1Y7OA

The structure of streptococcus pneumoniae a153p clpp
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
192
structure length
171
Chain Sequence
b'IPVVIESYDIYSRLLKDRIIMLTGPVEDNMANSVIAQLLFLDAQDSTKDIYLYVNTPGGSVSAGLAIVDTMNFIKADVQTIVMGMAASMGTVIASSGAKGKRFMLPNAEYMIHQPMAPEHLLKTRNTLEKILAENSGQSMEKVHADAERDNWMSAQETLEYGFIDEIMANN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-dependent Clp protease proteolytic subunit
publication title The ClpP double ring tetradecameric protease exhibits plastic ring-ring interactions, and the N termini of its subunits form flexible loops that are essential for ClpXP and ClpAP complex formation.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase
total genus 56
structure length 171
sequence length 192
chains with identical sequence B, C, D, E, F, G
ec nomenclature ec 3.4.21.92: Endopeptidase Clp.
pdb deposition date 2004-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00574 CLP_protease Clp protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 1y7oA00
2VSUF 5DU4A 3WG5A 4ELSA 2DEOA 3T89A 4GM2A 2F9IA 2VSUA 4I42A 4FZWA 4IZDA 3MOYA 2CBYA 1XNYA 2ZQQA 3H0JA 1YG8A 3FF6A 1FC7A 1UYRA 3H81A 3HE2A 3V5EA 4K3WA 5DTWA 4JOTA 3PEAA 2Q34A 2VSSE 2Q2XA 4EMMA 4OMRA 4JYLA 2X24A 4ZDDA 4U19A 3Q0GA 1HZDA 5IKLB 3G64A 5DUFA 1K32A 2F6IA 4FNBA 3N6RB 1WZ8A 3LKEA 1WDKA 1Q52A 3R9TA 1FCFA 4FNDA 4G2RA 1VRGA 5DZKH 3R0OA 2CE3A 2FW2A 3M6MA 2A7SA 3T3WA 3NJDA 5E0NX 4JCSA 1FC9A 3QREA 2J5II 1N6DA 1XO6A 3ZWCA 3LAOA 3KTKA 5C9GA 3BF0A 4JFCA 4LK5A 4U0GA 4B3JA 1SZOA 2VSUE 3K50A 2ZL4A 4RYFH 4B3HA 2A7KA 3QXZA 4RYFA 1SG4A 1EY3A 5DL1A 5JBWA 3H0SA 5DUCA 2GTRA 1FC6A 4ZDCA 5INFA 5E0SH 1TG6A 4ELWA 1ON3A 3K8XA 2ZQRA 2F9YA 3ZW9A 1DCIA 3MT6A 4OG1A 2C8TA 3TZ3A 4L8KA 3NJBA 1K39A 5KDRB 1X0UA 3L3SA 3ZW8A 4MI2A 5FIFA 1UYSA 5G1SA 3QMJA 3TT7A 2BZRA 4I4ZA 4WZ8B 3GKBA 3BPPA 5G1QA 1J7XA 3KQFA 3R6HA 2FBMA 2F9YB 2UZFA 4MOUA 1NZYB 2ZL2A 2WTBA 4JCQA 3Q7HA 1OD2A 2X58A 1PIXA 4GHNA 4U0HA 3U9TB 3OMEA 4WYOB 3PZKA 3QYRA 3P2LA 3P5MA 2F9IB 1XNWA 4FN7A 3R9SA 4I52A 3U9SB 1RJNA 3Q1TA 4IZBA 2D3TA 1XNVA 2EJ5A 2J5GD 4ELXA 3VIVA 5FUSA 4JCRA 3TLFA 3OT6A 3TVUA 4HNKA 3H02A 4HC8A 4ZDBA 4QIJA 4NNQA 4U0GH 3H0QA 3KTIA 2ZL3A 