1Y7OA

The structure of streptococcus pneumoniae a153p clpp
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
192
structure length
171
Chain Sequence
IPVVIESYDIYSRLLKDRIIMLTGPVEDNMANSVIAQLLFLDAQDSTKDIYLYVNTPGGSVSAGLAIVDTMNFIKADVQTIVMGMAASMGTVIASSGAKGKRFMLPNAEYMIHQPMAPEHLLKTRNTLEKILAENSGQSMEKVHADAERDNWMSAQETLEYGFIDEIMANN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The ClpP double ring tetradecameric protease exhibits plastic ring-ring interactions, and the N termini of its subunits form flexible loops that are essential for ClpXP and ClpAP complex formation.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase
molecule keywords ATP-dependent Clp protease proteolytic subunit
total genus 56
structure length 171
sequence length 192
chains with identical sequence B, C, D, E, F, G
ec nomenclature ec 3.4.21.92: Endopeptidase Clp.
pdb deposition date 2004-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00574 CLP_protease Clp protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 1y7oA00
3MOYA 2VSUA 4F47A 5DUCA 1HNUA 3HINA 4EMMA 3LAOA 1Q51A 1HNOA 2EJ5A 4ASIA 1K39A 2F9YB 1Q52A 1FC6A 4B3IA 5DTWA 3Q0GA 1J7XA 3GMAA 4JWVA 1XNYA 4K29A 1TYFA 3H81A 4FNDA 3P2LA 3KQFA 3TZ3A 3MFMA 4ELWA 5DU4A 5INFA 4MOUA 3K50A 3TVWA 2X24A 4FZWA 4JCRA 3HRXA 4MI2A 1JXZA 3PE8A 3GF3A 1W2XA 1MJ3A 4I52A 3KTIA 2FW2A 3TT6A 2UZFA 3IB9A 3Q0JA 2PG8A 1FC9A 2BZRA 2J5IA 3H02A 1YG8A 4FN8A 4EMPA 3KTGA 3U9RB 2ZQRA 1VRGA 3NJDA 3ZWBA 4G2RA 1ON3A 4GHNA 1O8UA 3OMEA 4WYOB 4U18A 5IKLB 4QIIA 5DZKH 1RJNA 2DEOA 3LKEA 5DTPA 1EF9A 4L8KA 4JOTA 3M6NA 4NNQA 3RRVA 1PIXA 3R9QA 5INGA 1UYVA 3RSIA 1FC7A 1UYTA 3STAA 3ZW9A 3ZWCA 2VREA 2D3TA 1UYSA 1NZYA 2Q2XA 3MYBA 2QQ3A 5DUFA 4ZDFA 2VX2A 3PGQA 3GLMA 2F6QA 4KWBA 5G1RA 4HNKA 2A81A 3R9SA 3IBBA 4EMLA 4ZDCA 4U0GH 4FNBA 5JBXA 3Q1TA 4RYFH 2ZL3A 1PJHA 4HC8A 3KTKA 1XNVA 2FBMA 1RJMA 5MGBA 2J5II 2VSUF 2VSUC 4Q1IA 3K8XA 3T88A 3QKAA 3R6HA 2PPYA 2J5GA 3OC7A 4KNPA 3RSTA 5FUSA 3QYRA 5KJPA 3T89A 4QFEA 2W3PA 3QREA 3BEZA 3T8BA 3U9SB 2VSSA 2NP9A 1OD2A 2F6IA 3DORA 4OG1A 4FN7A 1DCIA 2Q34A 3KTJA 2A7KA 5CTCA 4JSBA 3T8AA 3FDUA 4ZDBA 1DUBA 2VSSE 4KD6A 2ZL2A 4GM2A 3V5EA 3QXIA 3TVUA 3U9TB 4JYJA 3L3SA 4QIJA 1OD4A 