1Y7PA

1.9 a crystal structure of a protein of unknown function af1403 from archaeoglobus fulgidus, probable metabolic regulator
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
216
structure length
212
Chain Sequence
LRGLRIIAENKIGVLRDLTTIIANITFAQTFLIKHGEHEGKALIYFEIEGGDFEKILERVKTFDYIIEIEEEESFERVFGKRVIILGGGALVSQVAIGAISEADRHNLRGERISVDTMPVVGEEEIAEAVKAVSRLHRAEVLVLAGGIMGGKITEEVKKLRKSGIRVISLSMFGSVPDVADVVISDPVMAGTLAVMHISEKAKFDLDRVKGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1.9A crystal structure of a hypothetical protein AF1403 from Archaeoglobus fulgidus
rcsb
source organism Archaeoglobus fulgidus
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein AF1403
total genus 62
structure length 212
sequence length 216
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01842 ACT ACT domain
A PF18462 DUF5612 Domain of unknown function (DUF5612)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1y7pA01
3.40.50.10550 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Hypothetical protein af1403; domain 2 1y7pA02
3IXQA 1PSDA 2QSWA 1LKZA 1UJ5A 4X84A 2JOQA 1ZPVA 1RWUA 3S1TA 3OFEA 3OBIA 3L7OA 3OFHA 3DC2A 4GO5X 2QMXA 5FIIA 1UJ4A 3AB2B 3U7JA 2LQJA 2RE1A 3TUZC 3OFFA 3OFGA 2CDQA 4IO1A 1LK5A 4GO7X 4M8LA 2NYIA 3DHWC 4PWUA 1XTZA 2J0WA 3MTJA 5IT4A 1SC6A 2P9EA 2RQMA 2RQKA 3ENVA 3O1LA 1LK7A 3P96A 3AB4B 1KS2A 5JJBA 1U8SA 3DDNA 3MAHA 2MDAA 2DTJA 4LUBA 2PC6A 3W7BA 5T41A 1YGYA 2ZHOA 2F8MA 3AAWB 3N0VA 2DT9A 5IS2A 1YBAA 5IT0A 2QMWA 2I9SA 3HHEA 3K5PA 2LVWA 2PA3A 2J0XA 1UJ6A 1M0SA 2KO1A 3ENQA 4GMKA 3NRBA 1O8BA 2P9GA 2FGCA 3IBWA 3LUYA 3ENWA 3KWMA 3LOUA 2P9CA 3DHXA 3TUIC 3TUJC 2H9ZA 4NMLA 3MWBA 2JHEA 1Y7PA 3UW1A 3CEDA 2QRRA 2F1FA
chains in the Genus database with same CATH superfamily
3H13A 4GLFA 2A9JA 1ID8A 3FQKA 2DBZA 4H7KA 1NYTA 4DUZF 4DU8A 1SBNE 5KAKA 4LBPA 1QH1A 3LOPA 1DAFA 5C5EA 3CLTD 4D9JA 4LV6A 3RJZA 4MA4A 3HKCA 5A06A 2FWNA 4IHQA 3AXSA 3KALA 2CQHA 1FB5A 2Y05A 4C7MA 4YS2A 2K4MA 1KZ9A 2EFQA 2NT3A 4KRYA 3ZY2A 1VYHA 3HM9A 1GXLA 3RS4A 1G21A 1KR4A 4BNDB 2E55A 5GQSA 2ZIXA 3OIFA 3JZDA 1JN0A 3H17A 3Q3VA 3ZVRA 4QX6A 2OGWA 4DR4J 3VKVA 3L0DA 1T03A 2NNWB 4F5DA 3V8RA 1T3NA 1YKGA 5E8JA 2OY0A 5D1NA 5B53A 2F43B 5JJKA 4HWPA 2PX3A 3M8PB 2R7XA 1RADB 4EQ6A 3EZYA 3G8DA 2ZJ5A 2QUJA 3WX0A 1PNRA 2HF7A 1UXOA 2HF2A 5AOBA 4GOND 4EK9A 4A03A 1Z2PX 5BR7A 1NF2A 3E9EA 1VP9A 3VZQA 5HKKA 3KOMA 5ISMA 1V8OA 4X6UA 4D0LB 2D9PA 1A97A 1YI0A 4QIVA 2OZKA 3PPYA 3WBJA 2GJ2A 2O8BA 5GIPE 3OIGA 3OQBA 3W9JA 3OPMA 1XRRA 3H4MA 4IOMA 3GW8A 5I8ZA 4AMUA 2YYAA 4O5OA 3SSOA 2MU1A 2ZFHA 3C39A 1JPNA 1MNQA 5K7SA 1QOZA 3EIHA 1PGZA 2XCOA 1DEXA 3F2IA 1TIKA 3ORRA 4HUJA 1N2GA 5AK3A 5F77A 1TC2A 2JFDA 4YO7A 2DKFA 1XRJA 3BJMA 5AUNB 1CVRA 4CO3A 2BMEA 3Q87B 2UXBF 3QVOA 3Q3HA 2NPOA 3R20A 5TS2A 4YMLA 1O77A 1C0UA 4D41A 1I14A 3SCLE 5AJUA 5GVSA 3CE8A 2LKDA 2NVWA 4KFBB 1TO6A 4AULA 1EVLA 3U02A 5CH7B 1Q50A 2HHWA 3HEAA 1U2PA 4RHEA 2FWPA 3K20A 1ESZA 4LXYA 2NG1A 1FF2A 4M9UA 4YT5A 2CD9A 1RT7A 2INGX 5CGZA 1PIEA 5AJXA 3QQPA 4BL5A 4FE4A 5KG1A 4GKJF 2X5KO 1DXHA 2FRVA 3CX7A 2UYCA 4YMIA 1TEZA 3ROPA 3N2KB 5I4KA 2V97A 4DLRA 1P1LA 3GDWA 1HY3A 3NVAA 4AZVA 4URYR 3AA8A 2EG2A 1Y4ZA 5K0TA 3KELA 3D1LA 3IQFA 4HTFB 4Q48A 2NXCA 4YVFA 3UPUA 4YMVA 3SYZA 4FOTA 4U02A 2XE6A 1LNQA 1ZUHA 1QIDA 2ZPAA 3K8WA 1K06A 3LP8A 2R6JA 4B3CA 4RTRA 3AP1A 4WJLA 1UJCA 4POOA 4USKA 3TQQA 4LFAB 4ANCA 1PS0A 4BGEA 1ST3A 1DBVO 3MM5A 3OFJA 2QJFA 1FDDA 4C08A 2JGRA 1PC4A 1L5LA 3E3OA 5DNUA 3H8YA 3M4ZA 1TL7C 1LNSA 4OQYA 1T8WA 2ETXA 4JT2A 3QPBA 1RBAA 1Y5IB 4I4CA 3D31A 1W96A 4OY3A 1GCGA 3GLTA 1VHQA 5C5JA 1XU9A 4L9AA 1KQOA 1NE7A 1MOZA 1X9IA 1WDTA 4CM3A 2WQ6A 5HIKA 4C4AA 5IT4A 2W9CB 4B3IA 3IQDB 5D1HA 2ZR9A 3G8TA 5GP1A 4HTJA 4X66B 1LI5A 1DKNA 1MAHA 3PWSA 3H7HB 1JFTA 2R42A 3G2OA 1IAVA 4PWDB 1FWKA 2P4UA 4UEQA 1LBEA 1MFZA 4BIMA 4RTPA 3E6AA 3COJA 4L4ZA 2OLJA 3DNMA 2BGIA 4X1IB 3AW9A 1XOIA 4IJUA 3EIFA 1H3FA 3DMYA 2JFOA 1Z7YA 3TP2A 4ZVTA 1SV5B 1N7HA 4O4LA 1DL5A 3SDEB 2X7XA 5C37A 1XR6A 4I69A 1CR6A 5AKYA 5J5CA 1LBTA 4IVQA 3RIEA 4WDRA 3OC0A 1X31C 1SHTX 3AVWA 1GIAA 3PQ3A 3WIDA 3MPYA 5JDCA 1WABA 4Z9XA 3OCZA 4UU1A 3HDQA 4MKYA 3OUUA 4PQYA 4QUKA 1W7WA 3PZRA 2OCDA 4YC7A 1FVOA 1ZPDA 4WBNA 4IICA 3S5UA 4XIYA 2G9ZA 1KTQA 2Y66A 1IAQA 4JJKA 1JB0C 1JQAA 5CYOA 2YXPX 3K8ZA 4D0GA 4D9GA 2NYIA 2RCYA 5LSOA 5BVHB 1ZAWA 1G5RA 1L5RA 3FI0A 4POAA 4ZYLA 4FFRA 2XDWA 1QB7A 4ESEA 3RC9A 4UTXA 2PA0A 3SQMA 3TVYA 1NR5A 3IMKA 2K1RA 2F2TA 3DAYA 4LWOA 1FBTA 1JBEA 4P7VA 4IFBA 2AZMA 1YRHA 2AYZA 1UBTS 2B1IA 1OAOC 1C1HA 4ZZ2A 3R7SA 3GF4A 5EHNA 2XUZA 4AYBD 2AMJA 1QANA 1MMDA 2BHNA 1M2KA 1DLJA 2CMDA 1M34B 