1Y7OA

The structure of streptococcus pneumoniae a153p clpp
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
192
structure length
171
Chain Sequence
IPVVIESYDIYSRLLKDRIIMLTGPVEDNMANSVIAQLLFLDAQDSTKDIYLYVNTPGGSVSAGLAIVDTMNFIKADVQTIVMGMAASMGTVIASSGAKGKRFMLPNAEYMIHQPMAPEHLLKTRNTLEKILAENSGQSMEKVHADAERDNWMSAQETLEYGFIDEIMANN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-dependent Clp protease proteolytic subunit
publication title The ClpP double ring tetradecameric protease exhibits plastic ring-ring interactions, and the N termini of its subunits form flexible loops that are essential for ClpXP and ClpAP complex formation.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase
total genus 56
structure length 171
sequence length 192
chains with identical sequence B, C, D, E, F, G
ec nomenclature ec 3.4.21.92: Endopeptidase Clp.
pdb deposition date 2004-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00574 CLP_protease Clp protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 1y7oA00
4DI1A 3QKAA 2VREA 4JSBA 1DCIA 3HINA 3OC7A 2ZL3A 2ZQRA 3V5IA 3KQFA 4L8KA 4GHNA 5INIA 3G64A 3P85A 4FZWC 2FBMA 1XNWA 1Q51A 1FCFA 3FF6A 2ZL0A 1UYRA 3PGQA 4KPKA 1WDKA 1RJNA 4I4ZA 3ZW9A 1YG6A 5DUCA 3H0SA 3GMAA 3TT7A 2FZSA 3TV5A 3IBBA 3LKEA 3T3WA 3L3SA 3U9TB 5CTCA 1UIYA 4Q1IA 4I42A 3MFMA 3GKBA 4K3WA 2X58A 1SG4A 3T8AA 4JCSA 3TVUA 3HE2A 1PIXA 4U1AA 3U9RB 3R9QA 3Q0JA 4OMRA 4EMMA 5KJPA 1WDLA 1FC9A 3MOYA 3IAVA 1SZOA 3ISAA 5G1RA 2X24A 4ASIA 3ZWAA 3PEAA 4ZDEA 3KTJA 3I47A 4U18A 1EF8A 1XNVA 5E0NX 3IB9A 5DKPA 4MOUA 4I52A 4WYOB 2NP9A 5CTBA 4B3IA 1ON3A 1N6EA 2J5GA 1W2XA 2VX2A 1YG8A 3QYRA 5JBXA 4ELWA 1FC7A 1TYFA 1UYVA 2CBYA 1N6FA 1ON9A 4B3HA 3H0JA 3M6NA 4JYLA 1JXZA 2IEXA 2QQ3A 3Q7HA 3GF3A 2GTRA 2VSUC 1K39A 5DU6A 4IZBA 2PPYA 3KTHA 4EMPA 4WCZA 4WZ8B 5MGBA 4IZDA 4KD6A 5E0SH 4ELSA 2J5SA 3MYBA 4JCQA 3RSIA 1HZDA 3H0UA 4MI2A 3ZW8A 4Q0GA 4FN8A 2PBPA 4FN7A 2HW5A 4U19A 5INFA 1X0UA 3HLN1 3K50A 2J5GD 3ST9A 4FJWD 4RYFH 3LAOA 4FNBA 3DJAA 4KWBA 3TZ3A 1NZYB 3KTIA 4JJTA 3QREA 3TVWA 1FC6A 5C90A 4HNKA 1VRGA 4LK5A 3TT6A 4F47A 2F6QA 4G2RA 4QFEA 2J5II 2VSSA 3VIVA 4GM2A 3M6MA 1RJMA 4ZDDA 4FB8A 2VSUA 4K29A 3QXZA 1NZYA 2A81A 2VSSE 