5CTCA 2J5IA 4JYJA 2A81A 1N6EA 4B3IA 5DTPA 4Q1IA 4JVTA 5JBXA 4ZU2A 4JJTA 1HNOA 1UYVA 5C90A 3KTGA 3IB9A 3ZWBA 4QIIA 3IBBA 3RSTA 3MYBA 2F6QA 3GF7A 1HNUA 1WDLA 5DKPA 1N6FA 4WCZA 3FDUA 2J5IB 3P85A 4FZWC 2PBPA 2ZL0A 3SLLA 4EMLA 3ST9A 1JXZA 3OC7A 2FZSA 5CTBA 2W3PA 3QXIA 4U1AA 3TRRA 3BEZA 2PG8A 4Q0GA 4ZDFA 4IZCA 1PJHA 1YG6A 1TYFA 2VREA 1EF9A 3PGQA 3QWDA 4KPKA 2DUBA 3H0UA 4RCNA 3RSIA 4FB8A 1Q51A 4ASIA 3QKAA 3TVWA 3SWXA 3T88A 5KJPA 3PE8A 5G1RA 4FJWD 2PPYA 1UYTA 1OD4A 4KD6A 3MFMA 2J5SA 5DU8A 3T8AA 4JWVA 1O8UA 5MGBA 3HRXA 3TT6A 4KNPA 4OLQA 1XX4A 1RJMA 1Y7OA 4EMPA 4L6WA 3JU1A 5DZKA 1WDMA 4Z0MA 3T8BA 3Q0JA 4KWBA 1DUBA 4K29A 1UIYA 4NEKA 2Q35A 3ISAA 2VSSF 3GF3A 2NP9A 3KTJA 3KTHA 3U9RB 3DJAA 4F47A 2VSSA 5KDRA 5INGA 3IAVA 2IEXA 3M6NA 4QFEA 3GLMA 3HINA 3R9QA 2VSUC 3DORA 3V5IA 3HP0A 4MXIA 3TDCA 3HLN1 1ON9A 3STAA 3ZWAA 1W2XA 4U18A 5INIA 2HW5A 4ZDEA 1EF8A 5E0SA 4DI1A 3I47A 4YLHA 2QQ3A 5DU6A 2J5GA 1MJ3A 1NZYA 2VX2A 3GMAA 3RRVA 3QK8A 4JCTA 4K2NA 4FN8A 3TV5A 4JSBA
chains in the Genus database with same CATH superfamily
2VSUF 5DU4A 3WG5A 4ELSA 2DEOA 3T89A 4GM2A 2F9IA 2VSUA 4I42A 4FZWA 4IZDA 3MOYA 2CBYA 1XNYA 2ZQQA 3H0JA 1YG8A 3FF6A 1FC7A 1UYRA 3H81A 3HE2A 3V5EA 4K3WA 5DTWA 4JOTA 3PEAA 2Q34A 4NARA 2VSSE 2Q2XA 4EMMA 4OMRA 4JYLA 2X24A 4ZDDA 4U19A 3Q0GA 1HZDA 5IKLB 3G64A 5DUFA 1K32A 2F6IA 4FNBA 3N6RB 1WZ8A 3LKEA 1WDKA 1Q52A 3R9TA 1FCFA 4FNDA 4G2RA 1VRGA 5DZKH 3R0OA 2CE3A 2FW2A 3M6MA 2A7SA 3T3WA 3NJDA 5E0NX 5HUQA 4JCSA 1FC9A 3QREA 2J5II 1N6DA 1XO6A 4HDTA 3ZWCA 3LAOA 3KTKA 5C9GA 3BF0A 4JFCA 4LK5A 4U0GA 4B3JA 1SZOA 2VSUE 3K50A 2ZL4A 4RYFH 4B3HA 2A7KA 3QXZA 4RYFA 1SG4A 1EY3A 5DL1A 5JBWA 3H0SA 5DUCA 2GTRA 1FC6A 4ZDCA 5INFA 5E0SH 1TG6A 4ELWA 1ON3A 3K8XA 2ZQRA 2F9YA 3ZW9A 1DCIA 3MT6A 4OG1A 2C8TA 3TZ3A 4L8KA 3NJBA 1K39A 5KDRB 1X0UA 3L3SA 3ZW8A 4MI2A 5FIFA 1UYSA 5G1SA 3QMJA 3TT7A 2BZRA 4I4ZA 4WZ8B 3GKBA 3BPPA 5G1QA 1J7XA 3KQFA 3R6HA 2FBMA 2F9YB 2UZFA 4MOUA 1NZYB 2ZL2A 2WTBA 4JCQA 3Q7HA 1OD2A 2X58A 1PIXA 4GHNA 4U0HA 3U9TB 3OMEA 4WYOB 3PZKA 3QYRA 3P2LA 3P5MA 2F9IB 1XNWA 4FN7A 3R9SA 4I52A 3U9SB 1RJNA 3Q1TA 4IZBA 2D3TA 1XNVA 2EJ5A 2J5GD 4ELXA 3VIVA 5FUSA 4JCRA 3TLFA 3OT6A 3TVUA 4HNKA 3H02A 4HC8A 4ZDBA 4QIJA 4NNQA 4U0GH 3H0QA 