3ESBA 3DYVA 4IH9A 3LLCA 1LLFA 1MX1A 4L72A 4CIBA 1UOOA 2H9YA 5ALSA 4F60A 2CEKA 5AM1A 1XLUA 1CUXA 1ZD3A 2PSFA 2HRRA 3IURA 1EK2A 1DX6A 3M3DA 5A62A 1CIJA 5AIBA 5HQ3B 1DINA 4WDRA 2GBFA 1BE0A 4HS9A 1QTIA 4EZIA 3AIMA 1GZ7A 1XRQA 5ALXA 1M33A 3STTA 2JGMA 1U8EA 5AHXA 2XUDA 4JNCA 2W6CX 4Q82A 5AI4A 1PFQA 3BXPA 2WIJA 5IVDA 1C7IA 3QMMA 3STWA 4M0FA 4X90A 1YB6A 4PV7A 2WU3A 4Y2UA 5AM2A 3VKFA 4H0CA 2XLBA 3WK5A 3BIWA 1XZGA 4EHBA 3AILA 1F0PA 2HA7A 4WY8A 3U1TA 1BRTA 2YYSA 4KRXA 4F0JA 1CUGA 1G42A 1MTZA 4J0GA 5DTJA 5CXUA 1H22A 4DMKA 5BOVA 2QXUA 2YXPX 4F5ZA 5LZ7A 1ZD2P 1THTA 3H2IA 3QMVA 5CXXA 4G1FA 4FLMA 1SCIA
chains in the Genus database with same CATH superfamily
3R20A 1CJBA 4P5EA 3LFTA 4P82A 1V7CA 2VBGA 1IL0A 2ET6A 2WU8A 3C98A 2ID4A 3CX4A 3I04A 3O74A 4U4AA 2WJPA 1D1SA 3VR3D 4LJLA 4LE2A 4EX7A 2APJA 3I4CA 4K9KA 1NC1A 2XE7A 3B5IA 3BRSA 4HYYA 2PPLA 4B3HA 2YFKA 1QPGA 2W6JA 4NE2A 1OLUA 2G40A 4QO8A 3CXUA 4EUHA 1KSGA 3O90A 4MYTA 4XSHA 4YQZA 3C41J 1F4LA 2EKZA 4MIKA 1L9XA 2KBFA 3DE6X 1G9SA 3QKRA 5IBRA 2ORVA 1G2PA 5KDOA 1RE0A 1TX4B 1VG8A 4CMEC 3GF4A 2VYNA 1LRKA 4LECA 4YPVA 1A27A 1KAMA 4Y9RA 1U5AA 1DAGA 1EGHA 1GGEA 1WY7A 2GFQA 2Z2XA 4ICIA 3M9WA 2QBYB 4TLDA 1R50A 2JI8A 5T67A 4BO0A 4QA9A 3W7AA 1LWNA 2HA6A 3IPAA 5HK8A 1L6RA 2JEOA 3GLKA 4WK2B 4KFRA 1A7KA 3AHFA 3G1UA 1W49A 2J0UA 1KHHA 2WIAA 1I4DD 3V2IA 2ZI3A 5G2OA 3ZY2A 2MR5A 2XA2A 3ND9A 3ZHXA 1RU3A 2ZVPX 1P60A 3F6RA 3TMYA 3QPUA 4U2DA 4DCVA 1HDOA 2VHTA 4H17A 4ZVSA 1DOZA 5FOQA 3K70B 1Y1PA 1SXJD 4RQTA 2YWHA 5ICSA 4J3JA 4IAOA 4GDMA 3TH5A 2PKQO 4EHLA 1I1NA 1XHEA 5CW1A 4DEYA 1HL3A 2V6GA 2W6OA 1RVDA 4OJKA 4QU5A 1UKCA 2AUTA 1E8NA 3AJ8A 3L6RA 5H9VA 1L2TA 1MRNA 4B3XA 4Z7JA 4BX0A 1T2VA 1GL3A 1KYYA 4TS4A 2K6GA 3QIAA 4N3CA 1T2CA 1O58A 4M37A 2H4WA 1QHEA 2W2LA 3OJWA 1SY7A 4YUWA 2WM3A 1N2GA 3NDPA 4H0FA 4H3KB 4HS4A 4IF6A 4YI3A 4D9HA 3BTSA 5F1YA 4U7PB 5KHAA 3BEDA 5TVGA 1G17A 2IHTA 1HMPA 3II6X 3R0VA 4I5DA 1JI0A 5AJZA 2HJ9A 3BHJA 2WNIA 2P8SA 3O8RA 2A58A 3CR8A 1ZLYA 5CU7A 4PZDA 4MA4A 1H2BA 2GPTA 2UYCA 2GJ8A 2PRYA 2OGUA 3FOCA 5KYXB 4B09A 2DH5A 2AE1A 3HR8A 1V5GA 1F6DA 4RYDA 1QGDA 3A2LA 4XWGA 1TB4A 3ELDA 4PX5A 2JKYA 5FO1A 1U2ZA 2PRKA 3Q7QA 2R6FA 1PWXA 2P5TB 5FFNA 2H18A 3JWEA 5DIZA 2VAVA 5G3YA 5JJIA 2AFHE 4D42A 3QYJA 2JLUA 1XAIA 2G9UA 3L07A 1AE1A 2NQTA 4L8GA 1AMOA 1O0BA 2R60A 2IU4A 1PO7A 1WCYA 3GFVA 4Q4DA 3VDMA 1HSZA 1C0IA 1WMEA 2AXPA 1XFAA 2OHOA 3GDHA 3A4IA 3BVPA 4LYYA 5ICCA 1OTYA 1ZZEA 5YASA 4PGHA 4QBKA 3GLIE 3AEKB 5K3SA 3ZI4A 3M1IA 5LNK1 3WDSA 3P2YA 4Z4FA 2A78A 4QJ4A 4HH0A 1I9CA 4BGIA 1GYRA 1MAHA 1W36C 1SHKA 2I4IA 1BROA 2E4ZA 2EX0A 1DJLA 2NUAB 1E62A 3FHOA 4PC2A 1Z2PX 1D6MA 3DNMA 4M9SA 3X3HA 1UBKS 1GL6A 1ZCAA 1E9FA 3JQPA 3JSXA 2R87A 1N3LA 3OCZA 5F9FA 3PFWO 1A50B 2VH2A 3KD2A 3E2IA 3U31A 2VDMB 1NBHA 3OZEA 5TQ2A 3ZNQA 1A0OA 4JP2A 1BN7A 1CDOA 1CRPA 2W22A 2D2IA 3W2EA 2BEWB 2QL7A 3MWEB 4ZQGA 4A73A 5A05A 3AHIA 3IQIX 2VXBA 4HUQB 4LA4A 2QJFA 3ACCA 3HVRA 2NLOA 1NX6A 1DDOA 4JJGA 1CY4A 4B33A 5HIAA 1X13A 4Q19A 1DPFA 3UFBA 4MV0A 3ZWCA 5JRDS 1MRZA 1UXJA 3QKWA 4RA9B 1J8MF 4FGKA 4RLQA 1FP1D 1KYWA 3KNZA 3MIIA 1PD0A 2XI4A 1Z62A 3N7TA 4BJ3A 3IBFA 2JASA 3CF4G 4CV0A 4Y6LA 3IXLA 3ZLUA 4ACBA 1XO1A 2JBHA 2NZXA 1RXCA 5E3HA 4F9EA 1VLLA 1DEKA 3OBIA 5C34B 2V7WA 4YIHA 3EIEA 3N2EA 4TKUA 1XQ1A 1ZNYA 1YFJA 4ARZB 1KH2A 2YN0A 4PVCA 3HI6A 1FS6A 3MJEA 4ITUA 2PT7A 3A1VA 5EKXA 4XYLA 4AUEA 1PJAA 1ZPDA 4B1FA 1AGRA 5BUZA 5JR3A 4NXMB 3LD9A 1Y5IA 3D6TB 3OOHA 3SY8A 1ZW6A 4YROA 2C3UA 3C2QA 3QVMA 5TPWB 4S35A 1FJHA 1M8FA 1HE1C 5DOZA 1JXOA 1UBRS 5LLSA 5C1IA 3CX3A 5BNFA 1YSCA 4H08A 2V0NA 4LFBB 3PR3A 3T3EA 4DG5A 2AQ8A 1EK1A 4LRXA 3CZ9A 4LI3X 4YJ3A 1UEJA 4NATA 3NVKI 2BRUA 2VATA 4HAWA 1RQGA 2HI0A 1FP4A 4S1PA 1BGVA 2JH3A 3N2LA 2H16A 3AF3A 3IQZA 5TS2A 1CQWA 2QZ9A 4H3VA 3TS1A 