4NPAA 3ZZ1A 4IQ8A 2E21A 4CLZA 1ZC4A 1YX2A 4JD5A 4UPVA 5ETVA 2IMWP 3KQKA 1KQGA 1GMUA 1QJHA 1CJMA 1DKOA 1R8XA 4CUJA 1MW9X 3UUGA 1RM4A 1ZAKA 3AR3A 3P9RA 4UTOA 1Q5PA 3R6WA 4KJXA 1NMSA 4OA5A 4KSBA 2AC4A 2ZAGA 2HLUA 5DI9A 1AQ6A 1NK0A 1CE8B 2IA0A 4AKTA 4LFBB 3TGWA 5DDPC 3AESA 1YVDA 3BXXA 4H6WA 5J59A 3T7IA 4GOMD 2GVZC 5DCUA 3JWEA 5CTAA 3I32A 4ME6A 1I2BA 3N86A 3HVTA 1N5OX 2WB1D 2FPHX 5BSUA 3EPJA 3DOKB 1GTL1 5TDHA 1L7EA 1EBBA 3GMSA 1KFDA 4FXDA 4J0DA 1FVXA 4KQKA 1YZFA 4E6PA 1DBSA 2DIUA 4KV8B 1M1HA 2P4SA 2IUEA 4Y2QA 1Q2UA 8AT1B 4UAUA 3PKYA 3L09A 3DGPA 2OXTA 1EINA 5CDSA 4YCSA 2X9LA 3DAOA 2CXUA 4IJQA 1OXMA 1SU8A 5EMJA 4R1UA 1FA9A 3H6GA 2ZS8A 3L0IB 4Q9DA 3PXUA 2KTQA 1XE3A 1NXPA 1Y10A 2DR6A 1ZRNA 5A6SB 2DGVA 3DUFB 1I1OA 4WXYB 4CLXA 2IW1A 4LSNA 2BKXA 3UD4P 1KDVA 1D4FA 3N5FA 3O44A 1NXXA 1C0PA 1VOMA 1D8YA 4WE3A 1T8EA 3NTQA 4EZIA 3E35A 1XA3A 3ETGA 2OVBA 1QV6A 2EKPA 2O0LA 2WW8A 2P9QA 4KGZA 1FRXA 2ZS7A 4JI1F 4LXUA 2H1YA 4TTRA 4J3NA 3TA1A 1GPDG 5EL0A 4MQFA 2A92A 5C5DA 2YIJA 3F78A 4HL6A 2XMVA 2IPOA 1DX9A 1JHOA 4O02B 3OPNA 4F84A 1D2AA 3AOEA 3EWSA 3IIMA 4LMZA 1N3IA 5IABA 2AW0A 1NOJA 5E3JA 2HW8A 3PKMA 5WRFA 3KFWX 5IYZF 3ZGLA 5AJ3F 1ICEB 4W99A 1EARA 2DKOB 4PGMA 3O73A 1OPIA 1XCPA 2DSNA 4ND4A 1DEAA 4I8DA 3K96A 4ZCLA 3NS6A 4DSLA 4HS9A 1PL8A 3IUBA 4HWSA 1WCYA 3DOIA 3WFJA 2C5BA 3RBEA 4HVAA 5MN6A 4PEOA 4JSTA 4GVBA 3C8UA 5A1TA 3ZVNA 3UJAA 2ZUSA 5JZ9A 4DPWA 4ICLB 1J33A 3QPVA 2BFBB 3SIPA 5HGJA 1E64A 1FNMA 2WSYB 4WLOA 5LJ5Y 3UPTA 1YTYA 4URUR 1ZAXA 1USUA 3PA8A 3T7TA 1UPAA 3SM3A 3NIFB 3QW2A 5ALOA 2XE7A 4H3SA 3AKCA 2JEZA 2C22A 5D01A 2V4MA 1UETA 2D2FA 1XALA 4OZ5A 2WUGA 3ANSA 3V55A 1RAEA 2CK3A 5C1IA 2AGQA 4PBSA 2ZH9A 1M76A 1IOWA 3JVUA 3T5AA 3OZEA 1FSZA 4BU0A 4MR7B 3GJ7A 1FFBA 1JDZA 2BFCA 3T34A 3VU1A 3A9UA 4D99A 3DLKA 5J4HA 2QB5A 4GKKB 2EXUA 4C0SA 4GKBA 2KT5A 5AKIA 3MTGA 1FX0A 4DCCA 2YHSA 4IH6A 2W2OP 2JD2A 3JQ6A 4IGFA 4WK0B 3P2YA 3G85A 4IXMA 7ADHA 3EVDA 3SXLA 3DXFA 5DLPA 2AC2A 4E5YA 3I3OA 1JJ7A 1A5ZA 2H31A 2NZCA 3W78A 3ONEA 2VBFA 3NAMA 3OETA 4RGVA 4N18A 1ZCZA 1JKJB 3RYHA 1GRRA 3E8SA 3L0YA 3NASA 3ZBPA 5I4CA 3MMBB 3D7SB 3NIGB 4XGQA 1SIOA 1LRLA 1M1YA 1VSBA 3T0GA 2VBYA 1WKBA 2BGRA 3KOZA 3QKRA 4IFYA 4KDRA 1ZDMA 2VK1A 3ORFA 3CEPB 3V80A 4IR9A 1JH8A 3LT0A 1R5NA 1FDSA 5HS6A 1XG5A 4KMOA 1S1UA 2C7QA 1RYEA 4KFTA 5HKLA 4QU5A 2PIAA 3IR6A 4NCIA 3QY0A 3QXHA 2ZZTA 4EKEA 1NL3A 1VB3A 3M8PA 1KU6A 5L1KA 4PZDA 3DSRA 3U1BA 2WAYA 3FMBA 1WW2A 1W76A 1Y1LA 4EYOA 2BE2B 1FYFA 1Q7LB 3RAFC 1M75A 1OB2A 2W4DA 2VYND 2VYVA 1A4RA 5JIBA 1MAUA 3FTDA 1S99A 1KBOA 2G67A 4I7FA 5C1BA 1HMVA 2H48A 2X2FA 3P2IA 1RYBA 1II8B 2IC5A 2WHYA 4DL2A 2O3RA 5E9AA 3Q6NA 3MT7A 3PA6A 4UHKA 3WQQA 3PL1A 4G07A 2D7CA 4OX9F 1CS0A 1J1UA 4PSCA 1YVPA 5I7OA 2XZTB 1MEOA 1RAFB 1JHPA 1EWQA 3RWBA 1WACA 1KSGA 2BM9A 3LQKA 4HAYA 2CLSA 3FPGA 1S9GA 1Q1GA 4UTZA 5DM1A 4JP3A 3HKZD 2R8ZA 3E1GA 1USWA 3MR7A 1CF4A 2IYWA 2VT7A 4BUJA 1OXSC 1I2AA 2Z1MA 1QE0A 2WZBA 4OKNA 3FPLA 4JJ7A 5EKDA 4YV7A 1XQ9A 4X9XA 2XWXA 4I7FB 4LF9J 4I2QB 4NYMR 3ZE6A 5K03A 5A03A 2OZVA 4DX8H 3AK4A 4D3HA 3KLEB 3PE4A 4DL7A 4HTIA 2A5DA 1EIYB 4IOKA 1T9TA 2ZVSA 5BSWA 3THPA 3ENWA 2ZXFA 3NDJA 1HUQA 2C4WA 3OFSA 2I99A 3IKTA 4K40A 2AOUB 2DFKB 4M6WB 2XI2A 2DTEA 4R1TA 2XY7A 5DRYA 3RNLA 1A8SA 3DR5A 3RUHA 1B26A 4IYJA 3ICQB 3OFKA 1PT9A 1JA1A 4ELUA 4PONA 4MPPA 5E38A 4MVJP 4BX3A 5AW7A 5EIEA 3H2KA 1T94A 4JJFA 2WWFA 1Y1KE 5CT6A 3Q9LA 1GN9A 5AHKA 2C84A 1YJCA 1Q82T 1RJ9B 3PQFA 1NULA 1XO1A 1HKHA 3QE9Y 3G5UA 3TLGA 2WSSA 1I6JA 1VKHA 1U65A 2UVPB 4G5QA 4KL8S 2QT9A 3EFHA 2AOTA 4OHXA 1WC3A 3WBZA 4X71A 4KPYA 5LBTA 3T15A 3S2IA 2W2MA 4HH1A 2IEYA 2IH4A 3KSDO 1Q5VA 4KXMA 3TB4A 3LU1A 1NN5A 1LDMA 2GFHA 2Q1LA 1TVKA 3DKVA 5AOAA 4DCPA 4Y3CA 5K09A 1M5UA 3KSUA 3RU0A 4QGBA 1R0LA 2IBOA 5EJ4A 5LA6F 1SOWA 1UXGA 2WAQD 3KBOA 5DH9A 2HTEA 1TP7A 1Z7BA 2HNZB 4AUEA 2FUG9 3DEYX 3UKOA 4OLOA 5JMTA 1S2MA 3TR6A 5K8JB 1R27B 2OFGX 5CG1A 2N4DA 1LFWA 3JYHA 2WVJA 3SBXA 3I5YA 2ZAIA 5C4IA 1ZU5A 1WS6A 4HN2A 2QYOA 3WRXC 4GWLA 3HKWA 3O1JC 4WP9A 5KFGA 1DWPA 2CJWB 1W2HA 4C97A 3UCUP 3OCWA 2A5JA 2IC3A 2WF7A 4WFYA 4LF2A 1JI0A 3E81A 1JXAA 1NUHA 2X8JA 5FRDA 3C16C 1ZGJA 2ERYA 5JPIA 3A1VA 1OBVA 2G82A 4OOFA 2VOJA 3LAMA 1VFNA 3K5PA 1F5CA 1JQ3A 2UVPA 1FK9B 1XL1A 2SKCA 3W9SA 2P9GA 2J3JA 3P94A 1PO7A 2C3UA 3LUHA 1WCWA 3MHYA 1U1LA 5AW4A 5CEFA 4XWAA 3ZXSA 5FAKA 4DV4J 3VYUB 3HJFA 2QG6A 2ZH4A 5COBA 4DV6F 1NKVA 4A92A 1TL3B 5LM3A 1FA0A 4XIGS 5BWLA 4E0BA 2QE5A 2VYCA 3QO9B 4IVRA 1Q1ZA 3OFEA 3ZUPA 1ZINA 1M10A 3U80A 2ZWVA 1IY2A 1GPMA 1XK6A 4KUHA 1ONBA 5GTDA 2JGFA 3P8BB 3EC1A 3GEIA 1UZMA 3QXXA 3EF1A 3E2EA 4G0QA 3EQ2A 1DQPA 1UBHS 2N42A 1YGPA 3S81A 2ZWAA 