2VSUF 3K8XA 2F6IA 4OLQA 2A7SA 2ZL2A 3R6HA 2VSUE 2Q35A 1UYSA 3ZWCA 3HP0A 4Z0MA 3QMJA 1OD4A 5E0SA 2Q34A 4JOTA 1N6DA 3H81A 1O8UA 3KTGA 1TG6A 5DU8A 5KDRB 4U0GH 3R9SA 5INGA 1OD2A 4QIJA 4L6WA 4ZU2A 3BF0A 3OT6A 1HNOA 4RYFA 4OG1A 4MXIA 3SWXA 5DL1A 5DTPA 2ZQQA 5JBWA 4YLHA 4NEKA 3Q0GA 2A7KA 5KDRA 5FIFA 2EJ5A 3DORA 3STAA 3RRVA 3WG5A 3PZKA 2F9IB 1PJHA 1HNUA 3RSTA 4RCNA 3FDUA 3P5MA 5FUSA 3TRRA 1UYTA 2DUBA 5DZKH 4NNQA 2W3PA 4IZCA 1XNYA 4B3JA 4JYJA 4ZDCA 4JVTA 3NJBA 4JFCA 4ZDBA 2F9IA 4EMLA 4QIIA 4K2NA 3U9SB 2J5IB 3QXIA 3H02A 2F9YB 2DEOA 1Y7OA 3NJDA 4FNDA 4U0GA 3V5EA 2WTBA 5G1SA 2VSSF 4JCTA 3H0QA 2CE3A 3MT6A 1WDMA 3GF7A 2J5IA 3N6RB 1EY3A 5DUFA 2UZFA 1K32A 2F9YA 3ZWBA 4JWVA 3P2LA 3JU1A 3QK8A 2ZL4A 4ELXA 5C9GA 4U0HA 3QWDA 3T88A 1WZ8A 2FW2A 3T89A 3TLFA 2Q2XA 2BZRA 5IKLB 5G1QA 3HRXA 4ZDFA 3OMEA 4FZWA 3R9TA 3T8BA 1XO6A 3SLLA 5DZKA 1Q52A 3Q1TA 3TDCA 5DTWA 4KNPA 1J7XA 1EF9A 2PG8A 3BPPA 1MJ3A 4HC8A 2C8TA 3KTKA 1XX4A 3BEZA 3PE8A 4JCRA 3GLMA 5DU4A 1DUBA 2D3TA 3R0OA
chains in the Genus database with same CATH superfamily
4DI1A 3QKAA 2VREA 4JSBA 1DCIA 3HINA 3OC7A 2ZL3A 2ZQRA 3V5IA 3KQFA 4L8KA 4GHNA 5INIA 3G64A 3P85A 4FZWC 2FBMA 1XNWA 1Q51A 1FCFA 3FF6A 2ZL0A 1UYRA 3PGQA 4KPKA 1WDKA 1RJNA 4I4ZA 3ZW9A 1YG6A 4NARA 5DUCA 3H0SA 3GMAA 3TT7A 2FZSA 3TV5A 3IBBA 3LKEA 3T3WA 3L3SA 3U9TB 5CTCA 1UIYA 4Q1IA 4I42A 3MFMA 3GKBA 4K3WA 2X58A 1SG4A 3T8AA 4JCSA 3TVUA 3HE2A 1PIXA 4U1AA 3U9RB 3R9QA 3Q0JA 4OMRA 4EMMA 5KJPA 1WDLA 1FC9A 3MOYA 3IAVA 1SZOA 3ISAA 5G1RA 2X24A 4ASIA 3ZWAA 3PEAA 4ZDEA 3KTJA 4HDTA 3I47A 4U18A 1EF8A 1XNVA 5E0NX 3IB9A 5DKPA 4MOUA 4I52A 4WYOB 2NP9A 5CTBA 4B3IA 1ON3A 1N6EA 2J5GA 1W2XA 2VX2A 1YG8A 3QYRA 5JBXA 4ELWA 1FC7A 1TYFA 1UYVA 2CBYA 1N6FA 1ON9A 4B3HA 3H0JA 3M6NA 4JYLA 1JXZA 2IEXA 2QQ3A 3Q7HA 3GF3A 2GTRA 2VSUC 1K39A 5DU6A 4IZBA 2PPYA 3KTHA 4EMPA 4WCZA 4WZ8B 5MGBA 4IZDA 4KD6A 5E0SH 5HUQA 4ELSA 2J5SA 3MYBA 4JCQA 3RSIA 1HZDA 3H0UA 4MI2A 3ZW8A 4Q0GA 4FN8A 2PBPA 4FN7A 2HW5A 4U19A 5INFA 1X0UA 3HLN1 3K50A 2J5GD 3ST9A 4FJWD 4RYFH 3LAOA 4FNBA 3DJAA 4KWBA 3TZ3A 1NZYB 3KTIA 4JJTA 3QREA 3TVWA 1FC6A 5C90A 4HNKA 1VRGA 4LK5A 3TT6A 4F47A 2F6QA 4G2RA 4QFEA 2J5II 2VSSA 3VIVA 4GM2A 3M6MA 1RJMA 4ZDDA 4FB8A 2VSUA 4K29A 3QXZA 1NZYA 