1KAOA 3NTLA 1V37A 1XCOA 3C3MA 3I8SA 3MHPA 3GARA 1CRZA 2J4FA 3NC1C 4X8LA 4U6SA 4UOQA 2HMVA 3PRJA 4CMGA 4JJ6A 4RTKA 1NIJA 4CF3A 1CF4A 1ISJA 5IAOA 3H8WA 3SYTA 4IG4A 1JQ3A 5B3LA 2Q4TA 2X4LA 1GPNA 3MQ4A 2CXXA 2DQSA 3P71T 3KCNA 2PAFA 4BO1A 1AXEA 1LLUA 3B60A 3M89A 4J75A 3A70A 3Q3EA 4DMRA 4Z4CA 5A9SB 1ND5A 1PEDA 1E6EA 1VOTA 4CCWA 4LRTB 4JN6B 2GZHA 4UUMA 3PL5A 2J1LA 4UCFA 1FQOA 3ANMA 3KKPA 1K7EB 2XADA 2HGSA 3NBYC 4B3CA 3KTAB 1UBCA 4OBWA 1IH8A 3LWDA 3H9JA 3QV1A 2F8TA 1J1IA 1VL1A 1M6VB 4QZVA 1A5SB 1KORA 3DOIA 4H0NA 5EYPA 5C4MA 4QARA 1GQQA 3BPSA 3LZCA 4EEKA 1FFBA 3AM1A 1Q7TA 4JBIA 1Z0SA 2FCAA 2IYPA 3DBLB 2JKVA 3UC5A 3W04A 1IHDA 2ZR0A 4UBJA 1P44A 3N2ZB 2GZ1A 2JZOA 2W2XA 1THMA 1P2DA 3OM1A 3GFPA 4MGYR 3RG2A 3N8IA 3F5QA 2W6ZA 3DEKA 1DJNA 4M1WA 3NEYA 3V7NA 1U8AA 3T1HB 2Q5IA 2IH5A 4D8XA 1GSIA 3BGDA 1T2UA 2PS9A 1UDWA 4R9UC 4BQFA 5CUQA 3KU1A 2GCEA 4MOWA 4YQYA 1J2YA 5J2UF 1RPZA 2HDHA 1N6OA 4K6MA 3T3DA 4BTEA 5K6TA 1N3IA 1OFUA 1DFHA 2Z5FA 3DFIA 1BCSB 5JSYA 4C3ZA 4AF6A 2XNSA 3FAKA 4OB7A 4TS3A 5LP6F 1DWPA 1BHQ1 2NSJA 4LJKA 1IM5A 2WNSA 4DSUA 3IAHA 5LMNB 4OK5A 4G5YA 4HVAA 4JL8A 4X1KA 1S7GA 2XWSA 3UWKA 4RIFA 4KBGA 1H1TA 4MX8A 3FVWA 4WE3A 1LTHR 5GPBA 5CH3A 4FILA 3TLKA 1YZNA 3C7CB 4U02A 1XNJA 1FVXA 1XVTA 3J80A 4AIIA 3B8HA 2W0SA 4GNRA 5LMCA 3KYCA 5CVUA 5FV7A 3FZQA 1NP3A 3O4IA 2H1FA 3E3OA 4GGMX 3GAZA 4IFEA 1EXDA 1E1NA 1G18A 1MGOA 2V9ZA 4EZBA 3O2QB 4J90A 5G1NA 2C5FA 4QEDA 16PKA 4HEA1 2OM2A 3BN3A 1SH7A 4Q7EA 5D3MB 1QOQB 2QVZX 3I1YA 3FB1A 5JWHA 1C1DA 2ZWIA 4FD2A 3M2TA 1XL0A 2CXSA 3O8CA 3GRUA 4ZHQA 2OQRA 1AK9A 3HLTA 3DMFA 1M6NA 1Q0SA 4DM7A 3WJ2A 4DLSA 3GDFA 1JN0A 1G5FA 4I6EA 3X1MA 4K05A 4L5BA 2M9MA 2B8NA 5IDVA 3IUPA 4UXIA 4P4UA 4OTZA 3ISVA 5BQOA 3BWVA 1UR5A 1M2NA 2FUEA 5L8VA 1NM5A 1M7HA 3FUCA 1E6KA 2NSLA 1HO3A 3DZCA 3TI7A 4CNBA 4DOMA 5BORA 1OFGA 2YZMA 1K89A 1YWGO 4QDTA 4RKFA 3WQHA 4E14A 1QCCA 2ZTLA 3IQWA 1LEHA 4NRDA 3S7ZA 1OTXA 3UF0A 5CCBA 1HYEA 2BFFA 3CZQA 2LV8A 1FYWA 2O2YA 1U8CB 2IE8A 1LTQA 2VJBA 4R7TA 1ZHOA 3JY6A 2IPNA 1D3AA 1VG9B 1QJ4A 4KFCA 3UUFA 2Z6AA 2F17A 2FUCA 4EY5A 2QX8A 2A4MA 5KYYA 1L7QA 1VP3A 2J48A 2QTCA 2Z8YM 2FI1A 4LJYA 1POXA 2AZTA 2XCRB 3M6XA 3A6FA 4QOHA 4FSXA 1E3WA 4HNRA 3WRXC 4BFZA 2BGRA 2ZSUA 4DW8A 5BN5B 8OHMA 3F73A 3U4HA 2W2NA 4RZSA 4FXOA 3NP7A 1UANA 3C1UA 4LJ5A 4A8PA 3OQMA 4FMPA 3ZCRA 2BJVA 5DIFA 4REOA 4ER7A 4OLAA 2QN8A 3BFXA 2J6BA 3UANA 1IWPB 1Z2NX 2C20A 1GNLA 2XB4A 3QNUA 4ANFA 1U9IC 4RUKA 2QUBA 4L8YA 2JCXA 4YPFA 1X70A 4MW7A 4CEHA 2JJ1A 1R0LA 3G8DA 1VXRA 3HC7A 2X0KA 2C8LA 3BOSA 3I39X 1JIVA 1LI5A 3WA7A 2XKJE 3G2PA 1J90A 3K9NA 4MW6A 2XB6A 2FX5A 3V46A 3V8NA 2ESRA 2PXCA 3DZKA 3EXFA 3OCXA 1E66A 1EDDA 1S2IA 8LDHA 5FUYA 5JJKA 2A88A 2M2IA 3LP8A 3LC1O 2RD2A 4IQ4A 2G6BA 3JZAA 2G80A 3LG2A 3A6DA 4FYIA 4KEAA 4P6VF 4KVFA 4TTRA 1PS8A 5ESRA 3TQTA 4EUFA 1ISSA 1TNDA 4WX2B 3RS9A 1PV1A 2FR8A 2JJ2D 4HMQA 4LKOA 4HC4A 1Q50A 3WYNA 4KR3A 2FPWA 3VM6A 4NS4A 2BZ1A 2PN1A 3TD2A 1UF9A 4E1BA 1EP3B 1SD5A 2PGDA 4YIKA 3FJ1A 2JGLA 1OLXB 2VHWA 5J63A 2RGDA 1CB0A 4EA7A 4RMIA 2FN8A 2ZYHA 2IHZA 4LN1A 2F9FA 1CRWG 1KMIY 2UZ1B 2R7KA 2Q41A 3R3VA 1T2NA 4NBWA 4BUZA 5G0SA 4CM1A 5K4HA 3N8KA 4DPMA 2D6FA 1XVLA 4JVNA 1VLQA 1RWBA 1TJ5A 3EZXA 2BM9A 2UZIR 1Z4JA 5GZ1A 1M2FA 1EX1A 4IO1A 2PWYA 5K0BA 4OLBA 1EGAA 1NW3A 4NH4A 5BNTA 2ZFUA 5HR5A 5K8TA 3L8EA 4S24A 1NRWA 3LRPA 4C87A 4Q3EA 2DPLA 5EIBD 2R8PA 4GI7A 4JJKA 1E6WA 3R3WA 1M2VB 2X2FA 3AERB 2BEVB 3D81A 5M04A 4EPRA 3IRVA 4Q05A 3L05A 1E5QA 4CTNA 2FFJA 2NQ2C 5KTMA 1J8YF 2DQZA 4XYBA 1UWKA 3H75A 2KQUA 2RBKA 1D4AA 1RI1A 5BRJA 1T4DA 5K0LA 1KMCA 3HSYA 2HHLA 1YQQA 4JUCA 1RP7A 3KJHA 1NVVR 4G1BA 4YJKA 1WUIS 1F9AA 1HG0A 1NKSA 3U49A 4W5NA 4HQ6A 5HQ3A 1B0PA 4RQUA 2WNHA 3K0AA 3RIMA 4AX4A 2Y68A 3B1YA 1PFWA 3SXJA 1RBQA 1PNRA 1NBAA 1NVKA 3ZOZA 4QJ5A 4PYKA 