1EBFA 2FH5B 1PFQA 1L2TA 1JLAA 4E12A 5B7QA 1P1HA 1Q19A 4P54A 5FBZA 3QOXA 4LZZA 3IEKA 3GV8B 1NNSA 2B4RO 4E33A 4HDGA 1I24A 1SV5A 1I10A 4HAUA 3MXHP 5CP8A 3IP3A 1P18A 3W3AD 5C46F 3O4JA 4O8CA 4QYMA 4A8PA 3ZEAA 1FCJA 2Z4TA 3FKSD 4U7UD 2WK4A 2IXGA 1PL0A 3ASUA 1ZESA 2Q1XA 1IQ0A 4YJHB 4EX6A 4N3NA 2QRUA 1GV1A 4NMHA 3HDVA 4DL9A 4QGSA 3RVBA 3KJIA 2VJOA 2NTNA 1OIWA 4K5SA 1BN6A 1B0VA 5IBRA 4PQFA 1MNAA 4X4OA 4QO8A 2QMHA 2DJWA 2CPJA 1JTEA 5DETA 5B0GA 4MIKA 5D4NA 5ALMA 2ZTUA 4R16A 3N2ZB 4LIRA 3KKZA 3RJMB 4JYCA 4Q2LA 4RUHA 4OD0A 5JJCA 1FXSA 2CC2A 3GUZA 4I4NA 1YHNA 1RWXA 3PR1A 3K0HA 2G63A 3L7MA 2JFGA 2FDXA 2OSRA 5CNJA 1GCUA 5JCZA 1RXOB 5BW6B 3BWYA 2A10A 5EXSA 2EWVA 1KRXA 3ZCRA 5KPJA 1KYYA 1OPRA 1GXTA 3OTOF 3OJ0A 5D0GA 1BD3A 1GAJA 5BSGA 2YJGA 4UZSA 2WNIA 2ZZKA 4LFCB 3ONDA 5HF9A 5J5AA 5CQGA 3T54A 2AKAB 3H5OA 4QBUA 5DGXA 1LRJA 1R8BA 2RHSB 4Q24A 3WLJA 3AONB 1XNHA 3FJ2A 2F67A 1BMQB 1MJHA 1O2DA 3A6DA 5EZ5A 2OESA 1RHUA 2FZWA 5C5IA 1RI5A 4ID3A 1E98A 4DDVA 1RWKB 3K4QA 5KCMA 1N2XA 3MMBA 4M53A 4G0OA 3B38A 5EIOA 1AMOA 4MTLA 2QZPA 2GIQA 4ZKAA 1E8MA 2PSEA 1XRSB 2BKUA 4GW3A 3ET6B 2XM3A 2IOQA 1GX5A 4X66J 4JGIA 3NBUA 2Z8QA 3NUQA 4YCDA 3HWWA 1AHHA 4YO8A 1FXLA 4A7PA 2H9AA 3CD6S 2W2TA 1SO8A 1Z34A 2AJ0A 2ZIAA 1UF9A 4TM7A 3PRBA 4RGQA 1KEZA 4COOA 3SMQA 1ILWA 1U2CA 3CWCA 3LSYA 2CLIB 2ECPA 4IUYA 3CURA 4FIZA 5COAA 3HY4A 4MVJM 2AQKA 3CSKA 3SC2A 1AGNA 2BJVA 5EQDA 5TS3A 1T13A 3CCVS 4DR7J 2HWWA 1L3BA 4O3QA 2G7MC 4WYLA 5A3RA 3N0RA 4D79A 4OGKA 3BKXA 4NV1A 1Y89A 1UM9A 4NFLA 1FD2A 3VC1A 3VTAA 4EGCB 3OBIA 5FOVA 4EH1A 1NJXA 2KHCA 4BMOB 2RD2A 2BE7D 4OUDA 4GXNA 2BFAA 1JB1A 4G1FA 5AJWA 3KOAA 4GO7X 1MB4A 1P1CA 4IY1A 1EBUA 1BQMB 4YV1A 3L8YA 3Q8PB 1D6NA 1XJ0A 1K08A 3E84A 4GI3A 3ZWXA 1MJ5A 2FUG6 3DV0A 2O8FB 1KS9A 3BXFA 1NKEA 1WOPA 3I4FA 3LY5A 1YOBA 4Y3UA 3U49A 1Y3IA 4EOGA 5ENDA 3FFXA 821PA 4TL7A 1G7SA 1K1EA 3D81A 4UXIA 2AFHA 3KQQA 2MQMA 4RFSA 1FQJA 1X4BA 1HNIA 3BMNB 2YC4C 3CLSD 4PS0A 1HDGO 2Z3ZA 4ZRMA 4A2QA 2ZI4A 2CHVA 3AF0A 3LCMA 4B5LA 1K3TA 1XRQA 3FYHA 5EUBA 4E5KA 4CQLB 4YROA 3NGRA 2HX1A 3R5KA 3Q3EA 1RJWA 1VL2A 3MEGA 4L8VA 4QBIA 1PN3A 4XWGA 1PT7A 2OVFA 2P9ZA 5DGIA 3R6LB 3GLUA 3JU3A 3OLXA 1FTNA 4F2HA 4TZKA 1QUFA 5D5QA 3WB1A 4DA9A 2M0GB 4TL9A 4K2XA 2XUDA 2E1CA 2Y27A 4WK1A 4OATA 1X77A 3HP7A 3VGPA 2ZIEA 4QHSA 1U1DA 2WONB 3M4JA 3WWDA 1HTBA 5CX1B 5FJIA 1FIUA 3CDWA 1NM5C 3Q7TA 3R9IA 2IHUA 2X8BA 2OLKA 2H59A 4FPIA 2ZT6A 1JAHA 4JR0A 3DLLQ 2BFOA 3NC0C 1CF2O 2BSQA 2O7VA 4RAOA 1YJ5A 3ZZNA 4HAXA 4NCHA 4J03A 4CTNA 1REQB 2AFHB 2D1YA 4WLEA 2E9TA 2RH9B 2YMMA 1MWZA 4RORA 3QUCA 2FU5C 3KZOA 4Y18A 4KPUB 4D26A 2D69A 4HZGA 4YJ3B 5LQJA 4ZU6X 4NPOA 4IOCQ 3MTBA 3CSSA 2QBYA 1YC2A 2G9RA 4F06A 5I42A 1NQWA 5A9TA 3MECB 2PZEA 3EW9A 2MJNA 3V1TC 1SI9A 5B0AA 3F5SA 4UE3S 1SRQA 1TL1B 4RACA 5A71A 3TXXA 2ROGA 2MIIA 2HMIA 2I78A 4Z9AA 5K6RA 2J9EA 3TLZA 1OWNA 5GAGU 1VR6A 5CAEB 4KYTA 4WRRA 1ARZA 3QOWA 4RZ3A 2QE6A 5CA1B 3LX4A 3EGWA 3A9VA 5K8MA 2QAIA 5FLEX 1WM1A 1XZBA 3KDNA 3JQGA 1MT0A 5HQ8A 3N0WA 3LECA 4B6FA 3RAMA 2XMQA 5K1ZA 3CZCA 3D7MA 5IAEA 2W83A 5K6AA 1YFKA 2VP0A 4JGGA 4TLBA 2O2JA 2PYDA 3JAKB 1VIDA 4JUDX 4GOOD 1OD6A 2FB0A 2XT9A 4E2WA 1AA6A 3CCJS 2XLCA 3CVJA 4A16A 1M0EA 2QLTA 1KMHB 3A2NA 4HGPA 1D1PA 3ZU4A 1F2VA 1UMJA 3FTQA 2MKKA 2BZ2A 4TLMB 4M1KA 1G42A 1U7ZA 4QM6A 2C4HA 2FW8A 4XD7D 2HF9A 4M0CA 3PUXA 3AB8A 3EPIA 5CM8B 3GQBB 1VK8A 1FSPA 2J31A 4M95A 3C0KA 3L4KA 1FRJA 2BMJA 4HDRB 4IXWA 5AI8A 1FWPA 3RAXA 4FGKA 3TIVA 1ZI8A 4UD2A 3EGEA 1XJCA 3T1YJ 2M52A 2OH2A 1ZMRA 1K97A 3KTFA 2RHHA 5FTWA 1ZR4A 3A05A 3STWA 2H9IA 4QFBA 4LF5F 3RT9A 1XK7A 3GFRA 3O03A 4RLHA 1MGOA 3KQMA 2B4UA 1HE5A 3DFZA 1LW2B 3ZW8A 3WA6A 1WXIA 1MOQA 3G2MA 1PJSA 1XQVA 5INTA 4I1UA 2D62A 1ZFNA 1KEPA 5EI5A 1CULA 1SG9A 2HQIA 4BVLA 2XWSA 2HLTA 2FWMX 2Q4TA 3JCZA 3IDZA 4LYHA 5EKTA 3ACCA 4PIVA 3ZJUA 3BB3A 1G55A 2YIDA 1Q0UA 1I3KA 1C9MA 4KAFA 4N47A 4U39A 4U7WA 3UK2A 3M6VA 3LGNA 4WNIA 5ALNA 2FF7A 2WTUA 1BW9B 2CHQA 4AMBA 1TFRA 3OJCA 3P20A 2QVXX 2V2ZA 4U5XA 4I5FA 2W2LA 4QPPA 1R6AA 5A8RB 1Y5IA 3MTAA 3WGOA 2B9WA 3JYTA 5BQFA 3CZRA 1PWEA 1PI3A 2NUPB 3LW8A 2BL4A 3NNSA 1TELA 4H7DA 1Z4KA 3VH2A 2MWMA 5I3ZA 3SLRA 4LF1A 1P4GA 2X8WA 1BZYA 3H2SA 3O3CA 1C0TB 4UY85 1JJFA 1JR4A 4AL7A 3KIPA 3TUPA 4HL9A 5CEEA 3NU1A 5JDIA 2XSJB 4BVJA 3I05A 1N32B 1F0YA 3V46A 1WCIA 1QP0A 4EZBA 2FPRA 1PLKA 3DEKA 1EVYA 3C7KA 2X23A 5E3AA 1M7GA 3PHBE 1APBA 2HBZA 1QG2A 1E6VA 1PJLA 4CUZA 1GDDA 5C5CA 1U4NA 3RT7A 2QLXA 1Z4NA 3K94A 1TTHA 3H05A 5TEVA 2ZPTX 2D2IA 5K4AA 1YE3A 2PS3A 3TE7A 1IQUA 1NPKA 4RNNA 2PN6A 2QSZA 2X8JB 5IJWA 4MUHA 3NNCA 1XYVA 4ZTZB 5DCWA 1E92A 5CIWA 4YI3A 4M87A 3ANMA 4RNDB 1QRAA 2YDXA 3WC4A 4ELTA 