2A81A 2VSSE 2VSUF 3K8XA 2F6IA 4OLQA 2A7SA 2ZL2A 3R6HA 2VSUE 2Q35A 1UYSA 3ZWCA 3HP0A 4Z0MA 3QMJA 1OD4A 5E0SA 2Q34A 4JOTA 1N6DA 3H81A 1O8UA 2YJGA 3KTGA 1TG6A 5DU8A 5KDRB 4U0GH 3R9SA 5INGA 1OD2A 4QIJA 4L6WA 4ZU2A 3BF0A 4J2UA 3OT6A 1HNOA 4RYFA 4OG1A 4MXIA 3SWXA 5DL1A 5DTPA 2ZQQA 5JBWA 4YLHA 4NEKA 3Q0GA 2A7KA 5KDRA 5FIFA 2EJ5A 3DORA 3STAA 3RRVA 3WG5A 3PZKA 2F9IB 1PJHA 1HNUA 3RSTA 4RCNA 3FDUA 3P5MA 5FUSA 3TRRA 1UYTA 2DUBA 5DZKH 4NNQA 2W3PA 3BPTA 4IZCA 1XNYA 4B3JA 4JYJA 4ZDCA 4JVTA 3NJBA 4JFCA 4ZDBA 2F9IA 4EMLA 4QIIA 4K2NA 3U9SB 2J5IB 3QXIA 3H02A 2F9YB 2DEOA 1Y7OA 3NJDA 4FNDA 4U0GA 3V5EA 2WTBA 5G1SA 2VSSF 4JCTA 3H0QA 2CE3A 3MT6A 1WDMA 3GF7A 2J5IA 3N6RB 1EY3A 5DUFA 2UZFA 1K32A 2F9YA 3ZWBA 4JWVA 3P2LA 3JU1A 3QK8A 2ZL4A 4ELXA 5C9GA 4U0HA 3QWDA 3T88A 1WZ8A 2FW2A 3T89A 3TLFA 2Q2XA 2BZRA 5IKLB 5G1QA 3HRXA 4ZDFA 3OMEA 4FZWA 3R9TA 3T8BA 1XO6A 3SLLA 5DZKA 1Q52A 3Q1TA 3TDCA 5DTWA 4KNPA 1J7XA 1EF9A 2PG8A 3BPPA 1MJ3A 4HC8A 2C8TA 3KTKA 1XX4A 3BEZA 3PE8A 4JCRA 3GLMA 5DU4A 1DUBA 2D3TA 3R0OA
chains in the Genus database with same CATH topology
4DI1A 3QKAA 2VREA 4JSBA 1DCIA 3HINA 3OC7A 2ZL3A 2ZQRA 3V5IA 3KQFA 4L8KA 4GHNA 5INIA 3G64A 3P85A 4FZWC 2FBMA 1XNWA 1Q51A 1FCFA 3FF6A 2ZL0A 1UYRA 3PGQA 4KPKA 1WDKA 1RJNA 4I4ZA 3ZW9A 1YG6A 4NARA 5DUCA 3H0SA 3GMAA 3TT7A 2FZSA 3TV5A 3IBBA 3LKEA 3T3WA 3L3SA 3U9TB 5CTCA 1UIYA 4Q1IA 4I42A 3MFMA 3GKBA 4K3WA 2X58A 1SG4A 3T8AA 4JCSA 3TVUA 3HE2A 1PIXA 4U1AA 3U9RB 3R9QA 3Q0JA 4OMRA 4EMMA 5KJPA 1WDLA 1FC9A 3MOYA 3IAVA 1SZOA 3ISAA 5G1RA 2X24A 4ASIA 3ZWAA 3PEAA 4ZDEA 3KTJA 4HDTA 3I47A 4U18A 1EF8A 1XNVA 5E0NX 3IB9A 5DKPA 4MOUA 4I52A 4WYOB 2NP9A 5CTBA 4B3IA 1ON3A 1N6EA 2J5GA 1W2XA 2VX2A 1YG8A 3QYRA 5JBXA 4ELWA 1FC7A 1TYFA 1UYVA 2CBYA 1N6FA 1ON9A 4B3HA 3H0JA 3M6NA 4JYLA 1JXZA 2IEXA 2QQ3A 3Q7HA 3GF3A 2GTRA 2VSUC 1K39A 5DU6A 4IZBA 2PPYA 3KTHA 4EMPA 4WCZA 4WZ8B 5MGBA 4IZDA 4KD6A 5E0SH 5HUQA 4ELSA 2J5SA 3MYBA 4JCQA 3RSIA 1HZDA 3H0UA 4MI2A 3ZW8A 4Q0GA 4FN8A 2PBPA 4FN7A 2HW5A 4U19A 5INFA 1X0UA 3HLN1 3K50A 2J5GD 3ST9A 4FJWD 4RYFH 3LAOA 4FNBA 3DJAA 4KWBA 3TZ3A 1NZYB 3KTIA 4JJTA 3QREA 3TVWA 1FC6A 5C90A 4HNKA 1VRGA 4LK5A 3TT6A 4F47A 2F6QA 4G2RA 4QFEA 2J5II 2VSSA 3VIVA 4GM2A 3M6MA 1RJMA 4ZDDA 