3KTIA 2ZL3A 5CTCA 2J5IA 4JYJA 2A81A 1N6EA 4B3IA 5DTPA 4Q1IA 4JVTA 5JBXA 4ZU2A 4JJTA 1HNOA 1UYVA 5C90A 3KTGA 3IB9A 3ZWBA 4QIIA 3IBBA 3RSTA 3MYBA 2F6QA 3GF7A 1HNUA 1WDLA 5DKPA 1N6FA 4WCZA 3FDUA 2J5IB 3P85A 4FZWC 2PBPA 2ZL0A 3SLLA 4EMLA 3ST9A 1JXZA 3OC7A 2FZSA 5CTBA 2W3PA 3QXIA 4U1AA 3TRRA 3BEZA 2PG8A 4Q0GA 4ZDFA 4IZCA 1PJHA 1YG6A 1TYFA 2VREA 1EF9A 3PGQA 3QWDA 4KPKA 2DUBA 3H0UA 4RCNA 3RSIA 4FB8A 1Q51A 4ASIA 3QKAA 3TVWA 3SWXA 3T88A 5KJPA 3PE8A 5G1RA 4FJWD 2PPYA 1UYTA 1OD4A 4J2UA 4KD6A 3MFMA 2J5SA 5DU8A 3T8AA 4JWVA 1O8UA 3BPTA 3HRXA 5MGBA 3TT6A 4KNPA 4OLQA 1XX4A 1RJMA 1Y7OA 4EMPA 4L6WA 3JU1A 5DZKA 1WDMA 4Z0MA 3T8BA 3Q0JA 4KWBA 1DUBA 4K29A 1UIYA 4NEKA 2Q35A 3ISAA 2VSSF 3GF3A 2NP9A 3KTJA 3KTHA 3U9RB 3DJAA 2YJGA 4F47A 2VSSA 5KDRA 5INGA 3IAVA 2IEXA 3M6NA 4QFEA 3GLMA 3HINA 3R9QA 2VSUC 3DORA 3V5IA 3HP0A 4MXIA 3TDCA 3HLN1 1ON9A 3STAA 3ZWAA 1W2XA 4U18A 5INIA 2HW5A 4ZDEA 1EF8A 5E0SA 4DI1A 3I47A 4YLHA 2QQ3A 5DU6A 2J5GA 1MJ3A 1NZYA 2VX2A 3GMAA 3RRVA 3QK8A 4JCTA 4K2NA 4FN8A 3TV5A 4JSBA
chains in the Genus database with same CATH topology
2VSUF 5DU4A 3WG5A 4ELSA 2DEOA 3T89A 4GM2A 2F9IA 2VSUA 4I42A 4FZWA 4IZDA 3MOYA 2CBYA 1XNYA 2ZQQA 3H0JA 1YG8A 3FF6A 1FC7A 1UYRA 3H81A 3HE2A 3V5EA 4K3WA 5DTWA 4JOTA 3PEAA 2Q34A 4NARA 2VSSE 2Q2XA 4EMMA 4OMRA 4JYLA 2X24A 4ZDDA 4U19A 3Q0GA 1HZDA 5IKLB 3G64A 5DUFA 1K32A 2F6IA 4FNBA 3N6RB 1WZ8A 3LKEA 1WDKA 1Q52A 3R9TA 1FCFA 4FNDA 4G2RA 1VRGA 5DZKH 3R0OA 2CE3A 2FW2A 3M6MA 2A7SA 3T3WA 3NJDA 5E0NX 5HUQA 4JCSA 1FC9A 3QREA 2J5II 1N6DA 1XO6A 4HDTA 3ZWCA 3LAOA 3KTKA 5C9GA 3BF0A 4JFCA 4LK5A 4U0GA 4B3JA 1SZOA 2VSUE 3K50A 2ZL4A 4RYFH 4B3HA 2A7KA 3QXZA 4RYFA 1SG4A 1EY3A 5DL1A 5JBWA 3H0SA 5DUCA 2GTRA 1FC6A 4ZDCA 5INFA 5E0SH 1TG6A 4ELWA 1ON3A 3K8XA 2ZQRA 2F9YA 3ZW9A 1DCIA 3MT6A 4OG1A 2C8TA 3TZ3A 4L8KA 3NJBA 1K39A 5KDRB 1X0UA 3L3SA 3ZW8A 4MI2A 5FIFA 1UYSA 5G1SA 3QMJA 3TT7A 2BZRA 4I4ZA 4WZ8B 3GKBA 3BPPA 5G1QA 1J7XA 3KQFA 3R6HA 2FBMA 2F9YB 2UZFA 4MOUA 1NZYB 2ZL2A 2WTBA 4JCQA 3Q7HA 1OD2A 2X58A 1PIXA 4GHNA 4U0HA 3U9TB 3OMEA 4WYOB 3PZKA 3QYRA 3P2LA 3P5MA 2F9IB 1XNWA 4FN7A 3R9SA 4I52A 3U9SB 1RJNA 3Q1TA 4IZBA 2D3TA 1XNVA 2EJ5A 2J5GD 4ELXA 3VIVA 5FUSA 4JCRA 3TLFA 3OT6A 3TVUA 4HNKA 3H02A 4HC8A 