3HVRA 3MJFA 1O0BA 2EKLA 1L0BA 3TIFA 2KN4A 3E51A 2EEYA 1UDCA 5KWIA 3G5TA 3IFSA 5ALVA 2AEJA 2WUVA 3HDHA 1FFDA 2VL7A 1B99A 5E0OA 1X80A 2JGMA 3FMFA 2W8BB 4UMVA 1U0FA 2XI3A 3GJTB 1RWWB 4IQFA 2PZKA 5DHFA 2R6HA 5K0LA 1VQPS 4J43A 2VO1A 5G2OA 4Y6RA 4RX6A 4ZS6A 3MR3A 4QU8A 2D6FA 5IUNC 3AC0A 2HMYB 4PLVA 4DDMA 2B20A 3L4JA 4BLQA 2D7JA 3VAFA 4MP3A 2DR7A 3R7SB 1PJZA 2C5GA 3KWMA 4NYZA 4ZGGA 1J22A 1QTIA 1IZ0A 1KDYA 2I4RA 2ENUA 4LF8B 1YIAA 5A5GA 2J8SA 1E7RA 2W1BA 1RWWA 1AQIA 2DBRA 1CEZA 2GEBA 2QXTA 4AS3A 4N9WA 4Q37A 3N59A 3TZBA 2DQSA 4IKOA 5C8DA 2VXBA 4MROA 3OT5A 3AJDA 3SEZA 5HVHA 4J2TA 4HDOB 4W5NA 5D5HA 3COSA 4CTKA 3PO4A 3A7DA 3K5HA 4I36A 4FGUA 4TVAB 4Q9LA 2YRFA 1Z06A 2ACKA 2BISA 4P71A 4M6WA 2JNWA 1VYUA 2M7SA 1P1JA 3GLFB 2F43A 5AW2A 2VYFA 3K0EA 1TMKA 4Q05A 2CXOA 4E11A 4M9RA 3KLHA 5H9EK 4J91A 4AY6A 1T8SA 4NI2B 3PC7A 2AMFA 4K4TA 1K86A 1U28A 3H86A 5F3TA 3JD4A 1M5OC 4URZR 1T15A 4QBGB 3Q7QA 4ZI5A 1QHHB 3AL3A 4YCJA 1L7BA 5IASA 4G97A 4MS1B 2OAQ1 5FT9A 2FR0A 4DHEA 2ORYA 2M6RA 1SB9A 3KLFA 1HYBA 3ZDQA 1WMDA 5TGTA 4L15A 4NEYA 2G76A 5BORA 3RU3A 3KLHB 3DP9A 2K7KA 3QRRA 4WFXA 2QDXA 3OQPA 1FMLA 3RTBA 3VYSB 1RAFA 5BV2P 4FDVA 2GN1A 2I33A 1X0VA 4YX9A 1A0OB 4WCDA 1GTZA 4BB5A 1AB5A 4USJC 1ZK3A 1QIFA 3CJKB 3EZ5A 2IX3A 5KYYB 4W4MA 1QVWA 3H0PA 3AXTA 1AQJA 1S02A 3GYBA 1HMVB 4IHJF 1BFUA 4I4BA 3EYAA 3ROQA 3KVRA 2X1FA 5BY2A 2Q5IA 2WWHA 5CYQB 2B35A 4K9NA 5FBRB 4FYPA 3DMDA 5CPFA 3MWYW 4OV6B 5L7WA 2C7PA 2BE2A 1URPA 3KB6A 2F4VF 3OPYB 2IBSA 2LCQA 4RF2A 3ST7A 5I7UA 2JGDB 2JAUA 4B7XA 2IZ5A 1DTWA 1NG1A 1R4NB 4M88A 4RFLA 2QTFA 1GTJ1 1PJCA 2HA7A 3LT4A 4C4XA 4EKDA 2EQBA 4Z51A 2ZSAA 1QLWA 1D6JA 2B98A 3U3OA 2GBIA 5SZJA 4CDNA 1AA1B 4FILA 1ZAVA 5CDFA 2HHCA 3K09A 3M8RA 2GHWA 1VIVA 4RKYA 3QJJA 4D0NA 4O0MA 1FRZA 2FPOA 2XSZA 4IHJA 3G6KA 4CMKA 1KMQA 1QDUB 4ARAA 2CA9A 2BRUA 5KFYA 1QAJA 1NFQA 2HQSA 1ST2A 2BEWA 2GIRA 1JNXX 2LD4A 4MV5A 1R6UA 3PEFA 1HYQA 2UXCB 1C9EA 3JSMB 3FPJA 4WU3A 4FR0A 3MM6A 4AK9A 1W5SA 2WOOA 3KAQA 5ES4B 2QLNA 5A3QA 3M4YA 1TFYA 1Z56C 4DV7F 4C9DA 2RGCA 4S2EA 2VBCA 1TL1A 1X7YA 4QYTA 1MRNA 1E3SA 2ZSHA 2G4VA 4CKXA 1PEKE 5B1DA 5EJ9A 1YDHA 1DBDA 3KSBC 3WIOA 4RE6A 3UMCA 2EK6A 5ETOA 2XTNA 3C66A 2FG7C 2P2SA 2P6PA 2O2XA 3VTFA 3D6JA 3W5AA 3WGGA 3M6FA 1FYDA 1Q8LA 2WR8A 2ZYIA 1QGED 4JYMA 1UP7A 2YFHA 1UL1X 4DQXA 3SYKA 1VPDA 3NBQA 2CNNA 4BVHA 3E2MA 2VI5A 1LEHA 3CEHA 2RSLA 5ILGA 4CQMB 5H9FJ 3UHOA 5E8RA 3CCFA 1YDWA 3C3JA 1IOZA 3HO1A 3GV7B 3JQBA 1HRDA 2H1CA 2X0JA 3ZR4B 3WNDA 3ANLA 4ARZA 1YBMA 2AV5A 2Q1WA 1JLRA 3JQFA 2BFDB 4OYBA 2Z30B 4L0MA 4UY8T 1XEZA 4QR0A 2BGUA 4BTVA 2OECA 2YVLA 3Q8XB 3RRKA 1SHLA 3FPCA 5LSLA 2VFRA 4LR8A 2VP9A 3SS9X 2VPTA 5KDOA 3ZLUA 2OKQA 5EE0A 1IYZA 3G82A 3ZXXA 1UZDA 2FYXA 4KEAA 1GL3A 1HNVB 2ATXA 1L3VA 3AP2A 4PLPA 2DNYA 2FVXA 1A9QA 2WDZA 1EZZB 4ZVOA 1DKRA 2C2GA 2DF8A 2BSXA 5G41A 4TPKA 2GYWA 5KG5A 4FDAA 3E9NA 1WELA 4OV1A 4ECXA 1SZCA 1HL7A 1PR3A 1X9SA 4FB5A 4NA1A 4J94A 1CJTA 1CUGA 4KUGA 4ZN6A 1V26A 1KJNA 4XVRA 4MRAA 3PRYA 1JEDA 3ZLVA 3VAIA 2B6AA 2GS8A 4AKHA 1AZWA 1FSSA 2DPYA 1E9CA 5LQDA 4IDGA 4KH0B 1NN3A 2G83A 2REQA 2HSEA 1TMGE 3PK0A 1QD1A 4E4RA 4XVUA 2GEUA 3QFTA 3L07A 3C24A 2VDWB 9LDTA 1NBIA 7ABPA 1N6NA 1VI6A 1YK0A 2PVCA 1K47A 1L7OA 5J2MA 3PX6A 2IM1A 4HQKA 1DJPA 2H63A 3F7OA 1IEWA 4CQNA 2QK4A 2VJBA 3TX8A 2JKVA 1GVHA 2K3KA 1MABA 1SOAA 1HZJA 1RAAA 4BVGA 1WI8A 3OVMA 4I2PB 4IJWA 4NZMA 4DUYF 4PO1A 4Z49A 4LWQA 1ZZFA 1R5OA 2PMFA 3COZA 1YE8A 2C1EB 4AKIA 2F1FA 1WY7A 3FVRA 1RHQB 4HVCA 4U8HA 2I62A 3NHRA 2XBLA 1D5WA 1B00A 2VDVE 2OP0A 5F73A 4TN5A 2GF0A 5HTKA 4QM7A 2MXYA 2GMWA 3PYGA 1NMZA 3TAXA 4KYZA 4OHOA 4W7SA 3JXOA 4CMHA 3TVKA 1RPNA 1JJAA 2GCFA 3S70A 4HWGA 3HKDA 4F71A 3PX3A 3QLVC 1A5TA 3QMMA 1ZK0A 4PFQA 4IDFA 1JWLA 2L9NA 1C7ZA 4M5MA 3MUVP 3G1WA 3GVHA 3OL6A 1QFSA 3DOOA 5TMPA 1RTDA 3OT1A 1JKJA 5KQGA 1GVNB 2FP4A 3OF5A 1CUCA 4XDYA 2JFYA 1IM4A 4CU5A 5BURA 4HB3A 4FKZA 1X1SA 3ULKA 5DM0A 1VHIA 2DE0X 2PM8A 1R6VA 1VJ0A 3B7PA 3KJEA 5D78A 4FBUA 3ZGXA 4GC7A 3V7YA 1XB2A 2QSWA 1PZFA 1TK3A 2FMKA 1FT8A 3EBPA 4E4TA 2IU3A 2O5VA 3VJMA 3VNAA 3K72B 1X60A 1X7YB 5FPSA 5YASA 3DEFA 1LW6E 1G38A 5I5EA 1DWUA 3G0OA 4BN0A 3ZDCA 3RRZA 3EZXA 5G40A 2EW8A 3JSMA 2GGPB 3I37X 2GVNA 1EDEA 1P7VA 3SOZA 4KNWA 2P0AA 4RV9A 3EPLA 5LLSA 2YBVA 1E62A 4NI5A 2QV6A 3A6LA 4AG3A 5J63A 3LQ2A 4UE6A 5LLDA 4R01A 3LG2A 1DS6A 2ECFA 1SPXA 3CRQA 2Q0HA 2FUCA 2HRRA 2D2VA 4IYRA 3PG5A 1PTJC 5IMSA 4DC9A 1TKXA 2A5LA 3UKDA 1EP4B 3A3YA 5EGYA 1G3OA 4I4IA 4I50A 1W581 1QNFA 3BXZA 2P4EA 3UK6A 2WSLA 1CDZA 4QODA 2SKEA 3B5EA 5CM2Z 4TMYA 4YMUA 2XGMA 3GJSA 3TIIA 4AM8A 2XDQA 3RANA 3KJGA 1PWXA 2P68A 1NBWB 3WISA 2DGTA 1NVXQ 4ITUA 5E6SA 4LFBF 4DMCA 