4FB8A 2VSUA 4K29A 3QXZA 1NZYA 2A81A 2VSSE 2VSUF 3K8XA 2F6IA 4OLQA 2A7SA 2ZL2A 3R6HA 2VSUE 2Q35A 1UYSA 3ZWCA 3HP0A 4Z0MA 3QMJA 1OD4A 5E0SA 2Q34A 4JOTA 1N6DA 3H81A 1O8UA 2YJGA 3KTGA 1TG6A 5DU8A 5KDRB 4U0GH 3R9SA 5INGA 1OD2A 4QIJA 4L6WA 4ZU2A 3BF0A 4J2UA 3OT6A 1HNOA 4RYFA 4OG1A 4MXIA 3SWXA 5DL1A 5DTPA 2ZQQA 5JBWA 4YLHA 4NEKA 3Q0GA 2A7KA 5KDRA 5FIFA 2EJ5A 3DORA 3STAA 3RRVA 3WG5A 3PZKA 2F9IB 1PJHA 1HNUA 3RSTA 4RCNA 3FDUA 3P5MA 5FUSA 3TRRA 1UYTA 2DUBA 5DZKH 4NNQA 2W3PA 3BPTA 4IZCA 1XNYA 4B3JA 4JYJA 4ZDCA 4JVTA 3NJBA 4JFCA 4ZDBA 2F9IA 4EMLA 4QIIA 4K2NA 3U9SB 2J5IB 3QXIA 3H02A 2F9YB 2DEOA 1Y7OA 3NJDA 4FNDA 4U0GA 3V5EA 2WTBA 5G1SA 2VSSF 4JCTA 3H0QA 2CE3A 3MT6A 1WDMA 3GF7A 2J5IA 3N6RB 1EY3A 5DUFA 2UZFA 1K32A 2F9YA 3ZWBA 4JWVA 3P2LA 3JU1A 3QK8A 2ZL4A 4ELXA 5C9GA 4U0HA 3QWDA 3T88A 1WZ8A 2FW2A 3T89A 3TLFA 2Q2XA 2BZRA 5IKLB 5G1QA 3HRXA 4ZDFA 3OMEA 4FZWA 3R9TA 3T8BA 1XO6A 3SLLA 5DZKA 1Q52A 3Q1TA 3TDCA 5DTWA 4KNPA 1J7XA 1EF9A 2PG8A 3BPPA 1MJ3A 4HC8A 2C8TA 3KTKA 1XX4A 3BEZA 3PE8A 4JCRA 3GLMA 5DU4A 1DUBA 2D3TA 3R0OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DI1 A;  3QKA A;  2VRE A;  4JSB A;  1DCI A;  3HIN A;  3OC7 A;  2ZL3 A;  2ZQR A;  3V5I A;  3KQF A;  4L8K A;  4GHN A;  5INI A;  3G64 A;  3P85 A;  4FZW C;  2FBM A;  1XNW A;  1Q51 A;  1FCF A;  3FF6 A;  2ZL0 A;  1UYR A;  3PGQ A;  4KPK A;  1WDK A;  1RJN A;  4I4Z A;  3ZW9 A;  1YG6 A;  5DUC A;  3H0S A;  3GMA A;  3TT7 A;  2FZS A;  3TV5 A;  3IBB A;  3LKE A;  3T3W A;  3L3S A;  3U9T B;  5CTC A;  1UIY A;  4Q1I A;  4I42 A;  3MFM A;  3GKB A;  4K3W A;  2X58 A;  1SG4 A;  3T8A A;  4JCS A;  3TVU A;  3HE2 A;  1PIX A;  4U1A A;  3U9R B;  3R9Q A;  3Q0J A;  4OMR A;  4EMM A;  5KJP A;  1WDL A;  1FC9 A;  3MOY A;  3IAV A;  1SZO A;  3ISA A;  5G1R A;  2X24 A;  4ASI A;  3ZWA A;  3PEA A;  4ZDE A;  3KTJ A;  3I47 A;  4U18 A;  1EF8 A;  1XNV A;  5E0N X;  3IB9 A;  5DKP A;  4MOU A;  4I52 A;  4WYO B;  2NP9 A;  5CTB A;  4B3I A;  1ON3 A;  1N6E A;  2J5G A;  1W2X A;  2VX2 A;  1YG8 A;  3QYR A;  5JBX A;  4ELW A;  1FC7 A;  1TYF A;  1UYV A;  2CBY A;  1N6F A;  1ON9 A;  4B3H A;  3H0J A;  3M6N A;  4JYL A;  1JXZ A;  2IEX A;  2QQ3 A;  3Q7H A;  3GF3 A;  2GTR A;  2VSU C;  1K39 A;  5DU6 A;  