1Y7OA

The structure of streptococcus pneumoniae a153p clpp
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
192
structure length
171
Chain Sequence
IPVVIESYDIYSRLLKDRIIMLTGPVEDNMANSVIAQLLFLDAQDSTKDIYLYVNTPGGSVSAGLAIVDTMNFIKADVQTIVMGMAASMGTVIASSGAKGKRFMLPNAEYMIHQPMAPEHLLKTRNTLEKILAENSGQSMEKVHADAERDNWMSAQETLEYGFIDEIMANN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The ClpP double ring tetradecameric protease exhibits plastic ring-ring interactions, and the N termini of its subunits form flexible loops that are essential for ClpXP and ClpAP complex formation.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase
molecule keywords ATP-dependent Clp protease proteolytic subunit
total genus 56
structure length 171
sequence length 192
chains with identical sequence B, C, D, E, F, G
ec nomenclature ec 3.4.21.92: Endopeptidase Clp.
pdb deposition date 2004-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00574 CLP_protease Clp protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 1y7oA00
2ZL4A 2VSSA 2GTRA 3P2LA 3QREA 4ZDBA 5INGA 5DZKA 3V5EA 3KTIA 5IKLB 5DUFA 3H0SA 3P5MA 3U9TB 1EF9A 5DU8A 3N6RB 2EJ5A 4Q1IA 1O8UA 3QMJA 3R9QA 3KTJA 2Q2XA 3VIVA 4ELWA 2D3TA 2ZL2A 4RYFA 4ELSA 1X0UA 4MI2A 3ZWBA 3TRRA 2IEXA 3BF0A 2QQ3A 3OMEA 3TLFA 4YLHA 1RJNA 2VSSE 4MOUA 3ST9A 3NJBA 4DI1A 3HP0A 2NP9A 1OD4A 1N6DA 4RYFH 1FC6A 2F9IB 4RCNA 5E0SH 3K50A 4JCRA 1WZ8A 4FZWC 4LK5A 4KD6A 4K29A 4U0GA 2C8TA 1NZYA 4KPKA 3T8BA 4KWBA 2A81A 5CTCA 3IAVA 3Q1TA 2UZFA 1UYSA 4U0HA 1HNUA 4F47A 1XNYA 1HNOA 3WG5A 4NEKA 1PIXA 5G1QA 1FCFA 4ASIA 1XNVA 1ON3A 3H02A 3RSTA 2J5II 1FC9A 3R0OA 3SLLA 3TVWA 1YG6A 3TVUA 1VRGA 1XX4A 3M6NA 2PPYA 1NZYB 5INIA 2F6IA 4QIJA 1HZDA 4L8KA 5DUCA 2X58A 3BEZA 3NJDA 2ZQRA 1SZOA 3KTHA 2J5IB 4B3HA 2F9YB 4I52A 1UYVA 4EMLA 1JXZA 1N6EA 1WDLA 2VSUE 1WDMA 5DL1A 4JCTA 3PEAA 2PG8A 4WYOB 3OT6A 1EF8A 3TT6A 1TYFA 3HINA 1EY3A 5JBXA 4JSBA 4FZWA 1N6FA 3Q0JA 5DU4A 2VREA 4JWVA 2DUBA 3QYRA 3H0UA 2A7SA 4MXIA 4ELXA 4ZDEA 4B3JA 3IBBA 5DZKH 3G64A 2F6QA 2CBYA 3T88A 4HC8A 3TZ3A 2J5SA 1XNWA 3GLMA 4OMRA 5DU6A 3RSIA 5KJPA 2ZQQA 5JBWA 1UYTA 4JOTA 4ZDFA 4G2RA 5KDRB 3M6MA 4L6WA 2BZRA 3ZWCA 4HNKA 4I42A 3QXZA 2J5GD 3IB9A 4K2NA 