1M6EX 5T4FA 4KPCA 1QK3A 3EVZA 3HF5A 4UREA 4C6RA 2VP2A 3NKFA 3RODA 2EDAA 2QW1A 1GU1A 1CQJB 2JCVA 1PK7A 3CUKA 1PJQA 3RK1A 3R40A 3L0OA 3WK8A 3ZU6A 4MP6A 2Y1DA 5LMNB 2O8FA 2Z58A 4GFDA 4GLBA 1EDZA 2AD5A 3CNBA 1MPXA 2MZTA 3MWJA 3RROA 5DQIA 3AF5A 3A6HA 5DGTA 2EF1A 3NMRA 3N75A 4RXTA 5BRNA 4I66A 1E5TA 2A9PA 1QU2A 2O8CA 3U09A 3CHYA 5TV2A 3EC7A 4XSVA 3BJRA 3AHGA 3QXGA 2GHTA 5KHLB 4YAOA 3K7RA 2C7GA 4EQZA 4ZVFA 4DR4B 3TNLA 4FX2A 4F6LA 1JT9A 1ZW6A 2F40A 1KXZA 2EJVA 4LNUA 3ITNA 4N54A 1W85A 1TL4A 1E9DA 4D57A 3AW8A 3CPSA 3I0NA 3RRFA 3CN7A 1BHNA 4IIVA 4EPVA 3ZH2A 2X22A 4GI5A 1V5WA 3EZGA 3G7UA 3ZDYB 4MUEA 1IBCB 4M60A 1UVJA 2O59A 3L8GA 2ZJFA 1XMVA 1Y00A 1E3QA 3SVTA 1RT7B 5RUBA 4W9NA 4Y9DA 2QL9B 2HZAA 4TKZA 4ZALA 3D6MB 2G0CA 3PX7A 5IEBA 2Z5LA 3RLFA 1R0CB 2PCLA 3UK7A 2W2XA 3JRNA 1NVFA 3S4YA 3OZSA 4LIPD 4OL9A 2GQCA 1Y3AA 3V6KA 2R7VA 1TYZA 5DM70 3EH2A 1XTQA 3QVGA 3ASVA 3ZS8A 2R2AA 3TPCA 3LP1B 2X7JA 2X7HA 5CURA 4I08A 2Z5FA 5AI4A 1KAHA 4GEGA 4FFBB 3MQFA 2CVPA 1LJ8A 2O01C 2PHZA 3SLGA 5AT1A 1UVLA 2ID4A 2KYZA 4HSEA 8OHMA 1TLLA 3UH0A 2RGNA 1L4MA 1P0CA 3BGOP 3QVTA 1FYXA 1RISA 3SIRA 4JC5A 4KMSA 1A5BB 4MKRA 3RAPR 3BD9A 1GMWD 4KTQA 2E2WA 1Y6QA 1FFXA 3ZTYA 3QFSA 3UN3A 2WJ4A 1FVQA 4O25A 3OJOA 4RH1A 1DNPA 3CLHA 3F3YA 3RIHA 1NK9A 4BXOB 3UK0A 1TU0B 3C87A 1V5IB 2ALYB 3OR2A 4N9QA 5J2UF 1XBTA 3IUNA 5JPDA 3LD9A 4J9LA 1WKCA 1MB9A 2QTZA 5DNEA 3DL2A 4LSMA 4LMPA 3S27A 3JARA 4CQJA 5CLLA 3S44A 4C8MA 5ALXA 4RLQA 1XTRA 2G1HA 4NZ9A 5JYEA 2IY9A 3WNVA 1EG2A 2GXUA 3WDOA 2HPHA 3NAHA 1G3RA 3CB2A 1GCAA 1L4GA 1ZXBA 3E7FA 3EM1A 4HNSA 3EW7A 4IG3B 1B7GO 4C4YA 1DO0A 3J81A 4HQFA 1N34B 2R6R1 2GAAA 1AQUA 3Q0EA 1MDBA 2ACWA 3NFRA 1M2JA 5KFMA 4HYKA 2P6NA 4BKQA 3W2FA 4DR2B 5A7HA 1T9WA 2FOXA 3Q8YA 4BVBA 4RPIA 2VPYB 1P5HA 3TNFA 4G0ZA 2I8LA 1EFLA 1XMOJ 1T35A 2RAPA 1K27A 5IM4F 2QROA 3CJ0A 3N39C 1GNTA 3IMFA 1P6TA 4M5HA 2W25A 2ZJYA 3TD6A 3PTWA 2ZRBA 1JEQA 2FLWA 2W9CA 5AK0A 1NSFA 3AHFA 2FZGA 4Q3LA 3WDMA 1AM4D 5FLYA 1FRMA 2Z0MA 4EI9A 1RADA 4EQ6B 2X8AA 1RHKB 3KLIA 3QGGA 4B9EA 1WNEA 2PL3A 1VGYA 1VJWA 1CS0B 3HR8A 4EI8A 1HBUB 1UMDB 2XECA 3WMXA 4D3ZA 5IDVA 1Z0SA 3PQCA 3FJOA 2VJYA 5H80A 2FPUA 3KOWA 3G86A 1M33A 1R0BG 2V67A 2MQPA 3DWIA 1ECFA 4B6JA 3N79A 3OL8A 3V6MA 4C7BA 2DPJA 3NI2A 2YH2A 3H87A 4ZMMA 4W6ZA 1RZMA 2CQ0A 1CJKC 3HZZA 2FHJD 4L3WA 2XWJI 4H2DA 3IS9A 2ISSD 2W2QA 1VBFA 3IHKA 3DHEA 3BPSA 2HXSA 1POWA 4YJKA 2I54A 3O4HA 1LDYA 3SSQA 5KFHA 2FQYA 4NL5A 2VSQA 1A7KA 3RUDA 3E5RA 3EMBA 3IP8A 3SDZA 2C59A 4ZVKA 1WQ4A 2BN4A 4GWGA 2PD3A 2ODBA 3HVIA 2AHOB 4B3SF 4GLJA 1A7AA 4AY2A 1OXVA 3GUHA 2MDTA 1RYHA 3LVQE 1GA4A 2A1IA 1KOJA 2NYVA 1D8AA 4B74A 1QTNB 1WBDA 4C8ZA 4LI0A 2LVWA 4JOUA 4NZYA 3D66A 3IVAA 4HAZA 1FP4B 4Q4LA 1H05A 3K9FC 3LDGA 1HE2A 3GN2A 3R09A 5D2CA 4YLYA 3K8OE 1SQ5A 4H1HA 3UK1A 1U0NA 5AHWA 4A9AA 3LXRA 1T02A 3CWJA 2G3YA 5L3QA 4RW9B 1MO6A 1V4BA 4QXOA 3TZQA 2CNWA 2VHCA 1A8QA 3BSOA 1H2VZ 3QQ5A 1MRSA 3LCUA 2V8BA 2OBYA 2VA2A 1P2UA 2FW0A 4XE5A 1X9HA 2JH8A 3OQ2A 4G4JA 4Q7LA 4D4IA 1UKYA 3W60A 3J7TA 1VS3A 4B02A 3OQ1A 3LWDA 1FNDA 2IDZA 3OM1A 4V0QA 2GCOB 3OPYI 5FI1B 4DKXA 1TFWA 1J9EA 3SIPB 2QTLA 3WIVA 4GBGA 3ZK9A 2PQ0A 3ADDA 4RXMA 2Q28A 4FVCA 1LOUA 1FX2A 5U1PA 5KTSA 3S3TA 2UUTA 2B1QA 4LJSA 2A1TR 1IG0A 2OR3A 2FPSA 1TEVA 1T0JB 1YFZA 5KMGB 1OVMA 4E8UA 5CT5A 3WC2A 3CPJB 2FQWA 3R6LA 4ITRC 3SAJA 1RC8A 1V7CA 1VQYA 2JLQA 3UOAB 5LUBA 3IIEA 5DBEX 3GAAA 3E9DA 1WZ2A 2JJQA 1KFBB 5DGCA 3M4NA 1TYBE 1IM6A 5E3IA 2VDJA 2ET6A 2J08A 2B4TO 3C3XA 6NULA 4RZXA 2JLBA 2EWHA 4EGFA 1FFYA 3VZHA 1XNQB 4RFSB 2FY8A 3DV9A 4FTWA 3HACA 1VBYA 1B74A 2WDPA 1IMJA 2D5CA 2NSDA 5IW8A 4BJ5A 2IZ0A 3WOHA 1HNWB 1D7OA 1YLXA 3KKQA 3EGNA 3EFBA 1YH3A 1MORA 3PVZA 5EP3A 3DF9A 4RD0A 1LFPA 1DG3A 4F04B 3HFGA 5JALA 3BWMA 4NLVA 1Q7YT 1CEEA 4Q4HB 1I5EA 3R2CJ 2JCGA 4DLPA 3VALA 3K0AB 4E2FB 5BXQC 2HNAA 3TM4A 3L1KA 2JHEA 2FRXA 2YRXA 4AWBA 3OJUA 5E9QA 4G25A 5DQHA 5HBMB 3IIKA 2QOEA 2PO4A 2V7VA 1RUSA 2C2MB 5THQA 1L5KA 5JAPA 2EC0A 3KLFB 1QFMA 4FWBA 5EWLB 9GPBA 4DT1B 1ORHA 3T99A 2B9VA 1GQ2A 3U4GA 3WZ2A 1GADO 2WSBA 2SICE 4C0LA 1ENYA 1QHHA 1GLVA 3D28A 3OE7D 2ZOFA 1NYQA 1CRLA 4AY5A 1GMWA 3K53A 4L78A 4NKRA 4R9UC 4UHCA 2DK2A 5C1DA 5DHUA 4LV8B 4DNPA 1NIJA 3BORA 4L2IB 1DHMA 1HSZA 5BWNA 5KJ1A 3TQTA 3ROKA 2I1QA 3GEGA 2Q1UA 3S2YA 2L17A 2R84A 4JKIA 3OE7A 1TKDA 2I71A 3FDXA 4ZCRA 1L8XA 4GKJB 5BOSA 2KFZA 3S0JA 5LJIA 1KQGB 3IPXA 1CZUA 5EEHA 5LDHA 2FG6C 2F62A 1V6SA 4ZJYA 1A7JA 3D8RA 1OFGA 3C70A 2DO4A 1APSA 4GU5A 1KVQA 2H1FA 1Y5LA 3KV1A 4U3JB 4AZWA 2IM2A 2J0VA 5BSTA 4XGRA 4W7IA 1NFFA 1GUFA 2DBQA 5I7WA 5G4KA 3GH1A 2RI1A 5DGDA 4ZEWA 4C22A 3EQZA 4MWGA 1WUJS 2JJ1D 2HSZA 1NDPA 1H5UA 3KNZA 