5KDRA 3DJAA 3GF7A 3HLN1 4RYFA 2FZSA 4U0GA 4YLHA 1TG6A 3KTHA 1ON9A 3GKBA 5KDRB 3H0JA 3I47A 3M6MA 4JVTA 4ELXA 1FCFA 4OLQA 4JCSA 4JJTA 3QK8A 4JCQA 2C8TA 1YG6A 3ZWAA 3H0SA 4IZBA 3VIVA 4RCNA 5CTBA 1X0UA 3PEAA 4K2NA 2F9IA 2J5IB 3SLLA 4U1AA 3BF0A 1EY3A 5DL1A 4IZCA 3OT6A 4FJWD 2HW5A 2F9YA 2F9IB 3PZKA 3H0UA 2GTRA 1N6FA 4ZDDA 2DUBA 1UIYA 3H0QA 2PBPA 4Z0MA 3Q7HA 1XO6A 5DZKA 4B3HA 2IEXA 3QMJA 1WZ8A 3P5MA 5DU8A 3QWDA 4DI1A 4B3JA 1SG4A 4WZ8B 4WCZA 2X58A 4FZWC 3TRRA 3V5IA 3WG5A 3IAVA 4JFCA 4U0HA 3TDCA 1UYRA 1K32A 2ZL0A 1WDLA 3MT6A 4JCTA 3FF6A 3T3WA 2A7SA 3JU1A 3HP0A 3TLFA 3N6RB 4KPKA 5C9GA 2CE3A 1HZDA 2Q35A 4ELSA 1WDMA 4LK5A 4U19A 1SZOA 4Q0GA 2J5SA 4I4ZA 3G64A 1EF8A 4IZDA 2J5GD 4K3WA 4I42A 5INIA 3HE2A 2ZQQA 5FIFA 5C90A 4L6WA 4ZU2A 5E0SH 3TT7A 3TV5A 3R0OA 4ZDEA 4MXIA 1XX4A 5JBWA 1Y7OA 2ZL4A 2CBYA 4JYLA 1XNWA 3ZW8A 3QXZA 1NZYB 5DU6A 3BPPA 3P85A 2WTBA 3ST9A 3SWXA 5G1QA 3R9TA 3ISAA 5E0NX 1N6DA 2VSUE 3NJBA 5E0SA 2VSSF 1WDKA 4OMRA 4FB8A 4NEKA 5G1SA 1N6EA 5DKPA
chains in the Genus database with same CATH superfamily
3MOYA 2VSUA 4F47A 5DUCA 1HNUA 3HINA 4EMMA 3LAOA 1Q51A 1HNOA 2EJ5A 4ASIA 1K39A 2F9YB 1Q52A 1FC6A 4B3IA 5DTWA 3Q0GA 1J7XA 3GMAA 4JWVA 1XNYA 4K29A 1TYFA 3H81A 4FNDA 4HDTA 3P2LA 3KQFA 3TZ3A 3MFMA 4ELWA 5DU4A 5INFA 4J2UA 4MOUA 3K50A 3TVWA 2X24A 4FZWA 4JCRA 3HRXA 4MI2A 1JXZA 3PE8A 3GF3A 1W2XA 1MJ3A 4I52A 3KTIA 2FW2A 3TT6A 2UZFA 3IB9A 3Q0JA 2PG8A 1FC9A 2BZRA 2J5IA 3H02A 1YG8A 4FN8A 4EMPA 3KTGA 3U9RB 2ZQRA 1VRGA 3NJDA 3ZWBA 4G2RA 1ON3A 4GHNA 1O8UA 3OMEA 4WYOB 4U18A 5IKLB 4QIIA 5DZKH 1RJNA 2DEOA 3LKEA 5DTPA 1EF9A 4L8KA 4JOTA 3M6NA 4NNQA 3RRVA 1PIXA 3R9QA 4NARA 5INGA 1UYVA 3RSIA 1FC7A 1UYTA 3STAA 3ZW9A 3ZWCA 2VREA 2D3TA 1UYSA 1NZYA 2Q2XA 3MYBA 2QQ3A 5DUFA 4ZDFA 2VX2A 3PGQA 3GLMA 2F6QA 2YJGA 4KWBA 5G1RA 4HNKA 2A81A 3R9SA 3IBBA 4EMLA 4ZDCA 4U0GH 4FNBA 5JBXA 3Q1TA 4RYFH 2ZL3A 1PJHA 4HC8A 3KTKA 1XNVA 2FBMA 1RJMA 5MGBA 2J5II 2VSUF 2VSUC 4Q1IA 3K8XA 3T88A 3QKAA 3R6HA 2PPYA 2J5GA 3OC7A 4KNPA 3RSTA 5FUSA 3QYRA 5KJPA 3T89A 4QFEA 2W3PA 3QREA 3BEZA 3T8BA 3U9SB 2VSSA 2NP9A 1OD2A 2F6IA 3DORA 4OG1A 4FN7A 1DCIA 2Q34A 3KTJA 2A7KA 5CTCA 4JSBA 3T8AA 3FDUA 4ZDBA 1DUBA 2VSSE 4KD6A 2ZL2A 4GM2A 3V5EA 3QXIA 3TVUA 3U9TB 