2AXQA 4TLMB 1QJCA 5CMLA 1E4EA 4E94A 4XW2A 2WJ3A 3VH1A 5EIFA 3KQQA 1M2OB 2BEKA 2XQJA 3N0VA 1PGOA 4EW3A 1A4IA 3BERA 2BY4A 5DZSA 4QXPA 3HO6A 1VMEA 2P6PA 1EG2A 3WSTA 4B47A 5B58C 3FBTA 1WUJS 3RT7A 5K4AA 1W35A 2C95A 3HJRA 4GYYA 2VF7A 4KVAA 3OQIA 5ALIA 5EL0A 5IDWA 3QW2A 2JLVA 3W8RA 2C2KA 3GFFA 3HY4A 4QHTA 1U6IA 4DXAA 3PICA 3OQOA 4Q37A 1BXGB 3FWYA 4Y2PA 3GAAA 4B80A 1VHTA 1IHXA 1A77A 2XH8A 2JGAA 5CJPA 4UDXX 4E4TA 4JFAA 1M8JA 3GGGA 4OFBA 3G9TA 5HMLA 1NASA 2RCNA 4S1NA 3ROGA 1IRXA 1TW2A 1W1UA 3PE6A 1Y1LA 2XGGA 1GGVA 1CJMA 1HKUA 2E7ZA 2IXEA 3F7NA 3HB0A 2J30A 3MB5A 4QXOA 3J7TA 3ETNA 1M2WA 2QNBA 4X62B 3H2KA 1COWA 3GRZA 3MWGA 4Y18A 4GT1A 4RL4A 2OP0A 2XVMA 4QEKA 4MDYA 2BISA 2GEFA 1YRAA 5IN5A 4DBZA 1E5XA 1QVAA 3ZHYA 2FP3A 3LECA 3IVCA 3C3DA 3OTQA 2YJZA 2IZZA 4G9EA 4LQCA 1RQ7A 3H2BA 4L8FA 4TN1A 4G4GA 4DLPA 821PA 1SG0A 2H4JA 3TVDA 1JHPA 4N5NA 1UXHA 4NESA 4CMEA 4BZZA 5B4VA 3SR0A 1GZSA 2H9AA 1J7JA 3CZ5A 4ZV4A 1C0EA 2AKEA 3SJZA 2QVYX 1L4HA 5DTQA 3G7UA 3MS2A 3MT9A 4GKAA 3HHEA 1NR7A 3OY2A 2JHGA 3IT3A 4LBVA 3T5GA 1ZP6A 3CUWA 3H3FA 1T2EA 5FNVA 2CVOA 3I37X 4G0WA 4TMTA 1YZ3A 1RTKA 3D31A 2AFIA 2W6QA 1NBIA 4DB2A 4HX9A 1VKJA 2YVQA 1MABB 1JFFB 3F9IA 3KQWA 4M6WB 3ABOB 2PJRA 5JNWA 1UC5B 4AP9A 2QLLA 2JGDA 4CR7A 5B6PA 1DAEA 5DHQA 4LF8B 4KO2S 4LXUA 1HC7A 3GY0A 1PBTA 2KHZA 1AQIA 1WZIA 1XZIA 3T7KA 5A04A 2PQ2A 2HJVA 1PV4A 3A7DA 1J5EB 3GLIB 2V6FA 1FUUA 4I50F 2E2WA 3H4IA 4YAEA 1OWPA 1TYEB 2IV2X 2RAPA 3LYAA 5CH8A 5KNBA 2FSSA 3QE3A 1HDZA 4OD0A 3P0JA 5J4LA 1QFZA 5H02A 1Q0PA 1HRDA 4FDMA 5ESDA 4AAYA 1KP3A 3WIDA 3MUNA 5IFLA 1U0NA 1AKNA 3GN2A 2J9YB 5EXXA 1CRQA 3OA0A 5AUQA 4JLPA 5JZVA 5I7FA 2IUEA 3I2GA 1EVKA 2IIVA 2R7LA 3I9OA 3K3PA 5BQPA 2Q29A 3GJ7A 5KJEA 3AVYA 1OKKA 5GAJA 1O97D 3R5TA 1BYUA 1KI7A 1NFQA 2MSNA 4LYGA 3SYLA 5IM4F 1YUMA 2D7CA 2GN9A 5I9SA 1N9GB 2X0EA 4DAOA 1TFRA 3KPWA 1L7DA 1MAUA 1XMSA 3DV0A 4WECA 1Q5PA 1E9EA 1YMVA 3P7MA 1A98A 1DKQA 5ALDA 2PWAA 1E7YA 5BSTA 2JCYA 4NMMA 3FZYA 1D7OA 3V4OA 2HY7A 3WDMA 3SS8A 4KUEA 2DERA 3S2YA 1GCOA 1JDJA 4R2KA 4HVLA 1LVGA 3EVGA 3LF1A 2FFBA 3DF9A 3P2KA 3LU1A 3C5VA 3P19A 1H5NA 4HEA6 1RI3A 1BSVA 1QIGA 4EZEA 1D5WA 3CRMA 4QPDA 1GPBA 2X7JA 4O2AF 1OB5A 3PC4A 1EUDB 3M6UA 4O5OA 3SQMA 2NYAA 5FI1B 1NW9B 5K3FB 4C4PA 1CEEA 2UZ4A 3MFYA 2VEDA 3HJNA 1WDLA 2C88A 1VL0A 4EHJA 4V0MA 3O8OB 3R40A 2PBLA 2VZLA 1ZL2A 2H7CA 2P2LA 2YW9A 3CUYA 2PSHA 3G9UA 3JATA 4MB2A 5A7HA 4DR1B 1JDVA 2DFKB 2GYVA 4M76B 4OOFA 3BE5A 5I6DA 1LPMA 3ER6A 2VSQA 2TECE 4WASA 4DCPA 3L0YA 4DQVA 4OEHA 3TZQA 4FI3C 4BMVA 1P1CA 4GM4A 3VVLA 1GPLA 1LW6E 1RJGA 3GJRA 3ZY3A 4ADSG 1DBVO 4QDKA 2G88A 4KCGA 1QYVA 1NJ1A 4MIYA 2XECA 1RCUA 5IBPA 2X0FA 3HCEA 3KSZO 4A2PA 1MB3A 3EQZA 3EZLA 3HYNA 3PA8A 3AM5A 1XN4A 5CA1F 3OICA 3WWCA 3ZVKA 2VLBA 1C7JA 1W59A 2FAXA 2OHJA 2Q4EA 2X1VA 1SQ5A 3GFOA 3M9XA 4CV2A 3TW4A 1H2HA 4PZYA 3AO0B 5AOCA 1GPUA 4EMSA 1KDRA 5HUQA 4GMGA 4MINA 1O6BA 4D4MA 4UZEA 4G8BA 1QAOA 4RXUA 2R7NA 4ZVQA 3AGPA 3C1AA 1IATA 2WF6A 4HUJA 2E5WA 3OOEA 2WT8A 3DEHA 1W0CA 4HDKA 2VJLA 4K5QA 2B98A 2O52A 5ER9A 4UZSA 5GIOE 5ARBA 4TMKA 2YKGA 1RWPA 5ADWA 1NUSA 2Y1OA 4CM3A 1QUEA 1XEWX 2AYXA 2UUAB 2YVKA 2FZ4A 2W0MA 3CNOA 1VI5A 1T4GA 4QM6A 3N75A 4LOJA 1XZKA 1ZO8A 4FN4A 4NJEB 4F8YA 4TSFA 3VNUA 4GXTA 4I1SA 1P4GA 4IDGA 2IZ6A 4XFDA 4DA4A 3D54D 3CN9A 5HBGA 4B81A 1G38A 1JQKA 1M7GA 3HPRA 3ZWWA 5BSKA 1ISGA 2PGNA 3ZK7A 4WCFC 1TZKA 1UPFA 3LTEA 4V0SA 4AZ0A 5C5CA 1NG9A 1Z16A 5HBRA 3LAWA 4UMEA 1LFAA 1CY1A 1R5JA 4UHEA 5D6NA 2NUPB 3IDQA 3O7WA 3V4FA 1QLWA 2O14A 1C30B 4X64B 2J0QA 1H42A 4PRLA 5CD1A 4LJ7A 1VCMA 4ZZ2A 1N0WA 2J6IA 5ITSA 1WWKA 3UJ7A 1E1YA 4AG6A 3V2UA 4ZA2A 4H1VA 3AEYA 3CPSA 4L6AA 4JP5A 2OK7A 2I87A 1X94A 3L7IA 3MRSA 1UEIA 3N28A 3Q3GE 1XQ6A 4JVOA 4BNYA 4YCCA 1ATZA 1T5OA 2QBYA 3P9KA 4I5EA 5DCYA 3O8OA 3OZUA 4I0WB 