4IZB A;  2PPY A;  3KTH A;  4EMP A;  4WCZ A;  4WZ8 B;  5MGB A;  4IZD A;  4KD6 A;  5E0S H;  4ELS A;  2J5S A;  3MYB A;  4JCQ A;  3RSI A;  1HZD A;  3H0U A;  4MI2 A;  3ZW8 A;  4Q0G A;  4FN8 A;  2PBP A;  4FN7 A;  2HW5 A;  4U19 A;  5INF A;  1X0U A;  3HLN 1;  3K50 A;  2J5G D;  3ST9 A;  4FJW D;  4RYF H;  3LAO A;  4FNB A;  3DJA A;  4KWB A;  3TZ3 A;  1NZY B;  3KTI A;  4JJT A;  3QRE A;  3TVW A;  1FC6 A;  5C90 A;  4HNK A;  1VRG A;  4LK5 A;  3TT6 A;  4F47 A;  2F6Q A;  4G2R A;  4QFE A;  2J5I I;  2VSS A;  3VIV A;  4GM2 A;  3M6M A;  1RJM A;  4ZDD A;  4FB8 A;  2VSU A;  4K29 A;  3QXZ A;  1NZY A;  2A81 A;  2VSS E;  2VSU F;  3K8X A;  2F6I A;  4OLQ A;  2A7S A;  2ZL2 A;  3R6H A;  2VSU E;  2Q35 A;  1UYS A;  3ZWC A;  3HP0 A;  4Z0M A;  3QMJ A;  1OD4 A;  5E0S A;  2Q34 A;  4JOT A;  1N6D A;  3H81 A;  1O8U A;  3KTG A;  1TG6 A;  5DU8 A;  5KDR B;  4U0G H;  3R9S A;  5ING A;  1OD2 A;  4QIJ A;  4L6W A;  4ZU2 A;  3BF0 A;  3OT6 A;  1HNO A;  4RYF A;  4OG1 A;  4MXI A;  3SWX A;  5DL1 A;  5DTP A;  2ZQQ A;  5JBW A;  4YLH A;  4NEK A;  3Q0G A;  2A7K A;  5KDR A;  5FIF A;  2EJ5 A;  3DOR A;  3STA A;  3RRV A;  3WG5 A;  3PZK A;  2F9I B;  1PJH A;  1HNU A;  3RST A;  4RCN A;  3FDU A;  3P5M A;  5FUS A;  3TRR A;  1UYT A;  2DUB A;  5DZK H;  4NNQ A;  2W3P A;  4IZC A;  1XNY A;  4B3J A;  4JYJ A;  4ZDC A;  4JVT A;  3NJB A;  4JFC A;  4ZDB A;  2F9I A;  4EML A;  4QII A;  4K2N A;  3U9S B;  2J5I B;  3QXI A;  3H02 A;  2F9Y B;  2DEO A;  1Y7O A;  3NJD A;  4FND A;  4U0G A;  3V5E A;  2WTB A;  5G1S A;  2VSS F;  4JCT A;  3H0Q A;  2CE3 A;  3MT6 A;  1WDM A;  3GF7 A;  2J5I A;  3N6R B;  1EY3 A;  5DUF A;  2UZF A;  1K32 A;  2F9Y A;  3ZWB A;  4JWV A;  3P2L A;  3JU1 A;  3QK8 A;  2ZL4 A;  4ELX A;  5C9G A;  4U0H A;  3QWD A;  3T88 A;  1WZ8 A;  2FW2 A;  3T89 A;  3TLF A;  2Q2X A;  2BZR A;  5IKL B;  5G1Q A;  3HRX A;  4ZDF A;  3OME A;  4FZW A;  3R9T A;  3T8B A;  1XO6 A;  3SLL A;  5DZK A;  1Q52 A;  3Q1T A;  3TDC A;  5DTW A;  4KNP A;  1J7X A;  1EF9 A;  2PG8 A;  3BPP A;  1MJ3 A;  4HC8 A;  2C8T A;  3KTK A;  1XX4 A;  3BEZ A;  3PE8 A;  4JCR A;  3GLM A;  5DU4 A;  1DUB A;  2D3T A;  3R0O A; 
#chains in the Genus database with same CATH topology