3LAOA 3TT7A 4QIIA 2ZL3A 4JCSA 1K32A 2F9YA 4Q0GA 4WCZA 4FNDA 3GKBA 4EMMA 5DTWA 2DEOA 2FBMA 2HW5A 2X24A 5G1SA 3ISAA 1J7XA 4IZDA 4JYLA 3MYBA 4IZCA 3PE8A 3QK8A 5FIFA 3ZW9A 3MFMA 4I4ZA 3T8AA 4FN8A 1OD2A 3QWDA 1SG4A 5FUSA 4B3IA 5E0NX 2J5IA 3KTGA 4ZDCA 2A7KA 3U9RB 1UYRA 1RJMA 3H0JA 4K3WA 4JVTA 4KNPA 3Q7HA 1K39A 4JJTA 2PBPA 1Y7OA 2CE3A 1ON9A 5DKPA 4ZDDA 4Z0MA 2WTBA 3U9SB 3DJAA 3R9TA 4GM2A 3R6HA 2J5GA 3ZWAA 5C90A 3L3SA 2VSSF 3TV5A 2FZSA 2F9IA 5KDRA 5DTPA 2VSUC 3JU1A 3MT6A 3V5IA 3R9SA 4IZBA 3H0QA 3Q0GA 5INFA 3GF7A 3GMAA 3OC7A 2VSUA 3H81A 4ZU2A 2VX2A 4GHNA 3BPPA 4JCQA 1XO6A 1Q52A 4FNBA 3T3WA 4JFCA 2Q35A 4JYJA 4WZ8B 4OLQA 4EMPA 4FJWD 4QFEA 2W3PA 1W2XA 3I47A 5CTBA 4OG1A 4FB8A 1DCIA 2FW2A 3PGQA 3PZKA 4NNQA 2ZL0A 3SWXA 1DUBA 1FC7A 4U1AA 3RRVA 3KTKA 3MOYA 3FF6A 3FDUA 1Q51A 1YG8A 1PJHA 3K8XA 3HRXA 5MGBA 3DORA 2VSUF 1MJ3A 3HLN1 4U19A 4U0GH 2Q34A 5C9GA 1TG6A 3STAA 3LKEA 4U18A 3TDCA 3ZW8A 3HE2A 1WDKA 3QXIA 3GF3A 3T89A 5G1RA 5E0SA 3KQFA 1UIYA 4FN7A 3QKAA 3P85A
chains in the Genus database with same CATH superfamily
2ZL4A 2VSSA 2GTRA 3P2LA 3QREA 4ZDBA 5INGA 5DZKA 3V5EA 3KTIA 5IKLB 3BPTA 5DUFA 3H0SA 3P5MA 3U9TB 1EF9A 5DU8A 4J2UA 3N6RB 2EJ5A 4Q1IA 1O8UA 3QMJA 3R9QA 3KTJA 2Q2XA 3VIVA 4ELWA 2D3TA 2ZL2A 4RYFA 4ELSA 1X0UA 4MI2A 3ZWBA 3TRRA 2IEXA 3BF0A 2QQ3A 3OMEA 3TLFA 4YLHA 1RJNA 2VSSE 4MOUA 3ST9A 3NJBA 4DI1A 3HP0A 2NP9A 1OD4A 1N6DA 4RYFH 1FC6A 2F9IB 4RCNA 5E0SH 3K50A 5HUQA 4JCRA 1WZ8A 4FZWC 4LK5A 4KD6A 4K29A 4U0GA 2C8TA 1NZYA 4KPKA 3T8BA 4KWBA 2A81A 5CTCA 3IAVA 3Q1TA 2UZFA 1UYSA 4U0HA 1HNUA 4F47A 1XNYA 1HNOA 3WG5A 4NEKA 1PIXA 5G1QA 1FCFA 4ASIA 1XNVA 1ON3A 3H02A 3RSTA 2J5II 1FC9A 3R0OA 3SLLA 3TVWA 1YG6A 3TVUA 1VRGA 1XX4A 3M6NA 2PPYA 1NZYB 5INIA 2F6IA 4QIJA 1HZDA 4L8KA 5DUCA 2X58A 3BEZA 3NJDA 2ZQRA 1SZOA 3KTHA 2J5IB 4B3HA 2F9YB 4I52A 1UYVA 4EMLA 1JXZA 1N6EA 1WDLA 2VSUE 1WDMA 5DL1A 4JCTA 3PEAA 2PG8A 4WYOB 3OT6A 1EF8A 3TT6A 1TYFA 3HINA 1EY3A 5JBXA 4JSBA 4FZWA 1N6FA 3Q0JA 5DU4A 2VREA 4JWVA 2DUBA 3QYRA 3H0UA 2A7SA 4MXIA 4ELXA 4ZDEA 4B3JA 3IBBA 5DZKH 3G64A 2F6QA 2CBYA 3T88A 4HC8A 3TZ3A 2J5SA 1XNWA 3GLMA 4OMRA 5DU6A 3RSIA 5KJPA 2ZQQA 5JBWA 1UYTA 4JOTA 4ZDFA 4G2RA 5KDRB 3M6MA 4L6WA 2BZRA 3ZWCA 4HNKA 4I42A 3QXZA 2J5GD 