4C76A 3MD9A 3INTA 2A92A 3HADA 2HV8A 3GUVA 5HOQA 1IXKA 1VA5A 1XEFA 2VNHA 4I9GA 4OQXA 3CH6A 3TFWA 1QS0B 4Q02A 1BS1A 5KX5F 5LP6A 4FM9A 4AS2A 4LZZA 1KDTA 3JAKB 4KLNA 2XXAB 1D6NA 1EFPB 2RIRA 4UEWA 2ZU0C 2XCIA 1N57A 2PT9A 2C78A 4JB2A 5LUBA 4NHEA 3FBWA 3SQXA 2R8RA 1UPTA 3C7AA 1PRYA 3DQPA 3WL4A 4EPXA 2GD6A 3QVTA 5DFAA 4UNPA 2EW8A 4ARZA 1O6ZA 3RVDA 1MX3A 3OUUA 3UT5B 5I4CA 4W6ZA 1U8ZA 1B0ZA 4QTUB 2G5TA 3PNKA 1SO8A 1XV5A 1Y3BE 3S2UA 3K2EA 1XFDA 3BQNB 1HYHA 4FHGA 3FNHA 1LVHA 4UMVA 2C2OA 4P8RA 1AUVA 3W7VA 3U62A 4RTLA 3DLIA 4MKHA 1Y7PA 4MAFA 2BF4A 1G7SA 4IFIA 1XD8A 3UT5A 5JAUA 3HFSA 1TXGA 4KIFA 1DBSA 1RWVA 3EUWA 1X7XB 4QXQA 1ODLA 4KPUB 4UVHA 3CLHA 4EO7A 4ARIA 1ZBQA 4FFNA 2DQ4A 4QKQA 2LP4Y 2ZIGA 3UWOA 2J7PD 2R8YA 2QU7A 4HDNB 4KACA 5JRJA 1W36D 1PNVA 1PR1A 4MV8A 3R7DA 3EN0A 4CIYA 2J09A 4X60A 4LC9A 3K1ZA 4ZKEA 1NBWB 4DMUB 2ZWVA 2QIPA 5B6IA 4YHHB 1XTJA 2ZT5A 2JRLA 2XZDA 3OF5A 3FF4A 1SZDA 4FYJA 4RXMA 1LD3A 2NN3C 2Z04A 3FTEA 4TMZA 2VNAA 1Q0RA 1Q1ZA 1K7XB 1P9LA 3CPEA 3D8NA 4M54A 4UW9A 1DJOA 3HE3A 2Y1EA 4DUGD 2IX9A 1ZJWA 1W4BA 4CFYA 3GJ0A 3I01M 4HT3B 3A9WA 4DLUA 2I54A 1GPDG 1MW9X 3I52A 4CZ2A 1FRVA 2DJ5A 1RP1A 2OL4A 1PJSA 3NAQA 4LEIA 4OYRA 4WRRA 2X86A 3CKMA 5BMVB 4FBGA 1KO5A 2O7SA 3R7WB 2FZ5A 1W46A 3LI2A 3WMWA 2I2FA 1JKMA 2OHXA 4L0MA 3GD5A 2WAMA 4XWYA 2R1TB 1J0CA 4B7AA 1NM5C 4JLSA 1AV7A 2VZ0A 4BEVA 1X9GA 1AQLA 1ZW1A 4POOA 3E18A 2VJAA 1JHUA 1I80A 3I09A 4BVHA 2XR1A 2W2PA 2RONA 3UJDA 4HGRA 2O8DB 3AL3A 4CTOA 3W6OA 1P77A 4B4VA 4IFBA 1JFRA 1CZHA 4V39A 4DLLA 2YXLA 4TKZA 5KNBH 2DETA 3ZDCA 2BGWA 4NZOA 3WHIA 4WFIA 4CMJA 3OY7A 4Y2HA 2Q3CA 2OBYA 1Y1SA 2F3QA 2XKBA 5HE8A 1L5KA 5BXQC 4MVJE 1YC2A 2HHAA 4FEYA 2WB2A 4HXYA 5AM5A 3ILHA 3QVLA 1BU8A 2HLHA 3UXYA 4M7OA 2ZRKA 2RIPA 3VHLB 4X7MA 2QQ0A 3O4VA 4FK8A 1OC2A 4XWWA 2R79A 5AK4A 1KDZA 2BTQA 4A6EA 3IAM6 5ALUA 1U9CA 5LQUA 3U4MA 1KYZA 4WN9B 1YB7A 3RHSA 3B9BA 3M6AA 1F8GA 5KKNB 1ENYA 2MINB 4IIHA 4PHHA 1N5LA 3DG9A 1BDMA 4WHMA 3S0JA 3VTKA 5JEDA 2QDKA 4MPTA 3C5WP 2P4HX 2QNIA 5H0IA 2HT6A 4MLZA 5K0ZA 1Q1BA 2Y1LA 2EQAA 1UJBA 3GGPA 3JQAB 4U6NA 2HB6A 5C18A 1UKBA 1WUTA 4MS1B 2J5QA 3GJ6A 1MGPA 1FSFA 4HI0E 4TPKA 2FF5A 2YJGA 3GA5A 4YP9A 3OM9A 4LKRA 4C6TB 3PF9A 3U5TA 3MUFA 4RF4A 1ZUNB 1OBVA 4NTZA 1TEVA 1V1RA 4ONEA 3W5IA 4Q3CA 1CUCA 3UAXA 4D02A 4Y6OA 3R0XA 3EA4A 3I4LA 1JKJB 3N07A 1J56A 4GU5A 3KUDA 4JROA 4CNQA 3LTNC 2BTOA 1BCRB 5G41A 1W19A 2QXYA 3PTLA 1Z5VA 2VC2B 4RX1A 2R6DA 3WO1A 3ZE1B 4RTSA 3ISJA 3P9CA 2NZWA 2LDXA 1L5HA 1DKPA 3W4IA 3F6BX 2C5HA 4XVHA 1WU8A 3UYLA 1NA5A 1OU4A 1PAUA 2CC2A 2YBDA 4QWMA 3PFKA 5GV8A 2IH4A 1U2DA 2A9JA 3ETHA 4FE7A 4WOPA 1O6GA 3OJXA 2V74B 1YV9A 3L18A 5LCXA 3RYHB 4NBSA 1JV2B 3LZ6A 1XVVA 4BQPA 1X92A 2CVHA 1WDWB 4R71A 2BBTA 3E8XA 4PINA 1I4WA 2WZCA 3K6KA 1CJVC 2ZYWX 3TEFA 3T94A 4ILKA 5F7OA 4DHWA 3UHOA 3FVTA 1WEHA 3NHFA 1BWQA 1X9IA 1XCBA 2GF9A 3CLUC 3KS9A 4NEHB 3RGGA 5FWYA 4ZOLF 2Z0MA 1RABA 3LPCA 3HO8A 1ZVMA 4N7MA 1Q22A 4V0NA 5C1BA 2HL6A 3EC7A 2PVSA 4KHPB 4WEQA 3ZU6A 1D0IA 4JEMA 3UJ9A 3A32A 3WLSA 1QANA 4C14A 3OEEA 3UT6A 4QJ3A 4RY0A 5DT9A 3PEWA 3C1TA 2IYVA 7ABPA 4NABA 3PEEA 2ZTHA 1Y34E 1C1XB 2EL7A 4M7PA 4MO9A 1F3LA 1GYQA 4E21A 1KI1A 4RTNA 3ETEA 3ITEA 1L9KA 3VZBA 4TXMA 2ZI9A 1XZMA 2IL1A 1U0TA 1YCGA 3KKEA 1GQSA 2I2DA 3MT7A 4ZT5A 2IUUA 1MO2A 3WMEA 1JSZA 3R9KA 2YL2A 1KJYA 1UZMA 3HDYA 3TUZC 3LVRE 3OZFA 3PC8A 1BMFD 2BUAA 2V5AA 4G84A 1SOWA 4DSNA 5JHGB 4M83A 3T1VA 2V7BA 3AF6A 4YR7A 2AOVA 4N18A 3P0IA 2ZDHA 2AC4A 2L69A 4HFMA 1FNSA 1R4ZA 3RANA 3VTAA 1Q17A 2IW1A 2IYQA 3SE7A 3SX4A 3BCSA 4GC9A 3MCZA 4UMFA 4C0SA 3SPXA 1XPOA 3G68A 3I3SR 3O38A 3UFXB 5GJBA 3E8MA 1XHFA 2CMHA 2XOXA 3AUKA 3LRTA 4FGLA 4C88A 1QGUB 2JFNA 2Y92A 3GRAA 2DECA 4NS1A 3ELUA 3L1IA 3AB7A 2XJ9A 1Z33A 2REQA 3LLSA 3P0RA 1ZONA 3DCNA 5AWFC 3FYHA 3X1XA 5JD5A 2NO9A 