4JYJA 3L3SA 4QIJA 1OD4A 5KDRA 3DJAA 3GF7A 3HLN1 4RYFA 2FZSA 4U0GA 4YLHA 1TG6A 3KTHA 1ON9A 3GKBA 5KDRB 3H0JA 3I47A 3M6MA 4JVTA 4ELXA 1FCFA 4OLQA 4JCSA 4JJTA 3QK8A 4JCQA 2C8TA 1YG6A 3ZWAA 3H0SA 4IZBA 3VIVA 4RCNA 5CTBA 1X0UA 3PEAA 4K2NA 2F9IA 2J5IB 3SLLA 4U1AA 3BF0A 1EY3A 5DL1A 4IZCA 3OT6A 4FJWD 2HW5A 2F9YA 2F9IB 3PZKA 3H0UA 2GTRA 1N6FA 4ZDDA 2DUBA 1UIYA 3H0QA 2PBPA 4Z0MA 3Q7HA 1XO6A 5DZKA 4B3HA 2IEXA 3QMJA 1WZ8A 3P5MA 5DU8A 3QWDA 4DI1A 4B3JA 1SG4A 4WZ8B 4WCZA 2X58A 4FZWC 3TRRA 3V5IA 3WG5A 3IAVA 4JFCA 4U0HA 3TDCA 1UYRA 1K32A 2ZL0A 1WDLA 3MT6A 4JCTA 3FF6A 3T3WA 2A7SA 3JU1A 3HP0A 3TLFA 3N6RB 4KPKA 5C9GA 2CE3A 1HZDA 2Q35A 3BPTA 4ELSA 1WDMA 4LK5A 4U19A 1SZOA 4Q0GA 2J5SA 4I4ZA 3G64A 1EF8A 4IZDA 2J5GD 4K3WA 4I42A 5INIA 3HE2A 2ZQQA 5FIFA 5C90A 4L6WA 4ZU2A 5E0SH 3TT7A 3TV5A 3R0OA 4ZDEA 4MXIA 1XX4A 5JBWA 1Y7OA 2ZL4A 2CBYA 4JYLA 1XNWA 3ZW8A 3QXZA 1NZYB 5HUQA 5DU6A 3BPPA 3P85A 2WTBA 3ST9A 3SWXA 5G1QA 3R9TA 3ISAA 5E0NX 1N6DA 2VSUE 3NJBA 5E0SA 2VSSF 1WDKA 4OMRA 4FB8A 4NEKA 5G1SA 1N6EA 5DKPA
chains in the Genus database with same CATH topology
3MOYA 2VSUA 4F47A 5DUCA 1HNUA 3HINA 4EMMA 3LAOA 1Q51A 1HNOA 2EJ5A 4ASIA 1K39A 2F9YB 1Q52A 1FC6A 4B3IA 5DTWA 3Q0GA 1J7XA 3GMAA 4JWVA 1XNYA 4K29A 1TYFA 3H81A 4FNDA 4HDTA 3P2LA 3KQFA 3TZ3A 3MFMA 4ELWA 5DU4A 5INFA 4J2UA 4MOUA 3K50A 3TVWA 2X24A 4FZWA 4JCRA 3HRXA 4MI2A 1JXZA 3PE8A 3GF3A 1W2XA 1MJ3A 4I52A 3KTIA 2FW2A 3TT6A 2UZFA 3IB9A 3Q0JA 2PG8A 1FC9A 2BZRA 2J5IA 3H02A 1YG8A 4FN8A 4EMPA 3KTGA 3U9RB 2ZQRA 1VRGA 3NJDA 3ZWBA 4G2RA 1ON3A 4GHNA 1O8UA 3OMEA 4WYOB 4U18A 5IKLB 4QIIA 5DZKH 1RJNA 2DEOA 3LKEA 5DTPA 1EF9A 4L8KA 4JOTA 3M6NA 4NNQA 3RRVA 1PIXA 3R9QA 4NARA 5INGA 1UYVA 3RSIA 1FC7A 1UYTA 3STAA 3ZW9A 3ZWCA 2VREA 2D3TA 1UYSA 1NZYA 2Q2XA 3MYBA 2QQ3A 5DUFA 4ZDFA 2VX2A 3PGQA 3GLMA 2F6QA 2YJGA 4KWBA 5G1RA 4HNKA 2A81A 3R9SA 3IBBA 4EMLA 4ZDCA 4U0GH 4FNBA 5JBXA 3Q1TA 4RYFH 2ZL3A 1PJHA 4HC8A 3KTKA 1XNVA 2FBMA 1RJMA 5MGBA 2J5II 2VSUF 2VSUC 4Q1IA 3K8XA 3T88A 3QKAA 3R6HA 2PPYA 2J5GA 3OC7A 4KNPA 3RSTA 5FUSA 3QYRA 5KJPA 3T89A 4QFEA 2W3PA 3QREA 3BEZA 3T8BA 3U9SB 2VSSA 2NP9A 1OD2A 2F6IA 3DORA 4OG1A 4FN7A 1DCIA 2Q34A 3KTJA 2A7KA 5CTCA 4JSBA 3T8AA 3FDUA 4ZDBA 1DUBA 2VSSE 4KD6A 2ZL2A 4GM2A 