4EABA 2R68A 1NM5A 4JQOA 3SI7A 5CYPA 2DB3A 5SYAA 3F49S 4WZMA 4L07A 2D1SA 4O2AF 4P86A 4TUYF 3FSGD 3IC5A 5JCJA 5AXAA 1G21B 3MUNA 1NVBA 5EWMB 1GILA 5ERGB 3VAMA 1PZMA 3PZPA 2NT4A 4ZV4A 2NUBA 1PBUA 3HS3A 4WCFC 3MJDA 3AKDA 3QUAA 4Y0AA 2ZH7A 1QDUA 2HQFA 1N5RA 2HH9A 4MRPA 3MCWA 5L4SA 4QOSA 3BM5A 2Y9HA 1RHMB 3WGHA 1GGEA 1QIHA 1NHUA 2YV3A 2VQEF 1A27A 2DX7A 5AVJA 2ZBDA 4ZDIA 1FZQA 2QRRA 1VIOA 3NAGA 4QOGA 4BIIA 3EODA 1R0AB 3BV8A 5BYQA 3RAJA 1VRTB 3RFVA 3RVJA 1WG1A 2X1AA 3CJQA 5JE8A 4UBKA 2BQ3A 1HETA 3ZWWA 3MCUA 3NWEA 4G8CA 4KH1B 3I1IA 3PS9A 5AK6A 4CFSA 1XLWA 3CLTC 4F50A 3F9RA 1OBCA 2J67A 3N6VA 1J8FA 3LW7A 4BNGA 1EFUA 3EXG2 4ZO7A 4J0FA 1D1UA 2CJFA 3RVKA 4JYAF 1R66A 1VTKA 4X3OA 1RE1A 2HQRA 3BEGB 1FJ7A 1T4CA 4BKMA 1X1AA 2Z8YM 1AQLA 2P5TB 2J8AA 3H83A 3A2MA 3HZOA 1JJVA 1PX2A 4ZYXA 2Q49A 4IR1A 5FTMA 5AVOA 2XQJA 3IRXA 3IXLA 2C0PA 3X3HA 3KXDA 3GDHA 1JXEA 1SJRA 5DS7A 2CBXA 2PJDA 4EPTA 3OZDA 4QRHA 2IOFK 1TUWA 1MXHA 1FMFA 1Y9ZA 4RY9A 2W22A 1YRQA 1BMFD 1DHRA 3CLSC 4TRNA 1M6VA 3DFEA 2BOAA 1DFGA 3KFLA 1GFSA 1G4CA 3MAJA 4WLFA 2COUA 2OHHA 3N58A 4UCQA 2EHDA 4ZZ1A 2GA8A 3E18A 1MAVA 2RGBA 2UUAB 2PU7A 3EVTA 3DTTA 3K0AA 2IWHA 5HJXA 4UQOA 1QX3A 5T4HA 5BQOA 2RHDA 4CN8A 4P34A 1NT4A 1ZS6A 3NOQA 2JLFA 1IUNA 4KBYA 4KN6A 4B3RB 1SC1B 2ZSFA 3KKOA 4QT0A 3ORHA 3GCXP 1L7QA 2XITA 3PNIA 2AVNA 4B84A 1QONA 4OHKA 4PRKA 4GDFA 3M6UA 1RM5A 2JFPA 3FMOB 3BRSA 5JVGQ 1XTJA 3EDQB 2WIKA 2V69A 1C2TA 2DMRA 4JLJA 3R5HA 4BLTA 4YGXB 1PGPA 2ZBCA 3GGGA 4K9MA 5TQ2B 2J41A 3ZTTA 4Q16A 3JALB 3TX2A 1QZXA 1JFFB 4HKTA 3ABZA 2PKWA 2RH4A 2GNKA 4RESA 4ITSA 3F6RA 3JD2A 5F78A 2O8EA 3L77A 3P27A 1DJOA 2IV2X 2WWTA 4NX9A 2BJHA 3QHPA 1DAMA 1J1ZA 3GCZA 3R7LA 4D8UA 3ZIAA 2FSHA 3RO7A 5DSXA 1I01A 4A8TA 1I6KA 3D1QA 4OBWA 1J5EF 3HCWA 2P69A 1LW7A 2NZ4A 4ETWA 5IOLA 4DCOA 2IXTA 3JQAD 1B6TA 4Q7EA 1C5KA 2E4VA 4WINA 4QDJA 1NXWA 2GERA 4N6NA 2LPMA 4TXNA 4DJJA 2ZBGA 2Q9BA 2MT9A 3OJFA 1RCTE 4JP5A 3P7MA 1FRNA 3ELYA 1UWBA 3BYRA 3I2KA 1PJ3A 3PX2A 1EVKA 4YTEA 3VPDA 5BMVF 3DHVA 5KTRA 1E0SA 1Y4SA 2FGJA 3HYSA 5KG4A 3PC8C 1YUBA 4QQKA 4MX8A 1ZVMA 3K0FA 1S0UA 3GG1A 4Z0HO 3AF1A 1VOTA 1YITS 1ZETA 1JSXA 2M1ZA 4NXNF 5IZ4A 4E5PA 1NPYA 1COWA 2P9FA 3GA5A 4UM9B 4J3JA 3Q7IA 3AY7A 3N76A 3AUYA 1RXEA 1NQUA 4NX2A 2VWQA 1OHHA 2N47A 4RTSA 5JO0A 3B51X 3UD3P 4A48A 2HJRA 4P2SA 3PIDA 1SC6A 3D6HA 5FR2A 3PXBA 9MHTA 1OLXB 1L5ZA 1XKQA 2HCBA 5B36A 2DUWA 3THSA 3IWLA 4A0QA 1C0TA 4CIOA 4RD2A 1QGAA 3T7KA 2CXXA 2Q21A 4Y8VA 1ECGA 4YDXA 2H92A 4IEEA 3DE5X 5AW8A 1KJJA 3WLAA 1EH5A 1M8GA 1VCNA 4LFBJ 1W5FA 2UXDB 1R37A 1EQAA 2RDMA 8GPBA 2VB6A 1VSTA 3KFVA 2ZC4A 3L93A 2AOUA 3R6DA 1M34E 4WOCA 3QBJA 4GZ6A 1TVEA 4YJ2A 4V0OA 1NDQA 4PO9A 1NAQA 4Z7CA 4RNOA 3DZGA 4Q3BA 4ESVA 3KVOA 2HRZA 1Y6GA 3BO4A 4RO0A 4HX9A 3AH8A 3CX8A 2EIXA 1Z5ZA 4ND8A 3KV3O 1Z4OA 3G5MA 3DL0A 3WYFA 1Y5MA 4XAKA 4CI9A 1KQFA 5B12A 3SFTA 1WBJB 4GC5A 4DR7F 2RG7A 3MM5B 5B4TA 3D3JA 4ARSA 2QD1A 1KHHA 4ER5A 5MN4A 3L7AA 4BS2A 4D81A 5DI3B 4B9LA 2Y6UA 1CJTB 4N5IX 4ER8A 1ZW1A 1ZC3A 5HILA 3KJHA 3GRCA 1Z2LA 3TCKA 1NRXA 1F6BA 3AO0B 2WSCC 1LQ9A 1U1KA 5JMNA 4DFDA 2FFJA 1XFAA 5BP7A 1S9EB 1VL0A 3MK31 4N4AA 2ZP1A 4Q4AA 4K9DA 1N1MA 5DHSA 3V1YA 4YJ2B 3H4VA 5C8ZA 2BCJQ 2WWVD 1X4CA 2VC2B 3IAS1 4A8YA 5BVGA 4C6SA 1Z26A 1W2IA 2PSFA 5KYWB 4LRXA 4DLBA 2HRQA 3NTOA 4MV1A 1Q0ZA 5KT4A 2WIFA 2I80A 3HU5A 4Q0MA 3TQEA 2B4AA 4A0SA 2YXNA 1TMJA 4AJHA 2VQDA 1I2DA 2C2BA 1FDAA 1ZVQA 4CR8A 3D6HB 4R8VA 3M9WA 3DRSA 1GR1A 2WICA 3K5LA 2IXFA 4UBLA 2J3DA 4P3XA 4B48A 1S6YA 1JDVA 2BZ0A 3KCNA 2K3IA 1O4WA 4KR0A 2DQYA 3KEQA 1RRKA 3CO0S 2W9BB 3BVPA 1F2TA 3JX9A 4W90B 2IJGX 1IOLA 5L1JA 4DQ0A 2W90A 2IHVA 1IBMF 3GVIA 4YQYA 1PNVA 5DULA 1K1SA 4DJFC 4NVRA 3NB0A 3Q8RB 5D3MA 3HHLB 1GP2A 3NJ4A 1L9XA 3EVOA 3W90A 1YI1A 4BO3A 4DR5B 4ZDWA 3LCJA 3SLKA 3VZCA 1OREA 2YXBA 3KQNA 4MYSA 4QFMA 4ZI2A 5KSZA 2WJ6A 4IG9A 2IP2A 4IZ6A 3ZJTA 4JBCA 2YFKA 1JJ2R 3WZ0A 1XCGB 5CFLA 4KFRA 3CCES 4S35A 3ADKA 1KVRA 2Z04A 4KGDA 3T0IA 3GGSA 2G1AA 4AZ3B 2R8IA 2GJKA 1TA4A 5EXDA 4UOZA 1NE2A 1H2UX 4MV3A 2HR1A 3OE4A 2AJCA 2OD9A 1T6ZA 4YCAA 2HHTA 3DDWA 1DQZA 1N0IA 4UMEA 2J0WA 3RABA 1ACMA 2FGKA 5JH7A 4IHKA 1YL6A 3POTA 2KX7A 2ZE8A 3DPUA 1Z18A 1TA0A 4QU6A 3HYRA 2Y3YA 5LSAA 3PZBA 1KS2A 4HD8A 1AHNA 1WMBA 1BEUB 4J0QA 4NYIQ 5KJFA 4LDZA 1TAQA 1QZZA 4C11A 1YQGA 1Z2OX 1E3LA 4LYYA 3DXSX 4HXGA 3M8YA 2ZZMA 4DPOA 3FSXA 4HQ0A 4OGWA 1D4OA 6GPBA 2QZZA 3M5CA 1JF8A 2XCPA 1M8JA 1AHPA 1ZUNA 3RUBL 1T6XA 2GBGA 2G9VA 4PSDA 3IE1A 1HHSA 5TVGA 3DWEX 1CZKA 2E4XA 2DISA 1HORA 1DTTA 3OM9A 3SBOA 1DKMA 4QC2A 1L5QA 1E79A 4CF4A 1MV5A 4B08A 4MS4B 2IZOA 4Y2PA 3AP3A 3LO8A 2O66A 3ILIA 3RRNA 4MH0R 1AKMA 4WY5A 5FUMA 4ZIRB 1QRDA 4UHDA 