3IB9A 4K2NA 3LAOA 3TT7A 4QIIA 2ZL3A 4JCSA 1K32A 2F9YA 4Q0GA 4WCZA 4FNDA 3GKBA 4EMMA 4NARA 5DTWA 2DEOA 2FBMA 2HW5A 2X24A 5G1SA 3ISAA 1J7XA 4IZDA 4JYLA 3MYBA 4IZCA 3PE8A 3QK8A 5FIFA 4HDTA 3ZW9A 3MFMA 4I4ZA 3T8AA 4FN8A 1OD2A 3QWDA 1SG4A 5FUSA 4B3IA 5E0NX 2J5IA 3KTGA 4ZDCA 2A7KA 3U9RB 1UYRA 1RJMA 3H0JA 4K3WA 2YJGA 4JVTA 4KNPA 3Q7HA 1K39A 4JJTA 2PBPA 1Y7OA 2CE3A 1ON9A 5DKPA 4ZDDA 4Z0MA 2WTBA 3U9SB 3DJAA 3R9TA 4GM2A 3R6HA 2J5GA 3ZWAA 5C90A 3L3SA 2VSSF 3TV5A 2FZSA 2F9IA 5KDRA 5DTPA 2VSUC 3JU1A 3MT6A 3V5IA 3R9SA 4IZBA 3H0QA 3Q0GA 5INFA 3GF7A 3GMAA 3OC7A 2VSUA 3H81A 4ZU2A 2VX2A 4GHNA 3BPPA 4JCQA 1XO6A 1Q52A 4FNBA 3T3WA 4JFCA 2Q35A 4JYJA 4WZ8B 4OLQA 4EMPA 4FJWD 4QFEA 2W3PA 1W2XA 3I47A 5CTBA 4OG1A 4FB8A 1DCIA 2FW2A 3PGQA 3PZKA 4NNQA 2ZL0A 3SWXA 1DUBA 1FC7A 4U1AA 3RRVA 3KTKA 3MOYA 3FF6A 3FDUA 1Q51A 1YG8A 1PJHA 3K8XA 3HRXA 5MGBA 3DORA 2VSUF 1MJ3A 3HLN1 4U19A 4U0GH 2Q34A 5C9GA 1TG6A 3STAA 3LKEA 4U18A 3TDCA 3ZW8A 3HE2A 1WDKA 3QXIA 3GF3A 3T89A 5G1RA 5E0SA 3KQFA 1UIYA 4FN7A 3QKAA 3P85A
chains in the Genus database with same CATH topology
2ZL4A 2VSSA 2GTRA 3P2LA 3QREA 4ZDBA 5INGA 5DZKA 3V5EA 3KTIA 5IKLB 3BPTA 5DUFA 3H0SA 3P5MA 3U9TB 1EF9A 5DU8A 4J2UA 3N6RB 2EJ5A 4Q1IA 1O8UA 3QMJA 3R9QA 3KTJA 2Q2XA 3VIVA 4ELWA 2D3TA 2ZL2A 4RYFA 4ELSA 1X0UA 4MI2A 3ZWBA 3TRRA 2IEXA 3BF0A 2QQ3A 3OMEA 3TLFA 4YLHA 1RJNA 2VSSE 4MOUA 3ST9A 3NJBA 4DI1A 3HP0A 2NP9A 1OD4A 1N6DA 4RYFH 1FC6A 2F9IB 4RCNA 5E0SH 3K50A 5HUQA 4JCRA 1WZ8A 4FZWC 4LK5A 4KD6A 4K29A 4U0GA 2C8TA 1NZYA 4KPKA 3T8BA 4KWBA 2A81A 5CTCA 3IAVA 3Q1TA 2UZFA 1UYSA 4U0HA 1HNUA 4F47A 1XNYA 1HNOA 3WG5A 4NEKA 1PIXA 5G1QA 1FCFA 4ASIA 1XNVA 1ON3A 3H02A 3RSTA 2J5II 1FC9A 3R0OA 3SLLA 3TVWA 1YG6A 3TVUA 1VRGA 1XX4A 3M6NA 2PPYA 1NZYB 5INIA 2F6IA 4QIJA 1HZDA 4L8KA 5DUCA 2X58A 3BEZA 3NJDA 2ZQRA 1SZOA 3KTHA 2J5IB 4B3HA 2F9YB 4I52A 1UYVA 4EMLA 1JXZA 1N6EA 1WDLA 2VSUE 1WDMA 5DL1A 4JCTA 3PEAA 2PG8A 4WYOB 3OT6A 1EF8A 3TT6A 1TYFA 3HINA 1EY3A 5JBXA 4JSBA 4FZWA 1N6FA 3Q0JA 5DU4A 2VREA 4JWVA 2DUBA 3QYRA 3H0UA 2A7SA 4MXIA 4ELXA 4ZDEA 4B3JA 3IBBA 5DZKH 3G64A 2F6QA 2CBYA 3T88A 4HC8A 3TZ3A 2J5SA 1XNWA 3GLMA 4OMRA 5DU6A 3RSIA 5KJPA 2ZQQA 5JBWA 1UYTA 4JOTA 4ZDFA 4G2RA 5KDRB 3M6MA 4L6WA 2BZRA 