3V5EA 3QXIA 3TVUA 3U9TB 4JYJA 3L3SA 4QIJA 1OD4A 5KDRA 3DJAA 3GF7A 3HLN1 4RYFA 2FZSA 4U0GA 4YLHA 1TG6A 3KTHA 1ON9A 3GKBA 5KDRB 3H0JA 3I47A 3M6MA 4JVTA 4ELXA 1FCFA 4OLQA 4JCSA 4JJTA 3QK8A 4JCQA 2C8TA 1YG6A 3ZWAA 3H0SA 4IZBA 3VIVA 4RCNA 5CTBA 1X0UA 3PEAA 4K2NA 2F9IA 2J5IB 3SLLA 4U1AA 3BF0A 1EY3A 5DL1A 4IZCA 3OT6A 4FJWD 2HW5A 2F9YA 2F9IB 3PZKA 3H0UA 2GTRA 1N6FA 4ZDDA 2DUBA 1UIYA 3H0QA 2PBPA 4Z0MA 3Q7HA 1XO6A 5DZKA 4B3HA 2IEXA 3QMJA 1WZ8A 3P5MA 5DU8A 3QWDA 4DI1A 4B3JA 1SG4A 4WZ8B 4WCZA 2X58A 4FZWC 3TRRA 3V5IA 3WG5A 3IAVA 4JFCA 4U0HA 3TDCA 1UYRA 1K32A 2ZL0A 1WDLA 3MT6A 4JCTA 3FF6A 3T3WA 2A7SA 3JU1A 3HP0A 3TLFA 3N6RB 4KPKA 5C9GA 2CE3A 1HZDA 2Q35A 3BPTA 4ELSA 1WDMA 4LK5A 4U19A 1SZOA 4Q0GA 2J5SA 4I4ZA 3G64A 1EF8A 4IZDA 2J5GD 4K3WA 4I42A 5INIA 3HE2A 2ZQQA 5FIFA 5C90A 4L6WA 4ZU2A 5E0SH 3TT7A 3TV5A 3R0OA 4ZDEA 4MXIA 1XX4A 5JBWA 1Y7OA 2ZL4A 2CBYA 4JYLA 1XNWA 3ZW8A 3QXZA 1NZYB 5HUQA 5DU6A 3BPPA 3P85A 2WTBA 3ST9A 3SWXA 5G1QA 3R9TA 3ISAA 5E0NX 1N6DA 2VSUE 3NJBA 5E0SA 2VSSF 1WDKA 4OMRA 4FB8A 4NEKA 5G1SA 1N6EA 5DKPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MOY A;  2VSU A;  4F47 A;  5DUC A;  1HNU A;  3HIN A;  4EMM A;  3LAO A;  1Q51 A;  1HNO A;  2EJ5 A;  4ASI A;  1K39 A;  2F9Y B;  1Q52 A;  1FC6 A;  4B3I A;  5DTW A;  3Q0G A;  1J7X A;  3GMA A;  4JWV A;  1XNY A;  4K29 A;  1TYF A;  3H81 A;  4FND A;  3P2L A;  3KQF A;  3TZ3 A;  3MFM A;  4ELW A;  5DU4 A;  5INF A;  4MOU A;  3K50 A;  3TVW A;  2X24 A;  4FZW A;  4JCR A;  3HRX A;  4MI2 A;  1JXZ A;  3PE8 A;  3GF3 A;  1W2X A;  1MJ3 A;  4I52 A;  3KTI A;  2FW2 A;  3TT6 A;  2UZF A;  3IB9 A;  3Q0J A;  2PG8 A;  1FC9 A;  2BZR A;  2J5I A;  3H02 A;  1YG8 A;  4FN8 A;  4EMP A;  3KTG A;  3U9R B;  2ZQR A;  1VRG A;  3NJD A;  3ZWB A;  4G2R A;  1ON3 A;  4GHN A;  1O8U A;  3OME A;  4WYO B;  4U18 A;  5IKL B;  4QII A;  5DZK H;  1RJN A;  2DEO A;  3LKE A;  5DTP A;  1EF9 A;  4L8K A;  4JOT A;  3M6N A;  4NNQ A;  3RRV A;  1PIX A;  3R9Q A;  5ING A;  1UYV A;  3RSI A;  1FC7 A;  1UYT A;  3STA A;  3ZW9 A;  3ZWC A;  2VRE A;  2D3T A;  1UYS A;  1NZY A;  2Q2X A;  3MYB A;  2QQ3 A;  5DUF A;  4ZDF A;  2VX2 A;  3PGQ A;  3GLM A;  2F6Q A;  4KWB A;  5G1R A;  4HNK A;  2A81 A;  3R9S A;  3IBB A;  