 4DI1 A;  3QKA A;  2VRE A;  4JSB A;  1DCI A;  3HIN A;  3OC7 A;  2ZL3 A;  2ZQR A;  3V5I A;  3KQF A;  4L8K A;  4GHN A;  5INI A;  3G64 A;  3P85 A;  4FZW C;  2FBM A;  1XNW A;  1Q51 A;  1FCF A;  3FF6 A;  2ZL0 A;  1UYR A;  3PGQ A;  4KPK A;  1WDK A;  1RJN A;  4I4Z A;  3ZW9 A;  1YG6 A;  4NAR A;  5DUC A;  3H0S A;  3GMA A;  3TT7 A;  2FZS A;  3TV5 A;  3IBB A;  3LKE A;  3T3W A;  3L3S A;  3U9T B;  5CTC A;  1UIY A;  4Q1I A;  4I42 A;  3MFM A;  3GKB A;  4K3W A;  2X58 A;  1SG4 A;  3T8A A;  4JCS A;  3TVU A;  3HE2 A;  1PIX A;  4U1A A;  3U9R B;  3R9Q A;  3Q0J A;  4OMR A;  4EMM A;  5KJP A;  1WDL A;  1FC9 A;  3MOY A;  3IAV A;  1SZO A;  3ISA A;  5G1R A;  2X24 A;  4ASI A;  3ZWA A;  3PEA A;  4ZDE A;  3KTJ A;  4HDT A;  3I47 A;  4U18 A;  1EF8 A;  1XNV A;  5E0N X;  3IB9 A;  5DKP A;  4MOU A;  4I52 A;  4WYO B;  2NP9 A;  5CTB A;  4B3I A;  1ON3 A;  1N6E A;  2J5G A;  1W2X A;  2VX2 A;  1YG8 A;  3QYR A;  5JBX A;  4ELW A;  1FC7 A;  1TYF A;  1UYV A;  2CBY A;  1N6F A;  1ON9 A;  4B3H A;  3H0J A;  3M6N A;  4JYL A;  1JXZ A;  2IEX A;  2QQ3 A;  3Q7H A;  3GF3 A;  2GTR A;  2VSU C;  1K39 A;  5DU6 A;  4IZB A;  2PPY A;  3KTH A;  4EMP A;  4WCZ A;  4WZ8 B;  5MGB A;  4IZD A;  4KD6 A;  5E0S H;  5HUQ A;  4ELS A;  2J5S A;  3MYB A;  4JCQ A;  3RSI A;  1HZD A;  3H0U A;  4MI2 A;  3ZW8 A;  4Q0G A;  4FN8 A;  2PBP A;  4FN7 A;  2HW5 A;  4U19 A;  5INF A;  1X0U A;  3HLN 1;  3K50 A;  2J5G D;  3ST9 A;  4FJW D;  4RYF H;  3LAO A;  4FNB A;  3DJA A;  4KWB A;  3TZ3 A;  1NZY B;  3KTI A;  4JJT A;  3QRE A;  3TVW A;  1FC6 A;  5C90 A;  4HNK A;  1VRG A;  4LK5 A;  3TT6 A;  4F47 A;  2F6Q A;  4G2R A;  4QFE A;  2J5I I;  2VSS A;  3VIV A;  4GM2 A;  3M6M A;  1RJM A;  4ZDD A;  4FB8 A;  2VSU A;  4K29 A;  3QXZ A;  1NZY A;  2A81 A;  2VSS E;  2VSU F;  3K8X A;  2F6I A;  4OLQ A;  2A7S A;  2ZL2 A;  3R6H A;  2VSU E;  2Q35 A;  1UYS A;  3ZWC A;  3HP0 A;  4Z0M A;  3QMJ A;  1OD4 A;  5E0S A;  2Q34 A;  4JOT A;  1N6D A;  3H81 A;  1O8U A;  2YJG A;  3KTG A;  1TG6 A;  5DU8 A;  5KDR B;  4U0G H;  3R9S A;  5ING A;  1OD2 A;  4QIJ A;  4L6W A;  4ZU2 A;  3BF0 A;  4J2U A;  3OT6 A;  1HNO A;  4RYF A;  4OG1 A;  4MXI A;  3SWX A;  5DL1 A;  5DTP A;  2ZQQ A;  5JBW A;  4YLH A;  4NEK A;  3Q0G A;  2A7K A;  5KDR A;  5FIF A;  2EJ5 A;  