3ZWCA 4HNKA 4I42A 3QXZA 2J5GD 3IB9A 4K2NA 3LAOA 3TT7A 4QIIA 2ZL3A 4JCSA 1K32A 2F9YA 4Q0GA 4WCZA 4FNDA 3GKBA 4EMMA 4NARA 5DTWA 2DEOA 2FBMA 2HW5A 2X24A 5G1SA 3ISAA 1J7XA 4IZDA 4JYLA 3MYBA 4IZCA 3PE8A 3QK8A 5FIFA 4HDTA 3ZW9A 3MFMA 4I4ZA 3T8AA 4FN8A 1OD2A 3QWDA 1SG4A 5FUSA 4B3IA 5E0NX 2J5IA 3KTGA 4ZDCA 2A7KA 3U9RB 1UYRA 1RJMA 3H0JA 4K3WA 2YJGA 4JVTA 4KNPA 3Q7HA 1K39A 4JJTA 2PBPA 1Y7OA 2CE3A 1ON9A 5DKPA 4ZDDA 4Z0MA 2WTBA 3U9SB 3DJAA 3R9TA 4GM2A 3R6HA 2J5GA 3ZWAA 5C90A 3L3SA 2VSSF 3TV5A 2FZSA 2F9IA 5KDRA 5DTPA 2VSUC 3JU1A 3MT6A 3V5IA 3R9SA 4IZBA 3H0QA 3Q0GA 5INFA 3GF7A 3GMAA 3OC7A 2VSUA 3H81A 4ZU2A 2VX2A 4GHNA 3BPPA 4JCQA 1XO6A 1Q52A 4FNBA 3T3WA 4JFCA 2Q35A 4JYJA 4WZ8B 4OLQA 4EMPA 4FJWD 4QFEA 2W3PA 1W2XA 3I47A 5CTBA 4OG1A 4FB8A 1DCIA 2FW2A 3PGQA 3PZKA 4NNQA 2ZL0A 3SWXA 1DUBA 1FC7A 4U1AA 3RRVA 3KTKA 3MOYA 3FF6A 3FDUA 1Q51A 1YG8A 1PJHA 3K8XA 3HRXA 5MGBA 3DORA 2VSUF 1MJ3A 3HLN1 4U19A 4U0GH 2Q34A 5C9GA 1TG6A 3STAA 3LKEA 4U18A 3TDCA 3ZW8A 3HE2A 1WDKA 3QXIA 3GF3A 3T89A 5G1RA 5E0SA 3KQFA 1UIYA 4FN7A 3QKAA 3P85A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZL4 A;  2VSS A;  2GTR A;  3P2L A;  3QRE A;  4ZDB A;  5ING A;  5DZK A;  3V5E A;  3KTI A;  5IKL B;  5DUF A;  3H0S A;  3P5M A;  3U9T B;  1EF9 A;  5DU8 A;  3N6R B;  2EJ5 A;  4Q1I A;  1O8U A;  3QMJ A;  3R9Q A;  3KTJ A;  2Q2X A;  3VIV A;  4ELW A;  2D3T A;  2ZL2 A;  4RYF A;  4ELS A;  1X0U A;  4MI2 A;  3ZWB A;  3TRR A;  2IEX A;  3BF0 A;  2QQ3 A;  3OME A;  3TLF A;  4YLH A;  1RJN A;  2VSS E;  4MOU A;  3ST9 A;  3NJB A;  4DI1 A;  3HP0 A;  2NP9 A;  1OD4 A;  1N6D A;  4RYF H;  1FC6 A;  2F9I B;  4RCN A;  5E0S H;  3K50 A;  4JCR A;  1WZ8 A;  4FZW C;  4LK5 A;  4KD6 A;  4K29 A;  4U0G A;  2C8T A;  1NZY A;  4KPK A;  3T8B A;  4KWB A;  2A81 A;  5CTC A;  3IAV A;  3Q1T A;  2UZF A;  1UYS A;  4U0H A;  1HNU A;  4F47 A;  1XNY A;  1HNO A;  3WG5 A;  4NEK A;  1PIX A;  5G1Q A;  1FCF A;  4ASI A;  1XNV A;  1ON3 A;  3H02 A;  3RST A;  2J5I I;  1FC9 A;  3R0O A;  3SLL A;  3TVW A;  1YG6 A;  3TVU A;  1VRG A;  1XX4 A;  3M6N A;  2PPY A;  1NZY B;  5INI A;  2F6I A;  4QIJ A;  1HZD A;  4L8K A;  5DUC A;  2X58 A;  3BEZ A;  3NJD A;  2ZQR A;  1SZO A;  3KTH A;  2J5I B;  4B3H A;  2F9Y B;  