4EML A;  4ZDC A;  4U0G H;  4FNB A;  5JBX A;  3Q1T A;  4RYF H;  2ZL3 A;  1PJH A;  4HC8 A;  3KTK A;  1XNV A;  2FBM A;  1RJM A;  5MGB A;  2J5I I;  2VSU F;  2VSU C;  4Q1I A;  3K8X A;  3T88 A;  3QKA A;  3R6H A;  2PPY A;  2J5G A;  3OC7 A;  4KNP A;  3RST A;  5FUS A;  3QYR A;  5KJP A;  3T89 A;  4QFE A;  2W3P A;  3QRE A;  3BEZ A;  3T8B A;  3U9S B;  2VSS A;  2NP9 A;  1OD2 A;  2F6I A;  3DOR A;  4OG1 A;  4FN7 A;  1DCI A;  2Q34 A;  3KTJ A;  2A7K A;  5CTC A;  4JSB A;  3T8A A;  3FDU A;  4ZDB A;  1DUB A;  2VSS E;  4KD6 A;  2ZL2 A;  4GM2 A;  3V5E A;  3QXI A;  3TVU A;  3U9T B;  4JYJ A;  3L3S A;  4QIJ A;  1OD4 A;  5KDR A;  3DJA A;  3GF7 A;  3HLN 1;  4RYF A;  2FZS A;  4U0G A;  4YLH A;  1TG6 A;  3KTH A;  1ON9 A;  3GKB A;  5KDR B;  3H0J A;  3I47 A;  3M6M A;  4JVT A;  4ELX A;  1FCF A;  4OLQ A;  4JCS A;  4JJT A;  3QK8 A;  4JCQ A;  2C8T A;  1YG6 A;  3ZWA A;  3H0S A;  4IZB A;  3VIV A;  4RCN A;  5CTB A;  1X0U A;  3PEA A;  4K2N A;  2F9I A;  2J5I B;  3SLL A;  4U1A A;  3BF0 A;  1EY3 A;  5DL1 A;  4IZC A;  3OT6 A;  4FJW D;  2HW5 A;  2F9Y A;  2F9I B;  3PZK A;  3H0U A;  2GTR A;  1N6F A;  4ZDD A;  2DUB A;  1UIY A;  3H0Q A;  2PBP A;  4Z0M A;  3Q7H A;  1XO6 A;  5DZK A;  4B3H A;  2IEX A;  3QMJ A;  1WZ8 A;  3P5M A;  5DU8 A;  3QWD A;  4DI1 A;  4B3J A;  1SG4 A;  4WZ8 B;  4WCZ A;  2X58 A;  4FZW C;  3TRR A;  3V5I A;  3WG5 A;  3IAV A;  4JFC A;  4U0H A;  3TDC A;  1UYR A;  1K32 A;  2ZL0 A;  1WDL A;  3MT6 A;  4JCT A;  3FF6 A;  3T3W A;  2A7S A;  3JU1 A;  3HP0 A;  3TLF A;  3N6R B;  4KPK A;  5C9G A;  2CE3 A;  1HZD A;  2Q35 A;  4ELS A;  1WDM A;  4LK5 A;  4U19 A;  1SZO A;  4Q0G A;  2J5S A;  4I4Z A;  3G64 A;  1EF8 A;  4IZD A;  2J5G D;  4K3W A;  4I42 A;  5INI A;  3HE2 A;  2ZQQ A;  5FIF A;  5C90 A;  4L6W A;  4ZU2 A;  5E0S H;  3TT7 A;  3TV5 A;  3R0O A;  4ZDE A;  4MXI A;  1XX4 A;  5JBW A;  1Y7O A;  2ZL4 A;  2CBY A;  4JYL A;  1XNW A;  3ZW8 A;  3QXZ A;  1NZY B;  5DU6 A;  3BPP A;  3P85 A;  2WTB A;  3ST9 A;  3SWX A;  5G1Q A;  3R9T A;  3ISA A;  5E0N X;  1N6D A;  2VSU E;  3NJB A;  5E0S A;  2VSS F;  1WDK A;  4OMR A;  4FB8 A;  4NEK A;  5G1S A;  1N6E A;  5DKP A; 
#chains in the Genus database with same CATH topology