4ZDBA 4QIJA 4NNQA 4U0GH 3H0QA 3KTIA 2ZL3A 5CTCA 2J5IA 4JYJA 2A81A 1N6EA 4B3IA 5DTPA 4Q1IA 4JVTA 5JBXA 4ZU2A 4JJTA 1HNOA 1UYVA 5C90A 3KTGA 3IB9A 3ZWBA 4QIIA 3IBBA 3RSTA 3MYBA 2F6QA 3GF7A 1HNUA 1WDLA 5DKPA 1N6FA 4WCZA 3FDUA 2J5IB 3P85A 4FZWC 2PBPA 2ZL0A 3SLLA 4EMLA 3ST9A 1JXZA 3OC7A 2FZSA 5CTBA 2W3PA 3QXIA 4U1AA 3TRRA 3BEZA 2PG8A 4Q0GA 4ZDFA 4IZCA 1PJHA 1YG6A 1TYFA 2VREA 1EF9A 3PGQA 3QWDA 4KPKA 2DUBA 3H0UA 4RCNA 3RSIA 4FB8A 1Q51A 4ASIA 3QKAA 3TVWA 3SWXA 3T88A 5KJPA 3PE8A 5G1RA 4FJWD 2PPYA 1UYTA 1OD4A 4J2UA 4KD6A 3MFMA 2J5SA 5DU8A 3T8AA 4JWVA 1O8UA 3BPTA 3HRXA 5MGBA 3TT6A 4KNPA 4OLQA 1XX4A 1RJMA 1Y7OA 4EMPA 4L6WA 3JU1A 5DZKA 1WDMA 4Z0MA 3T8BA 3Q0JA 4KWBA 1DUBA 4K29A 1UIYA 4NEKA 2Q35A 3ISAA 2VSSF 3GF3A 2NP9A 3KTJA 3KTHA 3U9RB 3DJAA 2YJGA 4F47A 2VSSA 5KDRA 5INGA 3IAVA 2IEXA 3M6NA 4QFEA 3GLMA 3HINA 3R9QA 2VSUC 3DORA 3V5IA 3HP0A 4MXIA 3TDCA 3HLN1 1ON9A 3STAA 3ZWAA 1W2XA 4U18A 5INIA 2HW5A 4ZDEA 1EF8A 5E0SA 4DI1A 3I47A 4YLHA 2QQ3A 5DU6A 2J5GA 1MJ3A 1NZYA 2VX2A 3GMAA 3RRVA 3QK8A 4JCTA 4K2NA 4FN8A 3TV5A 4JSBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VSU F;  5DU4 A;  3WG5 A;  4ELS A;  2DEO A;  3T89 A;  4GM2 A;  2F9I A;  2VSU A;  4I42 A;  4FZW A;  4IZD A;  3MOY A;  2CBY A;  1XNY A;  2ZQQ A;  3H0J A;  1YG8 A;  3FF6 A;  1FC7 A;  1UYR A;  3H81 A;  3HE2 A;  3V5E A;  4K3W A;  5DTW A;  4JOT A;  3PEA A;  2Q34 A;  2VSS E;  2Q2X A;  4EMM A;  4OMR A;  4JYL A;  2X24 A;  4ZDD A;  4U19 A;  3Q0G A;  1HZD A;  5IKL B;  3G64 A;  5DUF A;  1K32 A;  2F6I A;  4FNB A;  3N6R B;  1WZ8 A;  3LKE A;  1WDK A;  1Q52 A;  3R9T A;  1FCF A;  4FND A;  4G2R A;  1VRG A;  5DZK H;  3R0O A;  2CE3 A;  2FW2 A;  3M6M A;  2A7S A;  3T3W A;  3NJD A;  5E0N X;  4JCS A;  1FC9 A;  3QRE A;  2J5I I;  1N6D A;  1XO6 A;  3ZWC A;  3LAO A;  3KTK A;  5C9G A;  3BF0 A;  4JFC A;  4LK5 A;  4U0G A;  4B3J A;  1SZO A;  2VSU E;  3K50 A;  2ZL4 A;  4RYF H;  4B3H A;  2A7K A;  3QXZ A;  4RYF A;  1SG4 A;  1EY3 A;  5DL1 A;  5JBW A;  3H0S A;  5DUC A;  2GTR A;  1FC6 A;  4ZDC A;  5INF A;  5E0S H;  1TG6 A;  4ELW A;  1ON3 A;  3K8X A;  2ZQR A;  2F9Y A;  3ZW9 A;  1DCI A;  3MT6 A;  4OG1 A;  2C8T A;  3TZ3 A;  4L8K A;  3NJB A;  1K39 A;  5KDR B;  1X0U A;  3L3S A;  