1EVIA 1NRIA 5TT1A 5AXAA 4KGXA 2ONJA 3EEYA 1SVWA 1ZRSA 3NEAA 4K3VA 2FUKA 4UFNA 5HILA 4AC9A 2O8FA 2P9TA 4MLPA 4AUNA 3F7MA 3LWBA 1A8UA 2CFOA 3JAWB 3HYSA 1RM3A 3EGEA 3VGPA 5I7UA 1Z38A 1EWRA 4UNRA 1BMDA 4HNUA 2PUJA 4L3WA 4N40A 2QTMA 1Z5ZA 3K32A 2NV2B 4H6VA 2QAGC 5K2OA 1DEXA 5J5CA 2PZLA 2FRDC 3DHNA 1O7JA 3ASYA 2Q7OE 4AMGA 3ED5A 1SG6A 3U5ZB 1QK5A 1UBGA 2Q0QA 3D7NA 4CUZA 4QVGA 1VKHA 3HNPA 3SWWA 2HSEA 3JD3A 1ZL0A 1IY1A 2ZBRA 3B3QA 5D5PA 5CHYA 2FETA 1PN3A 1PS9A 5FHRA 4C22A 4Z4HA 2Z2ZA 4X00A 1T8YA 3NHWA 4NV0A 5C5IA 1BZYA 2I7DA 2NO4A 4IIUA 1YR1A 5BYKA 4GLLA 3PGA1 1QGED 2R96A 5CB8A 3R0QA 1CVIA 2DWCA 3DOOA 1BXRB 2EWWA 3W9UA 1K6JA 3FDZB 1GL7A 4PHTA 4J94A 3ZQUA 5IVPA 2YH2A 2ZYRA 2HNKA 1LDBA 4N0QA 1Z74A 4A0SA 1HDYA 1JDZA 1FDUA 1QMGA 1CETA 2CWDA 1T3GA 4YRJA 5BWMA 1DXYA 4Q9HA 4D9NA 3A8TA 2I1QA 4MGZR 1VMDA 3AG6A 4JEUA 4JT8A 4CUJA 2P1RA 4RHEA 5K8CA 2WHEA 4CM7A 3VJMA 4M1OA 4A0GA 3GLFA 2IWRA 4RHFA 5HP4A 1MKYA 2N1MA 3PNVA 2FSHA 2C4KA 4O2BF 3U1BA 4LXIA 2GT1A 3DO8A 4GR9A 1LX7A 2P8JA 1YRBA 3H99A 1D2CA 1AM4D 3G2JA 4DS3A 4DDTA 4X1KB 4EATA 3NBZC 3AJ9A 1B00A 1QZZA 4Z7OB 4DCOA 1I6MA 4V24A 4S1WA 1CB7A 1YASA 1DIAA 4RE5A 1K0FA 4YALA 5A7GA 2HA5A 3WWZA 2ZYIA 5CHEA 5A3SA 4B79A 4C4AA 1I32A 2B78A 3TXXA 3BSSA 3CZ4A 3MPUA 4KI0A 2ANCA 1B43A 3ZR4B 1W93A 3NETA 3ZWPA 5ADHA 5CVCA 1U1EA 2QPLA 2GYYA 5HEKA 3IVMA 4ZN6A 1P81A 1H8HD 3LUJA 4FIDA 2CJFA 3IMCA 4XWAA 2CYAA 3ZYCA 4ZAVA 4EGSA 2QMHA 4CMIB 2QX7A 1YFLA 4Z9YA 3TNJA 3HFRA 2CEAA 2OQIA 4N47A 3K0KA 1TC1A 1G2OA 3BWBA 2RGEA 3K2BA 2QTGA 3AI7A 4QUKA 5B1YA 1VSVA 4JI5B 1VSUA 4EFNA 4FZ3A 4CDGA 1UAGA 2J5RA 1F0YA 2V45A 1UK6A 1Y8RB 3HMKA 4O4HA 5J4KA 4B2YA 7MDHA 2HPHA 1PR9A 3CB4A 5KTRA 2FJPA 3E7FA 3HNOA 3PP8A 3VHRA 1KQOA 3TLZA 5GM2A 1CEYA 5EXEA 4WOBA 3KELA 1X39A 3A4TA 3VNAA 1PGNA 1Y7LA 2ADFA 1Q6ZA 3EIUA 3GZNA 4M87A 4N3GA 3DMDA 1E2QA 4LYFA 2QW1A 3D4PA 4L22A 5DCWA 4G1UC 3PUVA 2ZAGA 5BQ3A 2FZCA 2K5UA 1H9AA 4C0XA 5IYZA 1UM8A 1AQNA 4GW3A 3DMPA 4C4OA 1T3LA 1AQYA 3IQDB 2Y1GA 3NHPA 4AKHA 5JY6A 3P9NA 1CZUA 1TIBA 2FW8A 4XEUA 3EG9A 4WQMA 1DC7A 1ADYA 3D6VA 4LGCA 1F1BA 1K5GA 3D6FA 3NZEA 4NK4A 3S1AB 2PSEA 4RVSA 1C8VB 3DW1X 1JFSA 3PITA 3AYXB 1PJ8A 1GDDA 1YJ5A 2YOFA 2C5LA 4Q6WA 4GZ5A 5I5GA 2A5JA 1LC0A 1CZRA 1QBGA 1T35A 3MYRA 5IC6A 2N9UA 4YX9A 1J99A 3KT8A 4IIJB 4E5KA 1RR6A 2GD2A 2HJSA 2P4UA 4G4SO 5TMBA 2DC1A 1NVGA 1UC9A 4DN6A 4XLLA 2V6BA 1SAYA 2AG8A 3JQEA 4XIYA 2R68A 4DG8A 2HUNA 4R0MA 1N8SA 4ZJUA 5HXAA 1SOMA 1NZJA 1MV8A 2HCBA 4BVJA 5J23A 2EGUA 1XMXA 2HHHB 3WIEA 2O06A 3TUJC 3UHAA 4CLRB 3QVWA 4R7GA 1WSAA 2AN9A 5ALTA 1XA3A 3OU2A 4MW4A 3RIEA 3HL0A 5KVCA 4PQRA 3JZDA 3LBNA 3QI7A 3ZPXA 3VNBA 1UMDA 2VNKA 4HGQA 4ND7A 1G21B 3KJNA 4M1SA 4YCAA 4BEJA 2C9YA 2QRZA 2XGSA 4Q4AA 2P4SA 4R3NA 3NHBA 4KPFC 1T4CA 2JIPA 2OFPA 3PWSA 5FI3A 3CR7A 4JQSA 1HNNA 4G3XA 2AW5A 4PAOA 1ZUWA 2C98A 3ETLA 4JHXA 2VSOA 3BMXA 3V8EA 4D80A 2ISQA 3R9XA 4TKUB 5E1MA 3OPNA 3NLLA 4ID9A 3TLJA 1RE1A 4EJSA 1ZOIA 4YO8A 1AHHA 3DPUA 4F46A 2HR1A 1LS6A 2CLIB 4N0EA 1IUOA 3WMRA 1H1DA 3NHYA 3WWYA 2NYRA 3BDVA 3R6TA 3DULA 2ODQA 3GYGA 2OO5A 1G0NA 4YMUA 5CITA 2GMWA 1MAVA 4PX3A 1Z0KA 5L53A 2E1RA 4PRKA 4BWVA 4RA9A 4GVPA 1ADGA 1ZMBA 2A7XA 4GM0A 3FGZA 6GPBA 1PT6A 1B1AA 2ENWA 9ATCA 1NW7A 1CP3A 3SHQA 5B1IA 2CYCA 4B0OA 4XQ0A 1TKAA 1Z68A 1DAOA 5LP6C 2AI2A 2LVBA 4H4EA 4LS3A 1G8FA 3GNLA 3U60B 2JW5A 4BFTA 2IA5A 1V48A 2MSWA 1IM2A 3N2YA 3GG2A 2Y6UA 2DR2A 4BE9A 1K6XA 3RQIA 1QOPB 1K5HA 3AHCA 3GLRA 3H5OA 3SHFA 3U7QB 2H7XA 2BMWA 2O2HA 1SCUB 4TMWA 4P86A 5AO9A 5H80A 2LW7A 4QYIA 1LLDA 1NVBA 1C7ZA 5CPBA 5AXBA 5ANRB 4UOEA 1I6WA 4YQFA 2TSYB 5C81A 3LOPA 3EDQA 2CB0A 3E22A 2JFQA 1EU1A 1P2GA 4JJIA 5ETJA 3AESB 5E6RB 1TJ4A 2TRSB 2PU7A 2NU9B 1RYMA 4P5PA 2GN0A 3OKCA 5JO9A 3WJ1A 3NC4A 4RQBA 4KPGA 3DFUA 2PY6A 2QZSA 1BO6A 2UVQA 1GPWB 