 3MOY A;  2VSU A;  4F47 A;  5DUC A;  1HNU A;  3HIN A;  4EMM A;  3LAO A;  1Q51 A;  1HNO A;  2EJ5 A;  4ASI A;  1K39 A;  2F9Y B;  1Q52 A;  1FC6 A;  4B3I A;  5DTW A;  3Q0G A;  1J7X A;  3GMA A;  4JWV A;  1XNY A;  4K29 A;  1TYF A;  3H81 A;  4FND A;  4HDT A;  3P2L A;  3KQF A;  3TZ3 A;  3MFM A;  4ELW A;  5DU4 A;  5INF A;  4J2U A;  4MOU A;  3K50 A;  3TVW A;  2X24 A;  4FZW A;  4JCR A;  3HRX A;  4MI2 A;  1JXZ A;  3PE8 A;  3GF3 A;  1W2X A;  1MJ3 A;  4I52 A;  3KTI A;  2FW2 A;  3TT6 A;  2UZF A;  3IB9 A;  3Q0J A;  2PG8 A;  1FC9 A;  2BZR A;  2J5I A;  3H02 A;  1YG8 A;  4FN8 A;  4EMP A;  3KTG A;  3U9R B;  2ZQR A;  1VRG A;  3NJD A;  3ZWB A;  4G2R A;  1ON3 A;  4GHN A;  1O8U A;  3OME A;  4WYO B;  4U18 A;  5IKL B;  4QII A;  5DZK H;  1RJN A;  2DEO A;  3LKE A;  5DTP A;  1EF9 A;  4L8K A;  4JOT A;  3M6N A;  4NNQ A;  3RRV A;  1PIX A;  3R9Q A;  4NAR A;  5ING A;  1UYV A;  3RSI A;  1FC7 A;  1UYT A;  3STA A;  3ZW9 A;  3ZWC A;  2VRE A;  2D3T A;  1UYS A;  1NZY A;  2Q2X A;  3MYB A;  2QQ3 A;  5DUF A;  4ZDF A;  2VX2 A;  3PGQ A;  3GLM A;  2F6Q A;  2YJG A;  4KWB A;  5G1R A;  4HNK A;  2A81 A;  3R9S A;  3IBB A;  4EML A;  4ZDC A;  4U0G H;  4FNB A;  5JBX A;  3Q1T A;  4RYF H;  2ZL3 A;  1PJH A;  4HC8 A;  3KTK A;  1XNV A;  2FBM A;  1RJM A;  5MGB A;  2J5I I;  2VSU F;  2VSU C;  4Q1I A;  3K8X A;  3T88 A;  3QKA A;  3R6H A;  2PPY A;  2J5G A;  3OC7 A;  4KNP A;  3RST A;  5FUS A;  3QYR A;  5KJP A;  3T89 A;  4QFE A;  2W3P A;  3QRE A;  3BEZ A;  3T8B A;  3U9S B;  2VSS A;  2NP9 A;  1OD2 A;  2F6I A;  3DOR A;  4OG1 A;  4FN7 A;  1DCI A;  2Q34 A;  3KTJ A;  2A7K A;  5CTC A;  4JSB A;  3T8A A;  3FDU A;  4ZDB A;  1DUB A;  2VSS E;  4KD6 A;  2ZL2 A;  4GM2 A;  3V5E A;  3QXI A;  3TVU A;  3U9T B;  4JYJ A;  3L3S A;  4QIJ A;  1OD4 A;  5KDR A;  3DJA A;  3GF7 A;  3HLN 1;  4RYF A;  2FZS A;  4U0G A;  4YLH A;  1TG6 A;  3KTH A;  1ON9 A;  3GKB A;  5KDR B;  3H0J A;  3I47 A;  3M6M A;  4JVT A;  4ELX A;  1FCF A;  4OLQ A;  4JCS A;  4JJT A;  3QK8 A;  4JCQ A;  2C8T A;  1YG6 A;  3ZWA A;  3H0S A;  4IZB A;  3VIV A;  4RCN A;  5CTB A;  1X0U A;  3PEA A;  4K2N A;  2F9I A;  2J5I B;  3SLL A;  4U1A A;  3BF0 A;  1EY3 A;  5DL1 A;  4IZC A;  3OT6 A;  4FJW D;  2HW5 A;  2F9Y A;  2F9I B;  3PZK A;  3H0U A;  2GTR A;  