4I52 A;  1UYV A;  4EML A;  1JXZ A;  1N6E A;  1WDL A;  2VSU E;  1WDM A;  5DL1 A;  4JCT A;  3PEA A;  2PG8 A;  4WYO B;  3OT6 A;  1EF8 A;  3TT6 A;  1TYF A;  3HIN A;  1EY3 A;  5JBX A;  4JSB A;  4FZW A;  1N6F A;  3Q0J A;  5DU4 A;  2VRE A;  4JWV A;  2DUB A;  3QYR A;  3H0U A;  2A7S A;  4MXI A;  4ELX A;  4ZDE A;  4B3J A;  3IBB A;  5DZK H;  3G64 A;  2F6Q A;  2CBY A;  3T88 A;  4HC8 A;  3TZ3 A;  2J5S A;  1XNW A;  3GLM A;  4OMR A;  5DU6 A;  3RSI A;  5KJP A;  2ZQQ A;  5JBW A;  1UYT A;  4JOT A;  4ZDF A;  4G2R A;  5KDR B;  3M6M A;  4L6W A;  2BZR A;  3ZWC A;  4HNK A;  4I42 A;  3QXZ A;  2J5G D;  3IB9 A;  4K2N A;  3LAO A;  3TT7 A;  4QII A;  2ZL3 A;  4JCS A;  1K32 A;  2F9Y A;  4Q0G A;  4WCZ A;  4FND A;  3GKB A;  4EMM A;  5DTW A;  2DEO A;  2FBM A;  2HW5 A;  2X24 A;  5G1S A;  3ISA A;  1J7X A;  4IZD A;  4JYL A;  3MYB A;  4IZC A;  3PE8 A;  3QK8 A;  5FIF A;  3ZW9 A;  3MFM A;  4I4Z A;  3T8A A;  4FN8 A;  1OD2 A;  3QWD A;  1SG4 A;  5FUS A;  4B3I A;  5E0N X;  2J5I A;  3KTG A;  4ZDC A;  2A7K A;  3U9R B;  1UYR A;  1RJM A;  3H0J A;  4K3W A;  4JVT A;  4KNP A;  3Q7H A;  1K39 A;  4JJT A;  2PBP A;  1Y7O A;  2CE3 A;  1ON9 A;  5DKP A;  4ZDD A;  4Z0M A;  2WTB A;  3U9S B;  3DJA A;  3R9T A;  4GM2 A;  3R6H A;  2J5G A;  3ZWA A;  5C90 A;  3L3S A;  2VSS F;  3TV5 A;  2FZS A;  2F9I A;  5KDR A;  5DTP A;  2VSU C;  3JU1 A;  3MT6 A;  3V5I A;  3R9S A;  4IZB A;  3H0Q A;  3Q0G A;  5INF A;  3GF7 A;  3GMA A;  3OC7 A;  2VSU A;  3H81 A;  4ZU2 A;  2VX2 A;  4GHN A;  3BPP A;  4JCQ A;  1XO6 A;  1Q52 A;  4FNB A;  3T3W A;  4JFC A;  2Q35 A;  4JYJ A;  4WZ8 B;  4OLQ A;  4EMP A;  4FJW D;  4QFE A;  2W3P A;  1W2X A;  3I47 A;  5CTB A;  4OG1 A;  4FB8 A;  1DCI A;  2FW2 A;  3PGQ A;  3PZK A;  4NNQ A;  2ZL0 A;  3SWX A;  1DUB A;  1FC7 A;  4U1A A;  3RRV A;  3KTK A;  3MOY A;  3FF6 A;  3FDU A;  1Q51 A;  1YG8 A;  1PJH A;  3K8X A;  3HRX A;  5MGB A;  3DOR A;  2VSU F;  1MJ3 A;  3HLN 1;  4U19 A;  4U0G H;  2Q34 A;  5C9G A;  1TG6 A;  3STA A;  3LKE A;  4U18 A;  3TDC A;  3ZW8 A;  3HE2 A;  1WDK A;  3QXI A;  3GF3 A;  3T89 A;  5G1R A;  5E0S A;  3KQF A;  1UIY A;  4FN7 A;  3QKA A;  3P85 A; 
#chains in the Genus database with same CATH topology