3ZW8 A;  4MI2 A;  5FIF A;  1UYS A;  5G1S A;  3QMJ A;  3TT7 A;  2BZR A;  4I4Z A;  4WZ8 B;  3GKB A;  3BPP A;  5G1Q A;  1J7X A;  3KQF A;  3R6H A;  2FBM A;  2F9Y B;  2UZF A;  4MOU A;  1NZY B;  2ZL2 A;  2WTB A;  4JCQ A;  3Q7H A;  1OD2 A;  2X58 A;  1PIX A;  4GHN A;  4U0H A;  3U9T B;  3OME A;  4WYO B;  3PZK A;  3QYR A;  3P2L A;  3P5M A;  2F9I B;  1XNW A;  4FN7 A;  3R9S A;  4I52 A;  3U9S B;  1RJN A;  3Q1T A;  4IZB A;  2D3T A;  1XNV A;  2EJ5 A;  2J5G D;  4ELX A;  3VIV A;  5FUS A;  4JCR A;  3TLF A;  3OT6 A;  3TVU A;  4HNK A;  3H02 A;  4HC8 A;  4ZDB A;  4QIJ A;  4NNQ A;  4U0G H;  3H0Q A;  3KTI A;  2ZL3 A;  5CTC A;  2J5I A;  4JYJ A;  2A81 A;  1N6E A;  4B3I A;  5DTP A;  4Q1I A;  4JVT A;  5JBX A;  4ZU2 A;  4JJT A;  1HNO A;  1UYV A;  5C90 A;  3KTG A;  3IB9 A;  3ZWB A;  4QII A;  3IBB A;  3RST A;  3MYB A;  2F6Q A;  3GF7 A;  1HNU A;  1WDL A;  5DKP A;  1N6F A;  4WCZ A;  3FDU A;  2J5I B;  3P85 A;  4FZW C;  2PBP A;  2ZL0 A;  3SLL A;  4EML A;  3ST9 A;  1JXZ A;  3OC7 A;  2FZS A;  5CTB A;  2W3P A;  3QXI A;  4U1A A;  3TRR A;  3BEZ A;  2PG8 A;  4Q0G A;  4ZDF A;  4IZC A;  1PJH A;  1YG6 A;  1TYF A;  2VRE A;  1EF9 A;  3PGQ A;  3QWD A;  4KPK A;  2DUB A;  3H0U A;  4RCN A;  3RSI A;  4FB8 A;  1Q51 A;  4ASI A;  3QKA A;  3TVW A;  3SWX A;  3T88 A;  5KJP A;  3PE8 A;  5G1R A;  4FJW D;  2PPY A;  1UYT A;  1OD4 A;  4KD6 A;  3MFM A;  2J5S A;  5DU8 A;  3T8A A;  4JWV A;  1O8U A;  5MGB A;  3HRX A;  3TT6 A;  4KNP A;  4OLQ A;  1XX4 A;  1RJM A;  1Y7O A;  4EMP A;  4L6W A;  3JU1 A;  5DZK A;  1WDM A;  4Z0M A;  3T8B A;  3Q0J A;  4KWB A;  1DUB A;  4K29 A;  1UIY A;  4NEK A;  2Q35 A;  3ISA A;  2VSS F;  3GF3 A;  2NP9 A;  3KTJ A;  3KTH A;  3U9R B;  3DJA A;  4F47 A;  2VSS A;  5KDR A;  5ING A;  3IAV A;  2IEX A;  3M6N A;  4QFE A;  3GLM A;  3HIN A;  3R9Q A;  2VSU C;  3DOR A;  3V5I A;  3HP0 A;  4MXI A;  3TDC A;  3HLN 1;  1ON9 A;  3STA A;  3ZWA A;  1W2X A;  4U18 A;  5INI A;  2HW5 A;  4ZDE A;  1EF8 A;  5E0S A;  4DI1 A;  3I47 A;  4YLH A;  2QQ3 A;  5DU6 A;  2J5G A;  1MJ3 A;  1NZY A;  2VX2 A;  3GMA A;  3RRV A;  3QK8 A;  4JCT A;  4K2N A;  4FN8 A;  3TV5 A;  4JSB A; 
#chains in the Genus database with same CATH topology