3DOR A;  3STA A;  3RRV A;  3WG5 A;  3PZK A;  2F9I B;  1PJH A;  1HNU A;  3RST A;  4RCN A;  3FDU A;  3P5M A;  5FUS A;  3TRR A;  1UYT A;  2DUB A;  5DZK H;  4NNQ A;  2W3P A;  3BPT A;  4IZC A;  1XNY A;  4B3J A;  4JYJ A;  4ZDC A;  4JVT A;  3NJB A;  4JFC A;  4ZDB A;  2F9I A;  4EML A;  4QII A;  4K2N A;  3U9S B;  2J5I B;  3QXI A;  3H02 A;  2F9Y B;  2DEO A;  1Y7O A;  3NJD A;  4FND A;  4U0G A;  3V5E A;  2WTB A;  5G1S A;  2VSS F;  4JCT A;  3H0Q A;  2CE3 A;  3MT6 A;  1WDM A;  3GF7 A;  2J5I A;  3N6R B;  1EY3 A;  5DUF A;  2UZF A;  1K32 A;  2F9Y A;  3ZWB A;  4JWV A;  3P2L A;  3JU1 A;  3QK8 A;  2ZL4 A;  4ELX A;  5C9G A;  4U0H A;  3QWD A;  3T88 A;  1WZ8 A;  2FW2 A;  3T89 A;  3TLF A;  2Q2X A;  2BZR A;  5IKL B;  5G1Q A;  3HRX A;  4ZDF A;  3OME A;  4FZW A;  3R9T A;  3T8B A;  1XO6 A;  3SLL A;  5DZK A;  1Q52 A;  3Q1T A;  3TDC A;  5DTW A;  4KNP A;  1J7X A;  1EF9 A;  2PG8 A;  3BPP A;  1MJ3 A;  4HC8 A;  2C8T A;  3KTK A;  1XX4 A;  3BEZ A;  3PE8 A;  4JCR A;  3GLM A;  5DU4 A;  1DUB A;  2D3T A;  3R0O A; 
#chains in the Genus database with same CATH homology
 4DI1 A;  3QKA A;  2VRE A;  4JSB A;  1DCI A;  3HIN A;  3OC7 A;  2ZL3 A;  2ZQR A;  3V5I A;  3KQF A;  4L8K A;  4GHN A;  5INI A;  3G64 A;  3P85 A;  4FZW C;  2FBM A;  1XNW A;  1Q51 A;  1FCF A;  3FF6 A;  2ZL0 A;  1UYR A;  3PGQ A;  4KPK A;  1WDK A;  1RJN A;  4I4Z A;  3ZW9 A;  1YG6 A;  4NAR A;  5DUC A;  3H0S A;  3GMA A;  3TT7 A;  2FZS A;  3TV5 A;  3IBB A;  3LKE A;  3T3W A;  3L3S A;  3U9T B;  5CTC A;  1UIY A;  4Q1I A;  4I42 A;  3MFM A;  3GKB A;  4K3W A;  2X58 A;  1SG4 A;  3T8A A;  4JCS A;  3TVU A;  3HE2 A;  1PIX A;  4U1A A;  3U9R B;  3R9Q A;  3Q0J A;  4OMR A;  4EMM A;  5KJP A;  1WDL A;  1FC9 A;  3MOY A;  3IAV A;  1SZO A;  3ISA A;  5G1R A;  2X24 A;  4ASI A;  3ZWA A;  3PEA A;  4ZDE A;  3KTJ A;  4HDT A;  3I47 A;  4U18 A;  1EF8 A;  1XNV A;  5E0N X;  3IB9 A;  5DKP A;  4MOU A;  4I52 A;  4WYO B;  2NP9 A;  5CTB A;  4B3I A;  1ON3 A;  1N6E A;  2J5G A;  1W2X A;  2VX2 A;  1YG8 A;  3QYR A;  5JBX A;  4ELW A;  1FC7 A;  1TYF A;  1UYV A;  2CBY A;  1N6F A;  1ON9 A;  4B3H A;  3H0J A;  3M6N A;  4JYL A;  1JXZ A;  2IEX A;  2QQ3 A;  3Q7H A;  3GF3 A;  2GTR A;  2VSU C;  1K39 A;  5DU6 A;  