1N6F A;  4ZDD A;  2DUB A;  1UIY A;  3H0Q A;  2PBP A;  4Z0M A;  3Q7H A;  1XO6 A;  5DZK A;  4B3H A;  2IEX A;  3QMJ A;  1WZ8 A;  3P5M A;  5DU8 A;  3QWD A;  4DI1 A;  4B3J A;  1SG4 A;  4WZ8 B;  4WCZ A;  2X58 A;  4FZW C;  3TRR A;  3V5I A;  3WG5 A;  3IAV A;  4JFC A;  4U0H A;  3TDC A;  1UYR A;  1K32 A;  2ZL0 A;  1WDL A;  3MT6 A;  4JCT A;  3FF6 A;  3T3W A;  2A7S A;  3JU1 A;  3HP0 A;  3TLF A;  3N6R B;  4KPK A;  5C9G A;  2CE3 A;  1HZD A;  2Q35 A;  3BPT A;  4ELS A;  1WDM A;  4LK5 A;  4U19 A;  1SZO A;  4Q0G A;  2J5S A;  4I4Z A;  3G64 A;  1EF8 A;  4IZD A;  2J5G D;  4K3W A;  4I42 A;  5INI A;  3HE2 A;  2ZQQ A;  5FIF A;  5C90 A;  4L6W A;  4ZU2 A;  5E0S H;  3TT7 A;  3TV5 A;  3R0O A;  4ZDE A;  4MXI A;  1XX4 A;  5JBW A;  1Y7O A;  2ZL4 A;  2CBY A;  4JYL A;  1XNW A;  3ZW8 A;  3QXZ A;  1NZY B;  5HUQ A;  5DU6 A;  3BPP A;  3P85 A;  2WTB A;  3ST9 A;  3SWX A;  5G1Q A;  3R9T A;  3ISA A;  5E0N X;  1N6D A;  2VSU E;  3NJB A;  5E0S A;  2VSS F;  1WDK A;  4OMR A;  4FB8 A;  4NEK A;  5G1S A;  1N6E A;  5DKP A; 
#chains in the Genus database with same CATH homology
 3MOY A;  2VSU A;  4F47 A;  5DUC A;  1HNU A;  3HIN A;  4EMM A;  3LAO A;  1Q51 A;  1HNO A;  2EJ5 A;  4ASI A;  1K39 A;  2F9Y B;  1Q52 A;  1FC6 A;  4B3I A;  5DTW A;  3Q0G A;  1J7X A;  3GMA A;  4JWV A;  1XNY A;  4K29 A;  1TYF A;  3H81 A;  4FND A;  4HDT A;  3P2L A;  3KQF A;  3TZ3 A;  3MFM A;  4ELW A;  5DU4 A;  5INF A;  4J2U A;  4MOU A;  3K50 A;  3TVW A;  2X24 A;  4FZW A;  4JCR A;  3HRX A;  4MI2 A;  1JXZ A;  3PE8 A;  3GF3 A;  1W2X A;  1MJ3 A;  4I52 A;  3KTI A;  2FW2 A;  3TT6 A;  2UZF A;  3IB9 A;  3Q0J A;  2PG8 A;  1FC9 A;  2BZR A;  2J5I A;  3H02 A;  1YG8 A;  4FN8 A;  4EMP A;  3KTG A;  3U9R B;  2ZQR A;  1VRG A;  3NJD A;  3ZWB A;  4G2R A;  1ON3 A;  4GHN A;  1O8U A;  3OME A;  4WYO B;  4U18 A;  5IKL B;  4QII A;  5DZK H;  1RJN A;  2DEO A;  3LKE A;  5DTP A;  1EF9 A;  4L8K A;  4JOT A;  3M6N A;  4NNQ A;  3RRV A;  1PIX A;  3R9Q A;  4NAR A;  5ING A;  1UYV A;  3RSI A;  1FC7 A;  1UYT A;  3STA A;  3ZW9 A;  3ZWC A;  2VRE A;  2D3T A;  1UYS A;  1NZY A;  2Q2X A;  3MYB A;  2QQ3 A;  5DUF A;  4ZDF A;  2VX2 A;  3PGQ A;  3GLM A;  2F6Q A;  2YJG A;  4KWB A;  5G1R A;  4HNK A;  2A81 A;  