1A9TA 4X95A 5EUBA 3PQ6A 1JSCA 3ZDBA 2CN1A 2NGRA 1CYDA 2JD0A 1ULAA 4XVRA 1C8LA 3OSUA 2NTVA 2NW6A 2O1XA 2GNOA 4NEQA 3X2FA 1H93A 1MQ8B 1N5KA 2BONA 2YXBA 1PLJA 3ORSA 4RHUA 1JFTA 3VU3A 1S96A 2FXVA 3GUCA 5DK6A 3ZKAA 4DV3B 2M6SA 3K6SA 1MN6A 1XQXA 5DULA 4MRMA 4Y2JA 2WZQA 3EXEB 3OT1B 4MV1A 5BQ5A 3VU0A 1JECA 3BXEA 4J03A 1JIIA 1OBOA 2FEWB 3QBDA 3N87A 5TQ2B 4OI4A 2P3SA 3TQIA 1P7CA 2PX2A 3ZDXB 4FHEA 3TLAA 1DC6A 1R6UA 2GSWA 1XXHB 1SBTA 4DCUA 1EAMA 4ZYZA 5LU9A 4KVZA 3BE4A 2B8TA 5E2BA 1R8QA 5GIPE 4MUGA 1PQPA 3E48A 3AFHA 2VBFA 2ZOSA 2P2ZA 3LWZA 1GPKA 2O0MA 3X2SA 4EG8A 3O94A 4ETIA 4MICA 1Y98A 3DAPA 1VPLA 2WWVD 1WHSB 2AD1A 1BS2A 1XUOA 2JIRA 2O2SA 2X77A 3EQ9A 2RK6A 2XMPA 2IEGA 3N59A 3ORQA 3ZCTA 1H0SA 1TPZA 1XXHA 3EEIA 4M7RA 3WLLA 3ETDA 3C70A 3BS4A 4F3KA 3GR6A 3F4KA 4IMRA 2ZIWB 1PZXA 2ECPA 2VQ3A 4PLWA 5JS7A 1LI7A 4X61A 1JTEA 2IBTA 2QSZA 3PI6A 1E4VA 3K8OE 4KPEC 4D6YA 1KK2A 3F74A 4QUBA 2VYQA 5LQDA 3V8MA 1CR4A 2JRCA 4ESVA 3S5JA 1ORHA 1NXSA 1ZGCA 3PPXA 4FHZA 3BJZA 3UC9A 3UEOA 6PFKA 2GPBA 2VUUA 1FA9A 3KB6A 1XDGA 2Z2YA 1XIVA 3GJ5A 1W30A 3B1WA 2WD9A 1G8GA 1L7XA 3LVBA 4OGKA 4U5XA 2QVBA 2NVBA 3FZNA 1JT9A 5IKEA 4GEKA 4HEJA 3LCUA 3WE7A 1N6HA 3K1AB 4KZKA 1E2MA 4OHVA 4WNCA 1MV5A 3KEQA 1KOGA 1X6VA 1SC4A 2ZB7A 5K3FA 3GLHE 3ZVNA 2HC9A 2Q6TA 4WCDA 5DYTA 2V58A 5IM4A 2PZ8A 5COBA 4W9MC 3HWX1 1EQAA 1OOEA 4LFCB 2Y9MB 1HFEL 5JBQA 1MRSA 3D5QA 3L41A 1OWOA 2I6FA 1I14A 3H0CA 4CETA 2ZAYA 1SKYB 2IFTA 3FCCA 4M55A 2XCTB 2UXBB 3IEUA 2FLKA 2H2WA 1Q1NA 3ZHZA 4WXPA 1EFHA 1F14A 2EJWA 4L7QA 1T8WA 2C3YA 1MZVA 3MYYA 4GLOA 2C8VA 2YJ4A 1U11A 4J16A 5T6MA 3HU2A 2ZROA 2WAOA 5A3RA 4UEKA 4FEGA 1RIFA 5IUKC 3VKGA 4L4RA 2QN9A 4HDNA 2PL1A 2ES4A 3LH5A 3SHTA 4EAAA 3K0BA 3UK0A 1TLLA 2I3ZA 4G86A 2QYTA 2FSVA 5AESA 2I67A 3K4HA 2AG6A 1MEJA 2EC5A 2VTDA 3DOFA 3F2VA 5EJ9A 2I91A 5EFZA 3ZWDA 4F85A 3F9RA 3ZDDA 1E3LA 3A06A 1HYQA 3OBBA 3ENWA 2H54A 4HQLA 4BO4A 2ONKA 4NY1A 3TSCA 1BJTA 3EE6A 4MRRA 1JF8A 1XXLA 2O0KA 3WLJA 4JIGA 1OW3B 4Z2YA 2GB4A 3A4NA 4EDFA 1KYXA 4LVNA 2VZEA 3TUIC 1QCDA 4E2YA 4LVUA 1C9DB 5C8DA 2VAXA 1UIRA 3FKQA 4XX1A 4EG5A 4OUDB 3O3MB 2OY0A 1X86B 3KJQA 2AK3A 2IRWA 3L8HA 1G63A 4W5HA 3TNDA 1VIDA 6CHYA 2X0IA 3PX2A 1E4YA 1UMBA 3QVGB 1YL7A 2Q3EA 3KEOA 1T26A 5E38A 1E6LA 3SYMA 3HYCA 1BFDA 3RJ9A 5HDBB 1KY5A 4JMPA 4WUVA 4DARA 1R8XA 1IBCA 2BZSA 3L5OA 4FGZA 4AKGA 1WD5A 4GMDA 2IC5A 4MO2A 4MUBA 3W6UA 4M1KA 5BUQA 5DGTA 2N1BA 4X41A 1II0A 5SYMA 4J91A 4LF6B 4QD3A 1PL0A 2PQ0A 3SYKA 2P9BA 5DPMA 3RJ5A 4B35A 1PE0A 1VHQA 1LV7A 4IIXA 3UJPA 4DY6A 3BBLA 3O3CA 1LBSA 3OC0A 4R1TA 2JFYA 1ZD1A 4XGKA 1SU7A 1ZHHA 4FOTA 5DMXA 5GQSA 1FFEA 4GR5A 1S3GA 2BJHA 4JCCA 5K3BA 1X15A 2RGBA 2UU9B 2C03A 4EELA 4ZGGA 4X6YA 4XEHA 5DMHA 5TRTA 4PNEA 3ZEIA 5CFRA 4UE2A 5IXJA 1NJ6A 4MS3B 2BMEA 2AKAB 1PFKA 3KPJA 4BGUA 3W3AH 1J2RA 1JKIA 1P6XA 2WYWA 3E9YA 3H8VA 4XJXA 4PXSA 3RFVA 3S2ZA 1L5SA 4DCMA 1ZH8A 5E7MA 1WXQA 4YRFA 5IEBA 3SZOA 3U26A 2Q8NA 3ROQA 1U8UA 4O2AA 3G0CA 1OYVA 5KX5B 2P2SA 2Z3VA 3SIXA 3T7SA 3VU8A 4C4ZA 4DKXA 3I2KA 4QQKA 1FFXB 2NACA 4JA0A 4UDNA 5FXMA 3LO5A 3Q98A 1QIJA 5DHFA 3ICEA 3UXMA 5KTYA 2WVGA 1Z39A 2Q2QA 1C2YA 2PGLA 1FP2A 3O2NA 2VJCA 5TNXA 2WHPB 2H92A 4HQRA 4DT1B 3K9BA 5HX7A 2XGMA 4QU8A 3IKMB 1XDSA 2ZK7A 3V32A 5BV2P 1XB2A 4LYHA 3PGXA 3OU6A 4Z9AA 3DSRA 4KKVA 2BKAA 4P3PA 4PAMA 3FGNA 3C6BA 2PLAA 3PJFA 4QUHA 2PL5A 4DLBA 1I5OA 1C3VA 1AZLA 2PH7A 3MC1A 4LV8B 1HL7A 4O4JF 5AQEA 2B92A 3SEQA 2OCIA 3KQSA 3QYAA 3V6LA 3GUZA 1CRLA 3PS9A 2I5PO 5LL6P 1AUXA 1X1RA 3IBGA 4MQ5A 3VR6A 1HDCA 2MYNA 2X5XA 3EPPA 2ZXUA 4JJEA 3RD5A 4Q48A 2Q5LA 1EDZA 3K09C 5CT9A 1H4QA 2JFZA 3RVPA 3X44A 4BIIA 2AE2A 2ZTVA 3OQNA 2GASA 4D9BA 4KLCA 3SLGA 5C1OA 2HGZA 3I5AA 1E6CA 1XTVA 2D4AA 2ID8A 3PNBA 3T7CA 1D6SA 3M4XA 3ZD9A 4AJPA 4EX6A 4YRSA 3T7TA 2GPJA 5DM2A 4IXWA 1IMOA 1YDMA 