4IZB A;  2PPY A;  3KTH A;  4EMP A;  4WCZ A;  4WZ8 B;  5MGB A;  4IZD A;  4KD6 A;  5E0S H;  5HUQ A;  4ELS A;  2J5S A;  3MYB A;  4JCQ A;  3RSI A;  1HZD A;  3H0U A;  4MI2 A;  3ZW8 A;  4Q0G A;  4FN8 A;  2PBP A;  4FN7 A;  2HW5 A;  4U19 A;  5INF A;  1X0U A;  3HLN 1;  3K50 A;  2J5G D;  3ST9 A;  4FJW D;  4RYF H;  3LAO A;  4FNB A;  3DJA A;  4KWB A;  3TZ3 A;  1NZY B;  3KTI A;  4JJT A;  3QRE A;  3TVW A;  1FC6 A;  5C90 A;  4HNK A;  1VRG A;  4LK5 A;  3TT6 A;  4F47 A;  2F6Q A;  4G2R A;  4QFE A;  2J5I I;  2VSS A;  3VIV A;  4GM2 A;  3M6M A;  1RJM A;  4ZDD A;  4FB8 A;  2VSU A;  4K29 A;  3QXZ A;  1NZY A;  2A81 A;  2VSS E;  2VSU F;  3K8X A;  2F6I A;  4OLQ A;  2A7S A;  2ZL2 A;  3R6H A;  2VSU E;  2Q35 A;  1UYS A;  3ZWC A;  3HP0 A;  4Z0M A;  3QMJ A;  1OD4 A;  5E0S A;  2Q34 A;  4JOT A;  1N6D A;  3H81 A;  1O8U A;  2YJG A;  3KTG A;  1TG6 A;  5DU8 A;  5KDR B;  4U0G H;  3R9S A;  5ING A;  1OD2 A;  4QIJ A;  4L6W A;  4ZU2 A;  3BF0 A;  4J2U A;  3OT6 A;  1HNO A;  4RYF A;  4OG1 A;  4MXI A;  3SWX A;  5DL1 A;  5DTP A;  2ZQQ A;  5JBW A;  4YLH A;  4NEK A;  3Q0G A;  2A7K A;  5KDR A;  5FIF A;  2EJ5 A;  3DOR A;  3STA A;  3RRV A;  3WG5 A;  3PZK A;  2F9I B;  1PJH A;  1HNU A;  3RST A;  4RCN A;  3FDU A;  3P5M A;  5FUS A;  3TRR A;  1UYT A;  2DUB A;  5DZK H;  4NNQ A;  2W3P A;  3BPT A;  4IZC A;  1XNY A;  4B3J A;  4JYJ A;  4ZDC A;  4JVT A;  3NJB A;  4JFC A;  4ZDB A;  2F9I A;  4EML A;  4QII A;  4K2N A;  3U9S B;  2J5I B;  3QXI A;  3H02 A;  2F9Y B;  2DEO A;  1Y7O A;  3NJD A;  4FND A;  4U0G A;  3V5E A;  2WTB A;  5G1S A;  2VSS F;  4JCT A;  3H0Q A;  2CE3 A;  3MT6 A;  1WDM A;  3GF7 A;  2J5I A;  3N6R B;  1EY3 A;  5DUF A;  2UZF A;  1K32 A;  2F9Y A;  3ZWB A;  4JWV A;  3P2L A;  3JU1 A;  3QK8 A;  2ZL4 A;  4ELX A;  5C9G A;  4U0H A;  3QWD A;  3T88 A;  1WZ8 A;  2FW2 A;  3T89 A;  3TLF A;  2Q2X A;  2BZR A;  5IKL B;  5G1Q A;  3HRX A;  4ZDF A;  3OME A;  4FZW A;  3R9T A;  3T8B A;  1XO6 A;  3SLL A;  5DZK A;  1Q52 A;  3Q1T A;  3TDC A;  5DTW A;  4KNP A;  1J7X A;  1EF9 A;  2PG8 A;  3BPP A;  1MJ3 A;  4HC8 A;  2C8T A;  3KTK A;  1XX4 A;  3BEZ A;  3PE8 A;  4JCR A;  3GLM A;  5DU4 A;  1DUB A;  2D3T A;  3R0O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...