 2ZL4 A;  2VSS A;  2GTR A;  3P2L A;  3QRE A;  4ZDB A;  5ING A;  5DZK A;  3V5E A;  3KTI A;  5IKL B;  3BPT A;  5DUF A;  3H0S A;  3P5M A;  3U9T B;  1EF9 A;  5DU8 A;  4J2U A;  3N6R B;  2EJ5 A;  4Q1I A;  1O8U A;  3QMJ A;  3R9Q A;  3KTJ A;  2Q2X A;  3VIV A;  4ELW A;  2D3T A;  2ZL2 A;  4RYF A;  4ELS A;  1X0U A;  4MI2 A;  3ZWB A;  3TRR A;  2IEX A;  3BF0 A;  2QQ3 A;  3OME A;  3TLF A;  4YLH A;  1RJN A;  2VSS E;  4MOU A;  3ST9 A;  3NJB A;  4DI1 A;  3HP0 A;  2NP9 A;  1OD4 A;  1N6D A;  4RYF H;  1FC6 A;  2F9I B;  4RCN A;  5E0S H;  3K50 A;  5HUQ A;  4JCR A;  1WZ8 A;  4FZW C;  4LK5 A;  4KD6 A;  4K29 A;  4U0G A;  2C8T A;  1NZY A;  4KPK A;  3T8B A;  4KWB A;  2A81 A;  5CTC A;  3IAV A;  3Q1T A;  2UZF A;  1UYS A;  4U0H A;  1HNU A;  4F47 A;  1XNY A;  1HNO A;  3WG5 A;  4NEK A;  1PIX A;  5G1Q A;  1FCF A;  4ASI A;  1XNV A;  1ON3 A;  3H02 A;  3RST A;  2J5I I;  1FC9 A;  3R0O A;  3SLL A;  3TVW A;  1YG6 A;  3TVU A;  1VRG A;  1XX4 A;  3M6N A;  2PPY A;  1NZY B;  5INI A;  2F6I A;  4QIJ A;  1HZD A;  4L8K A;  5DUC A;  2X58 A;  3BEZ A;  3NJD A;  2ZQR A;  1SZO A;  3KTH A;  2J5I B;  4B3H A;  2F9Y B;  4I52 A;  1UYV A;  4EML A;  1JXZ A;  1N6E A;  1WDL A;  2VSU E;  1WDM A;  5DL1 A;  4JCT A;  3PEA A;  2PG8 A;  4WYO B;  3OT6 A;  1EF8 A;  3TT6 A;  1TYF A;  3HIN A;  1EY3 A;  5JBX A;  4JSB A;  4FZW A;  1N6F A;  3Q0J A;  5DU4 A;  2VRE A;  4JWV A;  2DUB A;  3QYR A;  3H0U A;  2A7S A;  4MXI A;  4ELX A;  4ZDE A;  4B3J A;  3IBB A;  5DZK H;  3G64 A;  2F6Q A;  2CBY A;  3T88 A;  4HC8 A;  3TZ3 A;  2J5S A;  1XNW A;  3GLM A;  4OMR A;  5DU6 A;  3RSI A;  5KJP A;  2ZQQ A;  5JBW A;  1UYT A;  4JOT A;  4ZDF A;  4G2R A;  5KDR B;  3M6M A;  4L6W A;  2BZR A;  3ZWC A;  4HNK A;  4I42 A;  3QXZ A;  2J5G D;  3IB9 A;  4K2N A;  3LAO A;  3TT7 A;  4QII A;  2ZL3 A;  4JCS A;  1K32 A;  2F9Y A;  4Q0G A;  4WCZ A;  4FND A;  3GKB A;  4EMM A;  4NAR A;  5DTW A;  2DEO A;  2FBM A;  2HW5 A;  2X24 A;  5G1S A;  3ISA A;  1J7X A;  4IZD A;  4JYL A;  3MYB A;  4IZC A;  3PE8 A;  3QK8 A;  5FIF A;  4HDT A;  3ZW9 A;  3MFM A;  4I4Z A;  3T8A A;  4FN8 A;  1OD2 A;  3QWD A;  1SG4 A;  5FUS A;  4B3I A;  5E0N X;  2J5I A;  3KTG A;  4ZDC A;  2A7K A;  3U9R B;  1UYR A;  1RJM A;  3H0J A;  4K3W A;  2YJG A;  4JVT A;  4KNP A;  