2H51A 4BYMA 1P45A 1FJ2A 3I9V6 5IKMA 1T5IA 1QK4A 2W4MA 1NAIA 1U5BB 3AF0A 4F2HA 2J9FA 1HTTA 4HH3C 5GONB 3SLKA 4YONB 5HJ5A 3TFQA 4QFDA 5CDHA 3HVKA 3JV7A 4PRYA 4R69A 1M8KA 1TVEA 3E5HA 1YVDA 3OQ1A 2OKCA 3ECCA 1K0UA 1ZSVA 2AJCA 2FPUA 3RSGA 3A1CA 5LYJA 2AZMA 4M8IA 2W9XA 2R1UA 3Q9NA 2XBMA 2P6OA 4ITRC 4NCNA 2I3BA 2P90A 3IAEA 4PZ0A 1KOJA 1WM1A 2DG2A 2F59A 3N0TA 4Z8YA 1EDBA 1J1ZA 3A6KA 4DR5B 1BDJA 4YLGA 1XLWA 1N1MA 2I76A 3OA2A 4QYXA 1BWPA 2FTKE 3HGQA 5AK5A 2WY2D 3E1SA 3PXEA 1AS2A 2ZXEA 3TTYA 2H2DA 1SWVA 2QJWA 5JTTA 3P9RA 1IJBA 2QL9A 1D1QA 3EVFA 5AJHA 3KBOA 4ARBA 1QNFA 2HEGA 2J9XB 1YS4A 3EHEA 1MENA 2E0IA 5F2OA 2OWEA 1KOLA 4BMDA 5LKAA 2B7LA 1CJSA 1QKIA 1KJ8A 4W1QA 3W0LB 1L5LA 4Z54A 3IEPA 5D3KA 5BR1A 3QKSA 4PS1A 4ZALA 4IDPA 2DBZA 2LR0A 1OX5A 5JZSA 3AZPA 5H8WA 1YF3A 4CKBB 3PGMA 1ONSA 5F9HA 2B2NA 1P4AA 3BEOA 4YRLA 1ECCA 3NH9A 1BVYF 2ZU6A 3V8BA 1W25A 1DKLA 3ZV6A 2YS7A 4OK3A 2HZ7A 3K9LA 1OASA 1Y7IA 1WW3A 2TMYA 4WJLA 1FU8A 1F48A 2MHCA 1U8FO 1JFFA 4EOGA 2OXTA 3WLHA 1P17A 3QJGA 4ML3A 4Q9LA 3F3YA 3QLJA 4HPWA 1O9GA 5A4JA 4MCIA 1R9JA 2LGJA 1XX6A 3KSRA 4FYPA 4QQRA 5KTSA 3L4JA 2FK8A 1UKYA 1QNLA 3B3FA 3NAMA 3HKBB 3PHCA 3I2IA 2C84A 1KZ7B 2VUHB 1PL8A 3JZIA 4FBMA 4NL4H 5D3ZA 4EW1A 3OIFA 3OTOB 1JDPA 1VJ5A 1Y9DA 1Z6YA 2PH5A 1NBME 2MSCB 1UOEA 4M9RA 2CF6A 3OCYA 1RHKA 2DY1A 1FL9A 5IJZA 5CCXA 2AQHA 3FYCA 4KRYA 2MSKA 1T5HX 3W2FA 3A0UA 1W581 2QP9X 2YFQA 4S2UA 4KOEC 3I2JA 1NNEA 5H4GA 2WM9B 4PLTA 1WBBA 2DUJA 3IPXA 4LK3A 4TVSA 3SX2A 3RUAA 4LXXA 3UAZA 4B3GA 1HBJA 3N5KA 2QRPA 4EHHA 2HRZA 2C54A 4XXHA 5EHZA 5DLEA 1N1DA 2G06A 5C3MA 3VHXA 3QU9A 1USVA 2P9FA 1MVOA 3EQ2A 4G26A 4NICA 4RM2A 2QV0A 2D7DA 2PKCA 1KBOA 4AZ3A 2BBSA 3WKDA 3KE9A 5JNSA 4JKIA 4EQ6B 4MR8B 5EZYA 5JBNA 4BL5A 4BYGA 4GBGA 2R0QC 2KM1A 4HF7A 2NWQA 4JS0A 2QAGB 3W9SA 1KO7A 1QQ5A 1IN1A 1PGPA 4MJLA 2WQ7A 1XPJA 3FNBA 4ZC1A 1N5MA 3JQFA 3JYOA 2GI4A 3WLEA 5K3DA 4F12A 1R6VA 1SQGA 4LTNA 2XYPA 1W73A 2WIBA 3EVBA 3G5MA 4MRMB 3UA4A 1SURA 4B8WA 1BH2A 2YY5A 3FNIA 1IBLB 5K6AC 5DP2A 5TT0A 2EFGA 2Z1DA 3Q7EA 3VPBA 5BSMA 3VZRA 3QOXA 1SXQA 3EVCA 3G6WA 3V4PB 1SXJA 1YI8A 5HM8A 2BC9A 4MWZA 2GYWA 2H0QA 1SKBA 4QUJA 3NG1A 1FS5A 2NNLD 1SOUA 3HQ4O 5AW9A 3U6BA 3E7PA 2XMBA 3CJTA 1RIIA 4I8IA 3BMOA 3KKLA 4MP6A 4IL5A 1FZTA 2BFBA 1ZICA 2X6RA 3CSSA 3QVKA 1DOAA 1YKFA 3D3KA 4U9HS 4NCXA 5ALYA 3FMVA 5IYZF 1V9SA 2O3TA 3VKWA 1O4WA 3WGKA 3NJ8A 3DVSX 3JYPA 4FFLA 1H1LA 3WZMA 3F6EX 2B4AA 2JAXA 1II8B 1PR3A 1XQWA 3CV3A 1M0SA 1R0RE 1YJBA 1U0GA 2PWPA 3FLMA 3PYLA 1YD7A 4HLQB 4P4LA 1JHXA 1JIJA 1NVTA 3PQDA 1YI0A 3S2EA 2DQYA 3PFFA 4FGSA 2HSGA 3T5BA 3E9NA 3KQKA 4K28A 2RJOA 3MTIA 2EBHX 2M1XA 3EFBA 4JITA 5HF9A 2CNNA 1YR9A 4OSPA 1SMKA 2G9VA 3S55A 4L4UA 1BA2A 4V1CI 1ORTA 4FMCB 4MYSA 1PGQA 2I29A 5ADVA 1LFDB 3H2ZA 3I8OA 4INOA 5A4IS 2BGJA 2GUWA 3QMWA 3PJGA 4UREA 2HHCA 3JQRA 1KYIA 3WMFA 4MDFA 1B7GO 2E4UA 2WA2A 1M34E 1Z3IX 3UKOA 4AKTA 5CVJA 3ICWA 3OIYA 2QKYA 4DIKA 2ZYVX 4FNAA 2HWKA 4HUTA 5KC9A 2DY0A 4Q21A 2G4CA 2HT1A 2YMQA 3PVZA 4DRXA 3A1NA 1ORWA 2WAAA 3QI2A 3EQ8A 4HADA 1JIKA 4JLMA 4QPJC 3W34A 4EITA 7REQA 1P91A 3GEEA 3NRJA 3GLVA 2QJTA 2F8LA 3THSA 3UXEA 2H4FA 2ODBA 3AI1A 2GCOB 4RIIA 4P93A 5DASA 1I7NA 4BNDA 1R12A 3FDXA 3UHJA 3V7WA 4D9MA 4FWTA 4PIVA 3LXMA 4UHCA 1EHCA 2AZDA 1BDIA 4JI0B 5BN3A 3KTFA 3FLEA 4YBZA 5T6BA 1RI2A 2B1JA 4HLDA 3WGGA 2OAEA 4PTYA 5C8YA 1MXHA 2Y71A 3TSYA 1XK7A 3EISA 3G23A 4ZKDA 2HPVA 3RS2A 1ZQ9A 3E7XA 1Q1EA 1NMYA 2FKNA 5DP1A 1J1UA 2Q46A 1QHXA 3A3KA 2NX2A 4O2BB 3B5EA 3UTCA 3GFGA 3CLVA 2A0YA 3WQRA 3GO4A 2IJGX 3N2IA 2A30A 2WUEA 5IX8A 3B9RA 3OQBA 1R5NA 4M1YA 5E4JA 1CNEA 1TJPB 1RRKA 1YAJA 1SRQA 3H1GA 1O87A 1PW5A 1UZAA 1J2EA 4MTCA 5I9MA 1JLLA 1P75A 3R3SA 4CKEA 3NM6B 4RV5A 4H1WA 3W9YA 2GM4A 1KFBB 3IAS6 3N8GA 2FHPA 4D1YA 1RVV1 4A8TA 2GAOA 2HN9A 3EH2A 