3R9S A;  3IBB A;  4EML A;  4ZDC A;  4U0G H;  4FNB A;  5JBX A;  3Q1T A;  4RYF H;  2ZL3 A;  1PJH A;  4HC8 A;  3KTK A;  1XNV A;  2FBM A;  1RJM A;  5MGB A;  2J5I I;  2VSU F;  2VSU C;  4Q1I A;  3K8X A;  3T88 A;  3QKA A;  3R6H A;  2PPY A;  2J5G A;  3OC7 A;  4KNP A;  3RST A;  5FUS A;  3QYR A;  5KJP A;  3T89 A;  4QFE A;  2W3P A;  3QRE A;  3BEZ A;  3T8B A;  3U9S B;  2VSS A;  2NP9 A;  1OD2 A;  2F6I A;  3DOR A;  4OG1 A;  4FN7 A;  1DCI A;  2Q34 A;  3KTJ A;  2A7K A;  5CTC A;  4JSB A;  3T8A A;  3FDU A;  4ZDB A;  1DUB A;  2VSS E;  4KD6 A;  2ZL2 A;  4GM2 A;  3V5E A;  3QXI A;  3TVU A;  3U9T B;  4JYJ A;  3L3S A;  4QIJ A;  1OD4 A;  5KDR A;  3DJA A;  3GF7 A;  3HLN 1;  4RYF A;  2FZS A;  4U0G A;  4YLH A;  1TG6 A;  3KTH A;  1ON9 A;  3GKB A;  5KDR B;  3H0J A;  3I47 A;  3M6M A;  4JVT A;  4ELX A;  1FCF A;  4OLQ A;  4JCS A;  4JJT A;  3QK8 A;  4JCQ A;  2C8T A;  1YG6 A;  3ZWA A;  3H0S A;  4IZB A;  3VIV A;  4RCN A;  5CTB A;  1X0U A;  3PEA A;  4K2N A;  2F9I A;  2J5I B;  3SLL A;  4U1A A;  3BF0 A;  1EY3 A;  5DL1 A;  4IZC A;  3OT6 A;  4FJW D;  2HW5 A;  2F9Y A;  2F9I B;  3PZK A;  3H0U A;  2GTR A;  1N6F A;  4ZDD A;  2DUB A;  1UIY A;  3H0Q A;  2PBP A;  4Z0M A;  3Q7H A;  1XO6 A;  5DZK A;  4B3H A;  2IEX A;  3QMJ A;  1WZ8 A;  3P5M A;  5DU8 A;  3QWD A;  4DI1 A;  4B3J A;  1SG4 A;  4WZ8 B;  4WCZ A;  2X58 A;  4FZW C;  3TRR A;  3V5I A;  3WG5 A;  3IAV A;  4JFC A;  4U0H A;  3TDC A;  1UYR A;  1K32 A;  2ZL0 A;  1WDL A;  3MT6 A;  4JCT A;  3FF6 A;  3T3W A;  2A7S A;  3JU1 A;  3HP0 A;  3TLF A;  3N6R B;  4KPK A;  5C9G A;  2CE3 A;  1HZD A;  2Q35 A;  3BPT A;  4ELS A;  1WDM A;  4LK5 A;  4U19 A;  1SZO A;  4Q0G A;  2J5S A;  4I4Z A;  3G64 A;  1EF8 A;  4IZD A;  2J5G D;  4K3W A;  4I42 A;  5INI A;  3HE2 A;  2ZQQ A;  5FIF A;  5C90 A;  4L6W A;  4ZU2 A;  5E0S H;  3TT7 A;  3TV5 A;  3R0O A;  4ZDE A;  4MXI A;  1XX4 A;  5JBW A;  1Y7O A;  2ZL4 A;  2CBY A;  4JYL A;  1XNW A;  3ZW8 A;  3QXZ A;  1NZY B;  5HUQ A;  5DU6 A;  3BPP A;  3P85 A;  2WTB A;  3ST9 A;  3SWX A;  5G1Q A;  3R9T A;  3ISA A;  5E0N X;  1N6D A;  2VSU E;  3NJB A;  5E0S A;  2VSS F;  1WDK A;  4OMR A;  4FB8 A;  4NEK A;  5G1S A;  1N6E A;  5DKP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...