3Q7H A;  1K39 A;  4JJT A;  2PBP A;  1Y7O A;  2CE3 A;  1ON9 A;  5DKP A;  4ZDD A;  4Z0M A;  2WTB A;  3U9S B;  3DJA A;  3R9T A;  4GM2 A;  3R6H A;  2J5G A;  3ZWA A;  5C90 A;  3L3S A;  2VSS F;  3TV5 A;  2FZS A;  2F9I A;  5KDR A;  5DTP A;  2VSU C;  3JU1 A;  3MT6 A;  3V5I A;  3R9S A;  4IZB A;  3H0Q A;  3Q0G A;  5INF A;  3GF7 A;  3GMA A;  3OC7 A;  2VSU A;  3H81 A;  4ZU2 A;  2VX2 A;  4GHN A;  3BPP A;  4JCQ A;  1XO6 A;  1Q52 A;  4FNB A;  3T3W A;  4JFC A;  2Q35 A;  4JYJ A;  4WZ8 B;  4OLQ A;  4EMP A;  4FJW D;  4QFE A;  2W3P A;  1W2X A;  3I47 A;  5CTB A;  4OG1 A;  4FB8 A;  1DCI A;  2FW2 A;  3PGQ A;  3PZK A;  4NNQ A;  2ZL0 A;  3SWX A;  1DUB A;  1FC7 A;  4U1A A;  3RRV A;  3KTK A;  3MOY A;  3FF6 A;  3FDU A;  1Q51 A;  1YG8 A;  1PJH A;  3K8X A;  3HRX A;  5MGB A;  3DOR A;  2VSU F;  1MJ3 A;  3HLN 1;  4U19 A;  4U0G H;  2Q34 A;  5C9G A;  1TG6 A;  3STA A;  3LKE A;  4U18 A;  3TDC A;  3ZW8 A;  3HE2 A;  1WDK A;  3QXI A;  3GF3 A;  3T89 A;  5G1R A;  5E0S A;  3KQF A;  1UIY A;  4FN7 A;  3QKA A;  3P85 A; 
#chains in the Genus database with same CATH homology
 2ZL4 A;  2VSS A;  2GTR A;  3P2L A;  3QRE A;  4ZDB A;  5ING A;  5DZK A;  3V5E A;  3KTI A;  5IKL B;  3BPT A;  5DUF A;  3H0S A;  3P5M A;  3U9T B;  1EF9 A;  5DU8 A;  4J2U A;  3N6R B;  2EJ5 A;  4Q1I A;  1O8U A;  3QMJ A;  3R9Q A;  3KTJ A;  2Q2X A;  3VIV A;  4ELW A;  2D3T A;  2ZL2 A;  4RYF A;  4ELS A;  1X0U A;  4MI2 A;  3ZWB A;  3TRR A;  2IEX A;  3BF0 A;  2QQ3 A;  3OME A;  3TLF A;  4YLH A;  1RJN A;  2VSS E;  4MOU A;  3ST9 A;  3NJB A;  4DI1 A;  3HP0 A;  2NP9 A;  1OD4 A;  1N6D A;  4RYF H;  1FC6 A;  2F9I B;  4RCN A;  5E0S H;  3K50 A;  5HUQ A;  4JCR A;  1WZ8 A;  4FZW C;  4LK5 A;  4KD6 A;  4K29 A;  4U0G A;  2C8T A;  1NZY A;  4KPK A;  3T8B A;  4KWB A;  2A81 A;  5CTC A;  3IAV A;  3Q1T A;  2UZF A;  1UYS A;  4U0H A;  1HNU A;  4F47 A;  1XNY A;  1HNO A;  3WG5 A;  4NEK A;  1PIX A;  5G1Q A;  1FCF A;  4ASI A;  1XNV A;  1ON3 A;  3H02 A;  3RST A;  2J5I I;  1FC9 A;  3R0O A;  3SLL A;  3TVW A;  1YG6 A;  3TVU A;  1VRG A;  1XX4 A;  3M6N A;  2PPY A;  1NZY B;  5INI A;  2F6I A;  4QIJ A;  1HZD A;  4L8K A;  5DUC A;  2X58 A;  3BEZ A;  3NJD A;  2ZQR A;  1SZO A;  3KTH A;  2J5I B;  4B3H A;  2F9Y