4BNZA 1NDHA 3D4BA 1NZDA 1B6SA 2EATA 4P92A 4K9LA 4F6RB 5CDGA 4X6LA 3PXCX 5AXCA 2XDWA 2O4UX 4GLBA 4GX2A 3WRYA 5LUAA 2P5UA 3F6YA 4MVXA 5DXAA 4I46A 1DG9A 4YAJA 3TLXA 2BFDB 3TWOA 3ZGOA 1U7OA 2JH9A 2CLKB 3BQMB 4UXJA 1YGPA 4IXDA 2VP6A 1AX9A 1YB5A 1FVFA 1F3OA 4HVTA 3MTEA 4CEJA 2I6XA 1K86A 2XHEA 3R5KA 4J0JA 5BN4A 4ZVUA 1VPWA 1B8UA 5EP3A 2WP8J 2WSMA 4V0OA 5AD1A 1JWLA 2P2NA 1C7RA 1QM5A 2I65A 4CV3A 1FFYA 1U3CA 3I9V1 4ZVNA 4MR7B 1GNRA 3ROTA 2II6A 1SUCA 5BOSA 5MN5A 3LGAA 3COYA 5EINA 2ZJFA 2ZRDA 5CVVA 3P9QA 4N03A 1RM4A 3JYLA 2E9SA 3G8BA 3ZTTA 2B82A 5F52A 1GTRA 1D2HA 4C7BA 1D09A 4QPCA 2D1RA 4GQBA 3WIUA 1Y8ZA 2IS1A 3ZHCA 1Z9BA 4QBFA 4L5AA 2XBUA 1QGZA 3GGOA 2FFRA 2XF8A 4L3VA 1O2DA 1SELA 1YVRA 2HSDA 5I7EA 3OX3A 5T3UA 1H3NA 1MO4A 3CZCA 5KOJB 2VDUE 3VH3A 3VR3A 4MQLA 2MT9A 1ZK1A 3BJRA 3EVDA 5JDIC 1SNYA 1PT5A 3ONDA 4UATA 4Q7LA 3GLSA 4KR9A 4LRWA 4MPJA 1KAEA 5SZHB 1RPNA 3RDPA 2RGNA 1ZOPA 1RMTA 4I81A 3HKCA 1QYWA 3HXQA 2CNLA 2YWEA 1V8OA 2Q5FA 1WSWA 2FWBA 3WIOA 3PXDA 3PFBA 3GXOA 4H3HB 1P6UA 1US8B 1XJ0A 3ZDYB 1EP1B 5DCUA 5HSGA 1X8LA 2XSZD 3FVRA 2IPMA 3BWYA 3DMTC 4D9IA 2ZRAA 4R2MA 2GUGA 2OV6A 3LYUA 2GEVA 2J85A 2Q3HA 2H17A 3FPCA 1YL5A 3GBVA 3UMBA 4XVUA 3EFHA 4C6TA 2C9ZA 4HDSA 4Z99A 3VOTA 4EI8A 4AY2A 3IOYA 4V3CA 2GKSA 4A7PA 3M5CA 1Z7BA 4NBVA 1Q91A 2VXCA 3HR4A 3MMZA 4Y1FA 1KQPA 1UFQA 1VL8A 3UVEA 3IGFA 3IILA 3UJAA 2COEA 1QKKA 2IEBA 3RGWS 3ST7A 1C9EA 3WNBA 4GZ3A 2F3UA 4DV4B 4R9SA 2O8NA 3T3OA 3VYWA 4A0FA 4KBYA 4F21A 1EZZA 5JVDA 5L3QA 4Q93A 2XUAA 4BLSA 2FW6A 2X0JA 5JDCC 3S7TA 4AZ0B 3GGSA 5TR9A 1Z2CA 1BE8A 5CEFA 1M1NB 4C6HA 5DX8A 2JKZA 4E09A 1EDEA 1NE2A 3N8HA 2V7TA 3F6PA 4KQHA 5JYCA 2BFWA 1ZGZA 3HYRA 3RASA 3VZQA 2GRAA 1VHDA 4A8JC 3AMVA 3N74A 1LV8A 1U7UA 3DGFC 1HDXA 3GD7A 5K99A 1RWMA 3B38A 4N5HX 3T4XA 4DWOA 5DTEA 1U81A 5CA0A 4EYEA 2XZLA 1U0OC 2QT9A 2IBMA 1RLIA 2WC1A 4UD6A 5AIAA 4AY5A 2ZCJA 1QHIA 2A6PA 3F5MA 1EQ2A 1Z83A 1TKRA 1Z63A 1GOTA 1JEQB 4IJ6A 3ZD7A 1VHLA 3QTLA 1KQ3A 5ILQA 3PD1A 3BF8A 4LK2A 3BORA 5FJIA 2RK3A 2AMYA 1M6HA 2IU6A 2O2JA 5A3JA 3UMCA 5MF6A 1Z4MA 3F1KA 4ZVVA 4QWWA 4ND1A 4ATNA 5U1PA 3V7FA 1UXIA 3TQQA 3DBHB 2PR7A 4YNBA 4AXXA 1IXYA 2VTEA 1QTRA 5DKFA 2PZGA 4IGEA 1QCZA 2Y0PA 1T15A 3EUFA 1WOMA 3PQ7A 1EJBA 3ASZA 3N2KA 1NNUA 5BVGB 3AF1A 5KKCA 1KQGA 2OXCA 4AJ2A 3LC2O 4OJNA 3FOAA 4IJMA 1Y4AE 3CZPA 1L5FA 4JR0A 1YB2A 2NAPA 5BVHA 1AHNA 4M1EA 4IH9A 3A1UA 3LLCA 2QD4A 4NJMB 1U0RA 1NW8A 2ZUTA 4BU1A 3I72A 3KJXA 2EFHB 3OFSA 4HWPA 3Q7PA 3NDJA 4YWJA 1CS0B 1KS9A 1T2AA 4LDAA 3KUUA 1Y7TA 2BIFA 3DL2A 1UBMS 1WLSA 5GONF 3W8NA 4F60A 1KEKA 1ECBA 3EGXB 4TROA 1P2TA 1FMFA 5IK2D 5IK2A 5C32A 4BNGA 2I55A 1ZD3A 2P2DA 2PSFA 4NZYA 5E8RA 1OH8A 2HRRA 2V54A 4WCFB 4ZO7A 4TLAA 2HMWA 2JVJA 3BA6A 4CL2A 3WBFA 2H48A 3W2GA 4YLEA 4EKNB 3S6JA 1M6EX 4URYR 1AA9A 1G16A 1SD2A 2DLNA 2I3GA 2GPSA 2QRVB 2SBTA 2JD2A 4WDRA 1BE0A 5CFOA 3DTNA 3WS7A 4RFSB 4BLRA 3THWA 1JHRA 2ZI7A 3U3JA 3AIMA 1JB9A 2E5FA 1XRQA 2X1HA 2JHPA 2O57A 3CO0S 3DV0B 3HGTA 3LFHA 3VKUA 4F45A 1QLJA 5I3CA 3L4KA 4G5HA 4B3FX 2PX5A 4S05A 2QSJA 1HFJA 1RYZA 4HZIA 4MLCA 4X1YB 4N41A 3EMVA 3K8ZA 4O4LB 1GADO 2JGMA 3OECA 1U8EA 1O95A 3KKOA 4N0PA 3OCUA 3AY6A 2IOFK 1GQ2A 1QP8A 4JNCA 4PYNA 1YQGA 3JRXA 2JIBA 3IV7A 4JU9A 4TOIA 2OGWA 2W6CX 1B8VA 3OC6A 1JR3A 1UMCB 2D06A 2WIJA 3GHYA 1RNLA 3GC6A 3KYCB 1B8NA 4JLJA 4GC5A 5SICE 1TRKA 1GV0A 2XGOA 3KLMX 4M0FA 4X90A 4D46A 2Z4TA 3BFVA 3MS7A 1GPMA 1KI6B 1U2TA 2ZTUA 2HHJA 4KQFA 4ALJA 5TPWA 4Y2UA 3RV3A 1U5BA 1RACA 2O1EA 4NENB 4Q4LA 3ILYA 4RVFA 4TTAA 5LC1A 5T3YA 4UHJA 1D1TA 2WVJA 3O47A 1H8ED 1E9BA 2J67A 4HQFA 4TTVA 4KDEA 3TSWA 4EKGA 4YPOA 1DOHA 3D7LA 4CM9A 4EG1A 3LUCA 3L7CA 1F0PA 1SM4A 4BNWA 3UMRA 5A9RA 3ZDAA 2H5JA 1C8BA 3SIRA 2R4QA 3K05A 1SU4A 3HH8A 1PQWA 3HUTA 4HX5A 3U1TA 5B30A 3I5MA 5EIXA 3NBXX 4HQKA 4KRXA 4F0JA