 2VSU F;  5DU4 A;  3WG5 A;  4ELS A;  2DEO A;  3T89 A;  4GM2 A;  2F9I A;  2VSU A;  4I42 A;  4FZW A;  4IZD A;  3MOY A;  2CBY A;  1XNY A;  2ZQQ A;  3H0J A;  1YG8 A;  3FF6 A;  1FC7 A;  1UYR A;  3H81 A;  3HE2 A;  3V5E A;  4K3W A;  5DTW A;  4JOT A;  3PEA A;  2Q34 A;  4NAR A;  2VSS E;  2Q2X A;  4EMM A;  4OMR A;  4JYL A;  2X24 A;  4ZDD A;  4U19 A;  3Q0G A;  1HZD A;  5IKL B;  3G64 A;  5DUF A;  1K32 A;  2F6I A;  4FNB A;  3N6R B;  1WZ8 A;  3LKE A;  1WDK A;  1Q52 A;  3R9T A;  1FCF A;  4FND A;  4G2R A;  1VRG A;  5DZK H;  3R0O A;  2CE3 A;  2FW2 A;  3M6M A;  2A7S A;  3T3W A;  3NJD A;  5E0N X;  5HUQ A;  4JCS A;  1FC9 A;  3QRE A;  2J5I I;  1N6D A;  1XO6 A;  4HDT A;  3ZWC A;  3LAO A;  3KTK A;  5C9G A;  3BF0 A;  4JFC A;  4LK5 A;  4U0G A;  4B3J A;  1SZO A;  2VSU E;  3K50 A;  2ZL4 A;  4RYF H;  4B3H A;  2A7K A;  3QXZ A;  4RYF A;  1SG4 A;  1EY3 A;  5DL1 A;  5JBW A;  3H0S A;  5DUC A;  2GTR A;  1FC6 A;  4ZDC A;  5INF A;  5E0S H;  1TG6 A;  4ELW A;  1ON3 A;  3K8X A;  2ZQR A;  2F9Y A;  3ZW9 A;  1DCI A;  3MT6 A;  4OG1 A;  2C8T A;  3TZ3 A;  4L8K A;  3NJB A;  1K39 A;  5KDR B;  1X0U A;  3L3S A;  3ZW8 A;  4MI2 A;  5FIF A;  1UYS A;  5G1S A;  3QMJ A;  3TT7 A;  2BZR A;  4I4Z A;  4WZ8 B;  3GKB A;  3BPP A;  5G1Q A;  1J7X A;  3KQF A;  3R6H A;  2FBM A;  2F9Y B;  2UZF A;  4MOU A;  1NZY B;  2ZL2 A;  2WTB A;  4JCQ A;  3Q7H A;  1OD2 A;  2X58 A;  1PIX A;  4GHN A;  4U0H A;  3U9T B;  3OME A;  4WYO B;  3PZK A;  3QYR A;  3P2L A;  3P5M A;  2F9I B;  1XNW A;  4FN7 A;  3R9S A;  4I52 A;  3U9S B;  1RJN A;  3Q1T A;  4IZB A;  2D3T A;  1XNV A;  2EJ5 A;  2J5G D;  4ELX A;  3VIV A;  5FUS A;  4JCR A;  3TLF A;  3OT6 A;  3TVU A;  4HNK A;  3H02 A;  4HC8 A;  4ZDB A;  4QIJ A;  4NNQ A;  4U0G H;  3H0Q A;  3KTI A;  2ZL3 A;  5CTC A;  2J5I A;  4JYJ A;  2A81 A;  1N6E A;  4B3I A;  5DTP A;  4Q1I A;  4JVT A;  5JBX A;  4ZU2 A;  4JJT A;  1HNO A;  1UYV A;  5C90 A;  3KTG A;  3IB9 A;  3ZWB A;  4QII A;  3IBB A;  3RST A;  3MYB A;  2F6Q A;  3GF7 A;  1HNU A;  1WDL A;  5DKP A;  1N6F A;  4WCZ A;  3FDU A;  2J5I B;  3P85 A;  4FZW C;  2PBP A;  2ZL0 A;  3SLL A;  4EML A;  3ST9 A;  1JXZ A;  3OC7 A;  2FZS A;  5CTB A;  2W3P A;  3QXI A;  4U1A A;  3TRR A;  3BEZ A;  2PG8 A;  4Q0G A;  4ZDF A;  4IZC A;  1PJH A;  