B;  4I52 A;  1UYV A;  4EML A;  1JXZ A;  1N6E A;  1WDL A;  2VSU E;  1WDM A;  5DL1 A;  4JCT A;  3PEA A;  2PG8 A;  4WYO B;  3OT6 A;  1EF8 A;  3TT6 A;  1TYF A;  3HIN A;  1EY3 A;  5JBX A;  4JSB A;  4FZW A;  1N6F A;  3Q0J A;  5DU4 A;  2VRE A;  4JWV A;  2DUB A;  3QYR A;  3H0U A;  2A7S A;  4MXI A;  4ELX A;  4ZDE A;  4B3J A;  3IBB A;  5DZK H;  3G64 A;  2F6Q A;  2CBY A;  3T88 A;  4HC8 A;  3TZ3 A;  2J5S A;  1XNW A;  3GLM A;  4OMR A;  5DU6 A;  3RSI A;  5KJP A;  2ZQQ A;  5JBW A;  1UYT A;  4JOT A;  4ZDF A;  4G2R A;  5KDR B;  3M6M A;  4L6W A;  2BZR A;  3ZWC A;  4HNK A;  4I42 A;  3QXZ A;  2J5G D;  3IB9 A;  4K2N A;  3LAO A;  3TT7 A;  4QII A;  2ZL3 A;  4JCS A;  1K32 A;  2F9Y A;  4Q0G A;  4WCZ A;  4FND A;  3GKB A;  4EMM A;  4NAR A;  5DTW A;  2DEO A;  2FBM A;  2HW5 A;  2X24 A;  5G1S A;  3ISA A;  1J7X A;  4IZD A;  4JYL A;  3MYB A;  4IZC A;  3PE8 A;  3QK8 A;  5FIF A;  4HDT A;  3ZW9 A;  3MFM A;  4I4Z A;  3T8A A;  4FN8 A;  1OD2 A;  3QWD A;  1SG4 A;  5FUS A;  4B3I A;  5E0N X;  2J5I A;  3KTG A;  4ZDC A;  2A7K A;  3U9R B;  1UYR A;  1RJM A;  3H0J A;  4K3W A;  2YJG A;  4JVT A;  4KNP A;  3Q7H A;  1K39 A;  4JJT A;  2PBP A;  1Y7O A;  2CE3 A;  1ON9 A;  5DKP A;  4ZDD A;  4Z0M A;  2WTB A;  3U9S B;  3DJA A;  3R9T A;  4GM2 A;  3R6H A;  2J5G A;  3ZWA A;  5C90 A;  3L3S A;  2VSS F;  3TV5 A;  2FZS A;  2F9I A;  5KDR A;  5DTP A;  2VSU C;  3JU1 A;  3MT6 A;  3V5I A;  3R9S A;  4IZB A;  3H0Q A;  3Q0G A;  5INF A;  3GF7 A;  3GMA A;  3OC7 A;  2VSU A;  3H81 A;  4ZU2 A;  2VX2 A;  4GHN A;  3BPP A;  4JCQ A;  1XO6 A;  1Q52 A;  4FNB A;  3T3W A;  4JFC A;  2Q35 A;  4JYJ A;  4WZ8 B;  4OLQ A;  4EMP A;  4FJW D;  4QFE A;  2W3P A;  1W2X A;  3I47 A;  5CTB A;  4OG1 A;  4FB8 A;  1DCI A;  2FW2 A;  3PGQ A;  3PZK A;  4NNQ A;  2ZL0 A;  3SWX A;  1DUB A;  1FC7 A;  4U1A A;  3RRV A;  3KTK A;  3MOY A;  3FF6 A;  3FDU A;  1Q51 A;  1YG8 A;  1PJH A;  3K8X A;  3HRX A;  5MGB A;  3DOR A;  2VSU F;  1MJ3 A;  3HLN 1;  4U19 A;  4U0G H;  2Q34 A;  5C9G A;  1TG6 A;  3STA A;  3LKE A;  4U18 A;  3TDC A;  3ZW8 A;  3HE2 A;  1WDK A;  3QXI A;  3GF3 A;  3T89 A;  5G1R A;  5E0S A;  3KQF A;  1UIY A;  4FN7 A;  3QKA A;  3P85 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...