1X13A 4F91B 4LK3A 5A3JA 8AT1A 1BE8A 2YHUA 1YIDA 3PY8A 4DR3J 1DRJA 3QRPA 2FE4A 3O4FA 1N5VA 4TKUA 2UXBJ 2OPBA 2BEUA 2RE8A 4NEZA 1ETUA 3R0QA 1OOEA 1F4VA 2BEJA 3DMFA 3WWOA 4F56A 3SC6A 5AKGA 1XMXA 1FKOA 1SKWA 1FDRA 3SZLA 4ERNA 2FPLA 3KNAA 3R2DJ 1GO2A 2XRFA 2V7EA 3TW8A 3QYYA 1M6HA 3EA5A 1PCAA 2GMLA 5CYMA 1HBUA 2YNHA 2W8KA 5AJVB 5FV4A 1NBEB 1UR5A 4CF5A 4EO6A 4AAYA 2J46A 2NSBA 3ROGA 4W9RA 3IAM1 1Z0IA 1SBYA 5HKKD 4R31A 5KJCA 2Y3IA 3L8MA 1ICIA 2NO6A 2GZ3A 4DSAA 1UWVA 1K7SN 2X0KA 2JIBA 3HJAA 5E3PA 3NGTA 2IAJA 1KP9A 3OTWA 4BKOA 1TT5B 3AVUA 3ELBA 2UUPA 2BZGA 2FWRA 2WF8A 4B79A 3ACDA 1MJNA 1FTRA 3S40A 1A77A 5KKAA 5I3QA 3K1YA 3ZC3A 4BLUA 3GAZA 3Q85A 1QJ4A 2UP1A 2UXBB 3BE8A 3R7DA 2NZVG 1CV2A 1S12A 1JR3A 4WIAA 1NW3A 2XWPA 1KYTA 2QVGA 2PEYA 3F5DA 2XKAA 1RACA 4BRWA 4TVKA 5FQNA 4RJ2A 3MA0A 2HLDD 3HHKA 1P2SA 4S0XA 1YSJA 2QC3A 3L46A 1XWLA 1G8HA 4R2HA 1RYDA 3A3KA 4DS4A 5M34A 2GO8A 1B76A 2AR9A 3I8SA 4EEKA 1RI3A 4NLRA 1GPH1 3WHLA 2QLFB 1SEPA 1G5FA 4DOMA 3FR7A 4KFUA 2J0QD 1M5HA 2H5JB 1U8TA 4QDKA 4N3GA 3VU3A 3TQFA 1FKAF 3KOUA 1ZH6A 3IR7A 3PXXA 5F98A 4YWJA 1BOFA 1X80B 2GPBA 2PWPA 5KT2A 4ISCA 4OJ3A 3K5IA 4KHPJ 1NYLA 1IWGA 3K4HA 1ODSA 3H5AA 3CCWA 3H0CA 2WD7A 5A3SA 3U9LA 3SDSA 4IDAA 3U81A 4GQBA 1F0PA 1N75A 2HCFA 3H11A 4ZI7F 2X14A 2G6BA 1OXXK 3IQWA 4MW5A 3IG1A 3ZJYA 4DL6A 3FPEA 4G8DA 5BMOA 5HOQA 1RLUA 5CXTA 3I28A 4M0PA 3ZVMA 1RTIA 4USUA 2MYFA 4C8KA 2O0JA 2C83A 3LP5A 3PT5A 4OU4A 4F0MA 2ODAA 4PAOA 3B4MA 1LEOA 5K2OA 5KG3A 1RW4A 4HOYA 4FBGA 4HQLA 5JAOA 5AW1A 1PJ5A 1IOVA 4C4PA 3GJTA 2B43A 1CR0A 1M6VB 4JNKA 3LCRA 5BQPA 5DU2A 4R0NA 1U1NA 2XSJA 1GOTA 2VP6A 1NK7A 4XJVA 5J5VA 2R6FA 2JVIA 2J3EA 2OXEA 1ROFA 4XR4A 4ZANA 4F96A 4O4JB 3D1HA 2VH1A 4BV8A 2RKBA 1IBMB 3OLAA 2RHGB 4RH0A 3PGVA 4BNFA 4MO2A 5I4BA 3RKRA 1VISA 3OPVA 1A9XA 4BCBA 2NYHA 3CMMA 4YGYA 1XTZA 3PKJA 1IZYA 2G2OA 4OX6A 1G0OA 5DASA 1TM3E 2XYGB 3MT9A 1TD9A 5KFKA 1G5IA 3HDGA 3A70A 4B17A 4H4DA 1YQTA 4FSHA 2OXIA 2PZLA 1YBUA 1K0UA 4M22A 3CPHA 4OFZA 5U4XA 3FOWA 2A0XA 2XZPA 2ADBA 2D5LA 4N7MA 5AJYA 3QM1A 2AN1A 4LJ8A 2HU7A 4EVIA 3IT0A 4Y2KA 4N0PA 4YP1A 2AOWA 1KJIA 3C6ZA 1C7QA 3PD0A 2BJ3A 2E5FA 1KD1T 1JHZA 1VLVA 3DMTC 4UUNA 1S9EA 1IK6A 5HMLA 3KKEA 4BPBA 1CJKB 2JI4A 5FL7D 1Z16A 4PNEA 3E3XA 1NRKA 4G63A 4MWTA 1ISSA 2VU5A 3RHTA 1G66A 1LPMA 2X4DA 2EHJA 1KERA 1CZHA 3W3ZB 2ID9A 2R7TA 5JQWA 2AX4A 3N6XA 2ZYUX 1Y4ZB 1HWIA 4QUGA 3H0EA 4KO2S 1WQ1R 2NTEA 3LBIA 1SIZA 2EDCA 2Q4EA 4LVNP 3A9WA 5C8XA 4I46A 4JBNA 1ESDA 5CLJA 2RILA 4LOIA 3F0NA 4E13A 5A8WB 5A6WA 2IXDA 4DXAA 1ZD9A 5DM4A 1YHQS 5F0UA 1FNBA 4FD3A 2D1QA 4RW7B 2J5AA 2FOLA 4QLBA 3SF8A 3WE7A 1V3VA 4F4DA 5D6GA 2VPQA 1OASA 4TLLB 4HFNA 3UDVA 1S8OA 2L0XA 2HGZA 3Q22A 1IWOA 1IBSA 1EMDA 1VDMA 2AJ1A 3UDLA 1H0HA 2HZ7A 4ZPVR 2WIGA 3A1DA 3O91A 2M3DA 3QKRB 4E22A 2YNMD 5T7BA 2OFXA 2XWYA 2XAUA 4MWCA 3F74A 4RY0A 4I6YA 4C89A 1Y5RA 4GZ3A 4LF7F 4EL0A 4KRGA 2IBKA 3FHTA 1WPGA 4CU2A 2EBUA 4F46A 1QPZA 2IBMA 1QZUA 3A12A 1NBME 4FJ2A 4BRUA 3LDFA 1ORIA 1HFKA 4HDNA 5SYMA 4IMRA 4BCCA 4LWPA 4CMAA 4I1OA 3H90A 1LPOA 1F51E 2DXIA 4MIAA 4I5GA 3TVTA 2DVIA 4KNVA 1H2BA 2NV0A 2PGOA 4ND3A 4QU7A 1HR0F 3MRTA 4GICA 3IUYA 1VKZA 2YDYA 2PLAA 4UBOA 4AJKA 4K81B 1XMPA 4KQHA 3K71B 4PV7A 4BDTA 3L8HA 1IB0A 2Q4BA 3HXLA 7MDHA 1V25A 2CGEA 4KSYA 1KP3A 1QYWA 2ZRMA 4GUDA 3I2HA 4LF4B 4UVEA 2FHKA 3WX4A 5DYGA 2VT6A 3IEVA 2K7JA 1CRQA 3M1AA 4IPTA 1E1QA 3BGRA 3W2WB 4JLBA 3VZBA 3HHNB 1UVKA 1OXTA 2AUTA 3ERCA 2BYCA 1IUKA 1P31A 1OCEA 1QF9A 3ROXA 2WHEA 4HWOA 3CLRD 3KLEA 1XNRF 2CPYA 1TUIA 2B4YA 4LOJA 3AZPA 1FRKA 2IYNA 3ZV7A 3FETA 4L8FA 2YPYA 1H65A 2DH9A 1SL1A 3VMMA 5DI3A 1Z13A 4X62B 3GFPA 1CRPA 3FUCA 1ZITA 4IMJB 2AGPA 1L5WA 4LV5B 4J76A 4P5PA 4LVOP 1W73A 5D77A 1M0TA 4BMVA 4TSKA 2ZRGA 5J4VA 1MO2A 2IY5B 3H4TA 4LDNA 1U11A 2FCRA 4RIEA 4DWWA 5GY7A 3U7HB 3AFMA 5KYYA 1FYWA 1TZBA 4ZO6A 1C7FA 4GG1A 4G37A 5A7GA 2VP5A 4IFVB 3K5NA 2WFAA 3KMQA 2P9CA 5E5NA 3HX9A 1EGQA 3JVEA 2C7RA 1JXLA 4P08A 3VDXA 3PQ5A 5F35A 1G1MA 1LQTA 1D2NA 2PN1A 4GRSA 4USWA 3ZQ4A 4RK7A 3W05A 2XT0A 2OEJA 2H2DA 2VDUE 1X1EA 4L9RA 3A1CA 4DKJA 4P82A 3CBGA 3TECE 4RW4B 2H2WA 4S1TA 3SR0A 5KWVA 4K03A 4OGGA 2VPPA 5KWEA 5IVIA 1N92A 2WHPB 4ECQA 1CS4C 3GYNA 2XUAA 3ESXA 4DL0C 2HK9A 4FYIA 3MPVA 3G0GA 5IZHA 3U3JA 1UBMS 4ID8A 4ZKDA 2QVYX 5AKJA 4GZ5A 1VA5A 3U27A 2V7UA 3ZY4A 4OEHA 3L7LA 2GA9A 4CQMA 2EZ4A 3TGPA 5KNBA 4ECYA 3LPAA 5ULLA 1TU3A 2UAGA 3WSTA 3ABQB 2AUNA 4BQFA 1YWXA 4N8EA 1WC1A 1MT3A 2Y99A 3O83A 1FJXA 2F17A 1U1QA 2O20A 4DI6A 3FFIA 3BERA 5D86A 1KC8T 4NC9A 3CJ2A 1L3SA 3RRXA 4WASA 1H0SA 5GPBA 1SIUA 3R5BA 2WLSA 3TI0A 3OBBA 4XB6B 4QBFA 2W9AA 2VLBA 2DUMA 2CMGA 8ADHA 4GPZA 1OWLA 2WM8A 1NATA 1TGYA 