1YG6 A;  1TYF A;  2VRE A;  1EF9 A;  3PGQ A;  3QWD A;  4KPK A;  2DUB A;  3H0U A;  4RCN A;  3RSI A;  4FB8 A;  1Q51 A;  4ASI A;  3QKA A;  3TVW A;  3SWX A;  3T88 A;  5KJP A;  3PE8 A;  5G1R A;  4FJW D;  2PPY A;  1UYT A;  1OD4 A;  4J2U A;  4KD6 A;  3MFM A;  2J5S A;  5DU8 A;  3T8A A;  4JWV A;  1O8U A;  3BPT A;  3HRX A;  5MGB A;  3TT6 A;  4KNP A;  4OLQ A;  1XX4 A;  1RJM A;  1Y7O A;  4EMP A;  4L6W A;  3JU1 A;  5DZK A;  1WDM A;  4Z0M A;  3T8B A;  3Q0J A;  4KWB A;  1DUB A;  4K29 A;  1UIY A;  4NEK A;  2Q35 A;  3ISA A;  2VSS F;  3GF3 A;  2NP9 A;  3KTJ A;  3KTH A;  3U9R B;  3DJA A;  2YJG A;  4F47 A;  2VSS A;  5KDR A;  5ING A;  3IAV A;  2IEX A;  3M6N A;  4QFE A;  3GLM A;  3HIN A;  3R9Q A;  2VSU C;  3DOR A;  3V5I A;  3HP0 A;  4MXI A;  3TDC A;  3HLN 1;  1ON9 A;  3STA A;  3ZWA A;  1W2X A;  4U18 A;  5INI A;  2HW5 A;  4ZDE A;  1EF8 A;  5E0S A;  4DI1 A;  3I47 A;  4YLH A;  2QQ3 A;  5DU6 A;  2J5G A;  1MJ3 A;  1NZY A;  2VX2 A;  3GMA A;  3RRV A;  3QK8 A;  4JCT A;  4K2N A;  4FN8 A;  3TV5 A;  4JSB A; 
#chains in the Genus database with same CATH homology
 2VSU F;  5DU4 A;  3WG5 A;  4ELS A;  2DEO A;  3T89 A;  4GM2 A;  2F9I A;  2VSU A;  4I42 A;  4FZW A;  4IZD A;  3MOY A;  2CBY A;  1XNY A;  2ZQQ A;  3H0J A;  1YG8 A;  3FF6 A;  1FC7 A;  1UYR A;  3H81 A;  3HE2 A;  3V5E A;  4K3W A;  5DTW A;  4JOT A;  3PEA A;  2Q34 A;  4NAR A;  2VSS E;  2Q2X A;  4EMM A;  4OMR A;  4JYL A;  2X24 A;  4ZDD A;  4U19 A;  3Q0G A;  1HZD A;  5IKL B;  3G64 A;  5DUF A;  1K32 A;  2F6I A;  4FNB A;  3N6R B;  1WZ8 A;  3LKE A;  1WDK A;  1Q52 A;  3R9T A;  1FCF A;  4FND A;  4G2R A;  1VRG A;  5DZK H;  3R0O A;  2CE3 A;  2FW2 A;  3M6M A;  2A7S A;  3T3W A;  3NJD A;  5E0N X;  5HUQ A;  4JCS A;  1FC9 A;  3QRE A;  2J5I I;  1N6D A;  1XO6 A;  4HDT A;  3ZWC A;  3LAO A;  3KTK A;  5C9G A;  3BF0 A;  4JFC A;  4LK5 A;  4U0G A;  4B3J A;  1SZO A;  2VSU E;  3K50 A;  2ZL4 A;  4RYF H;  4B3H A;  2A7K A;  3QXZ A;  4RYF A;  1SG4 A;  1EY3 A;  5DL1 A;  5JBW A;  3H0S A;  5DUC A;  2GTR A;  1FC6 A;  4ZDC A;  5INF A;  5E0S H;  1TG6 A;  4ELW A;  1ON3 A;  3K8X A;  2ZQR A;  2F9Y A;  3ZW9 A;  1DCI A;  3MT6 A;  4OG1 A;  2C8T A;  3TZ3 A;  4L8K A;  3NJB A;  1K39 A;  5KDR B;  1X0U A;  3L3S A;  3ZW8 A;  4MI2 A;  5FIF A;  1UYS A;  5G1S A;  3QMJ A;  3TT7 A;  2BZR A;  4I4Z A;  4WZ8 B;  3GKB A;  3BPP A;  5G1Q A;  1J7X A;  3KQF A;  3R6H A;  2FBM A;  2F9Y B;  2UZF A;  4MOU A;  1NZY B;  2ZL2 A;  2WTB A;  4JCQ A;  3Q7H A;  1OD2 A;  2X58 A;  1PIX A;  4GHN A;  4U0H A;  3U9T B;  3OME A;  4WYO B;  3PZK A;  3QYR A;  3P2L A;  3P5M A;  2F9I B;  1XNW A;  4FN7 A;  3R9S A;  4I52 A;  3U9S B;  1RJN A;  3Q1T A;  4IZB A;  2D3T A;  1XNV A;  2EJ5 A;  2J5G D;  4ELX A;  3VIV A;  5FUS A;  4JCR A;  3TLF A;  3OT6 A;  3TVU A;  4HNK A;  3H02 A;  4HC8 A;  4ZDB A;  4QIJ A;  4NNQ A;  4U0G H;  3H0Q A;  3KTI A;  2ZL3 A;  5CTC A;  2J5I A;  4JYJ A;  2A81 A;  1N6E A;  4B3I A;  5DTP A;  4Q1I A;  4JVT A;  5JBX A;  4ZU2 A;  4JJT A;  1HNO A;  1UYV A;  5C90 A;  3KTG A;  3IB9 A;  3ZWB A;  4QII A;  3IBB A;  3RST A;  3MYB A;  2F6Q A;  3GF7 A;  1HNU A;  1WDL A;  5DKP A;  1N6F A;  4WCZ A;  3FDU A;  2J5I B;  3P85 A;  4FZW C;  2PBP A;  2ZL0 A;  3SLL A;  4EML A;  3ST9 A;  1JXZ A;  3OC7 A;  2FZS A;  5CTB A;  2W3P A;  3QXI A;  4U1A A;  3TRR A;  3BEZ A;  2PG8 A;  4Q0G A;  4ZDF A;  4IZC A;  1PJH A;  1YG6 A;  1TYF A;  2VRE A;  1EF9 A;  3PGQ A;  3QWD A;  4KPK A;  2DUB A;  3H0U A;  4RCN A;  3RSI A;  4FB8 A;  1Q51 A;  4ASI A;  3QKA A;  3TVW A;  3SWX A;  3T88 A;  5KJP A;  3PE8 A;  5G1R A;  4FJW D;  2PPY A;  1UYT A;  1OD4 A;  4J2U A;  4KD6 A;  3MFM A;  2J5S A;  5DU8 A;  3T8A A;  4JWV A;  1O8U A;  3BPT A;  3HRX A;  5MGB A;  3TT6 A;  4KNP A;  4OLQ A;  1XX4 A;  1RJM A;  1Y7O A;  4EMP A;  4L6W A;  3JU1 A;  5DZK A;  1WDM A;  4Z0M A;  3T8B A;  3Q0J A;  4KWB A;  1DUB A;  4K29 A;  1UIY A;  4NEK A;  2Q35 A;  3ISA A;  2VSS F;  3GF3 A;  2NP9 A;  3KTJ A;  3KTH A;  3U9R B;  3DJA A;  2YJG A;  4F47 A;  2VSS A;  5KDR A;  5ING A;  3IAV A;  2IEX A;  3M6N A;  4QFE A;  3GLM A;  3HIN A;  3R9Q A;  2VSU C;  3DOR A;  3V5I A;  3HP0 A;  4MXI A;  3TDC A;  3HLN 1;  1ON9 A;  3STA A;  3ZWA A;  1W2X A;  4U18 A;  5INI A;  2HW5 A;  4ZDE A;  1EF8 A;  5E0S A;  4DI1 A;  3I47 A;  4YLH A;  2QQ3 A;  5DU6 A;  2J5G A;  1MJ3 A;  1NZY A;  2VX2 A;  3GMA A;  3RRV A;  3QK8 A;  4JCT A;  4K2N A;  4FN8 A;  3TV5 A;  4JSB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...