5L3VA 3GVCA 3ML1A 1DBQA 1Z12A 1F2UA 1VE1A 4NLXA 3DI6A 4OZ1A 4F60A 5EJIA 5IARA 2JIRA 3HJNA 1UBFA 3IAM9 4DR2J 2BOVA 3MM6B 1T95A 4XYBA 2OPRB 2NU9B 2VC0A 3AVYA 2P40A 2FDCA 1Q0QA 3EH1A 3PENA 1XMOB 3L1VA 2FY1A 1LFAA 5EESA 4YR3A 2Z08A 1PFWA 5LZ4A 2GBCA 1RIFA 2IZ1A 4EYKA 5G3ZA 1VLMA 3A7EA 2R7WA 1R89A 1N9GB 2ZUCA 5KTYA 3CD7A 3VVUA 3DDIA 4N03A 4DV0B 1RWMA 5ILQA 5B0CA 3RWMB 5AVXA 1NVDA 3GGCA 3VQSA 2CHEA 2ZUDA 4MVXA 1RWNA 5JC1A 3WBKA 1Y34E 5B57C 4J4BA 2GKOA 5LQUA 2A67A 4ZYYA 2TMKA 1J4AA 4Y2RA 4OK5A 5B6JA 1OLUA 2Y1OA 4CG0A 4QUAA 3NDRA 2BH2A 2XKJE 2P6RA 2UVQA 2J9XB 3JPWA 1JJBA 2XZOA 2WVHA 3G1UA 2IFTA 3D6MA 3M9NB 5T8KA 2A0YA 4AJ1A 3VMFA 3Q1LA 2BJ1A 1U7HA 1XZIA 4J2HA 3TZXA 1MH9A 3TQCA 2NO7A 1R88A 2WPDD 3I73A 2JBAA 3ABRB 5JI3E 1WU7A 4U63A 3JAMA 1WP9A 4DQIA 2K87A 4FXVA 1TYAE 4DSTA 3L1JA 3JSXA 1NZAA 2ZYHA 3CJ4A 2XOEA 5FORA 1EI9A 8MHTA 5LL6d 1XVLA 3EZLA 4Y9TA 1T4MA 5B4UA 4DV3B 2OHIA 2QL5A 5DTEA 1PL7A 3O7WA 4QU0A 3RSOA 3G8SA 2DLCX 3HZGA 1IR2A 4JP1A 2XWBF 2HHQA 4NL4H 3SJ7A 2VPYA 1TRKA 2GVZA 2FI1A 1KOOA 3P19A 4OBBA 1VRUB 2Q3BA 3E53A 4D4KA 1JUDA 4U7GA 5LXYA 2I4OA 1E1QD 2BANB 1OZAA 5EQTA 4QR1A 4FZ3A 4EUNA 1G4UR 2KBEA 3JQBC 2WP0A 4TQRA 4I2VA 4DR2F 3TUZC 4C8NA 1W0JD 3ZU5A 1N5QA 1R64A 3QPWA 3I5MA 4UEOA 4TLCA 3NHYA 1JKHB 1X1DA 4K4WA 2D74B 3GONA 4HHJA 1PEYA 3A1NA 4P92A 3FSEA 1TCAA 1L8QA 2X3UA 3U4MA 2BKOA 4DR1B 5JJLA 3LLCA 3CIFA 4RGBA 2V8GA 4HZUB 4RPCA 4DJBA 1BGWA 3W9IA 3UTDA 1ZZEA 3CD5A 3SBMA 2C8LA 4LF8F 5GZ6A 4RM3A 4DZZA 1X74A 5HNKA 3W6OA 1D4ZA 5K3CA 1QRRA 3QW4B 4BJ1A 1M5RA 3HP1A 2O3SA 3A3NB 4K9SA 4GMKA 1EFRA 4KJZA 4HGZA 1XDGA 2EZ9A 2GASA 9LDBA 3MS4A 3Q2SC 2XZDA 2G2YA 3GLFA 1CJBA 4FHEA 2FEKA 4MTPA 1QAYA 5ESXA 3ADOA 4HXEB 1M74A 3LTOA 5ERXA 1ZQ1A 2E1RA 2JNJA 2BGKA 1Z29A 4DUZB 3W8NA 1VMBA 2RE1A 5A76A 1RLIA 1DADA 1GAXA 4NU0A 2ZSKA 4EMTA 5H59A 1JKMA 1Y82A 1M3SA 1W44A 4BMXA 2VODA 5DDOC 1WVGA 5LZ8A 3GVPA 2HHHF 3EGDA 5IKEA 3GJRA 1E8NA 5L4NA 3BXHA 3K0CA 5CB6A 4IIUA 4USTA 1SR8A 4KXLA 2P90A 2JFWA 5TMDA 3BKFA 2UV8A 4DQLA 2PZ8A 4KYUA 2A18A 3WLSA 4B81A 3SFVA 2L3MA 1VE6A 4A8JC 1NVVR 4HG2A 1AZSB 3FUYA 3LP1A 5KX5A 2M9KA 4NMLA 3SY8A 1HSOA 1TTHB 4Y2AA 5IF9A 1OFUX 4BJ6A 1BE1A 4HPWA 4RKRA 4TVOA 2Z4PA 5G3YA 5B37A 1E3JA 2RU3A 3ABSB 1X8XA 1CUIA 2R751 5DSTA 5EXTA 4BE4A 3ME5A 3R1IA 5AQEA 1KNQA 3K8QA 2PMCA 4M36A 2POKA 1EP3B 1N3BA 4O4LB 2PD4A 1E6YA 3UVEA 3ZNNA 1M90T 2OMLA 2BABA 3IELA 3OM0A 2VATA 5C31A 1U1FA 4AYXA 3NATA 3EUFA 5HFJA 2WMDA 5ALUA 4WZZA 3Q6MA 1J8VA 5GV7A 3KZNA 3D0QA 2PPVA 3LHKA 4PWDA 3MJVA 3VBEA 2VPXB 2PBZA 4U4AA 3ZD7A 4MUXA 2QUAA 4KQZA 4KBIA 1HHQA 1W85B 2FMUA 4I6JA 1XD9A 3PSHA 1E3IA 2F7SA 1FJGF 5EMKA 1EIZA 4B43A 4FSXA 4OYMA 1RJEA 1IPHA 4EPWA 3O6VA 1CG6A 1NXOA 4MGIR 5HHTA 2XXJA 2IOHA 4HYYA 3V4FA 5IAOA 3FVYA 3OF2A 1X7ZB 1M5TA 5C1PA 3G2PA 4H4OA 1AKVA 3MLEA 3EDOA 4A15A 4CHTA 2CLHB 2R7QA 3QVJA 3ZCQA 1QQ5A 4ABYA 1QZTA 3K9WA 2WTBA 4HT5A 3WV4A 4P98A 4DILA 1UCFA 4X1OA 5B1HA 2UXCF 5CFNA 3R23A 5FBHA 2UUBB 5L53A 2QX9A 2F5GA 3OLWA 1YR2A 2AF6A 2QMQA 1ISIA 3ILXA 3CCTA 2FJAB 3RS5A 4DV7B 1V9OA 2NUPA 2YWJA 3RVDA 5TPZA 1EJ7L 1JQJC 4HI2A 1GNVA 2CFXA 2PFDA 4IXTA 1MUUA 3ZWNA 4H6PA 4ITVA 3KHHA 1N4LA 3QPIA 1ZUWA 3P96A 3F4LA 5H83A 3R7FA 2OSVA 1EHWA 1MB2A 4MR9A 3DE2X 1O5TA 2W6OA 4M0EA 4TLDA 1MHPA 4NOKA 4R05A 1W2WB 3TPZA 3F44A 4JH0A 3WLEA 3T6JA 2HHSA 1JQKA 3EASA 5SY6A 3L6BA 3EHDA 2D5AA 4X3PA 3FR8A 2FGCA 2ZHBA 1SKSA 3GA7A 4ZLJA 1E2DA 1KMNA 1YS7A 2YNMA 4X45A 1J5XA 3UENA 3BXGA 4NASA 5BQXA 2WJHA 4R9SA 4PTZA 1NM2A 2Z8ZA 3OURA 1J27A 3OZUA 3W0LB 3S6JA 2HL6A 4Q4DA 1WETA 1DELA 1HYHA 1NXVA 4MYCA 5AESA 3GDGA 4KNYA 2JASA 1US8A 5ADWA 3UCFA 2Z30A 4ANFA 3AV3A 4NBTA 4XDZA 3AGQA 4C5AA 4CV2A 4ZQBA 1TK8A 1OLXA 2VCEA 1HK7A 3TKAA 2OL4A 2IX9A 1VLZA 5CD4A 3NDBB 3URMA 3JQFC 3AWDA 1U9IC 3RFCA 3ZDFA 4Z7JA 1FDBA 4EYEA 2JJ8A 1KDNA 4XM0A 2XMCA 4QXAA 3KZMA 5JMPA 2Y1IA 2FKAA 1MB0A 3NYRA 1SG6A 4FB4A 1OJ4A 1D6SA 4LMRA 3DONA 1TZCA 3TNDA 2IL1A 1WLSA 2J6HA 4JV5J 5CJJA 1S1UB 4CEIA 1RTKA 4I5IA 5F1KA 1R2QA 3IQZA 2CL6X 4Y2VA 4JB8A 3AL2A 4A8SA 3N74A 5L3SB 2LDIA 3DMJA 3AB3A 3A4YA 2Q45A 1TTTA 1MP0A 3THXA 1PG0A 3L79A 5TMBA 2ZKUA 4QTTB 3AB2B 4BDSA 4O3OA 4HDHA 1GLNA 4V0LA 3AERA 1OSCA 4Z0PA 1RAAB 3ROFA 3UW3A 5BJRA 4Y2SA 1M1UA 5L1IA 5K3FA 3IUEA 2JLAA 4XH9B 2JCYA 3ESYA 1KRHA 3MM7B 3DZCA 2BP7B 3R8CA 3LP2A 3ET4A 1XRLA 2XX3A 5F3DA 4P9NA 3K92A 4OB6A 4BECA 5DTJA 1I4EB 2IPNA 1D2CA 5CRIA 3O84A 3C16B 2WVCA 3VZDA 2NWQA 4LJRA 4W63A 1KMIY 2VRCD 3MOJB 3OR1A 3MD0A 1NOKA 1H22A 1MLAA 4M0KA 3KETA 3I6BA 4HHEA 2LUOA 3ER9A 5A6PA 2ZC3A 4B3RJ 1U90A 2CZQA 521PA 2ZI6A 4PX3A 4H0NA 4M5KA 1RQPA 1VQ5S 4CKEB 5C7YA 3VBCA 3M30A 2DVMA 3I9NA 2YOHA 1Q86T 4WKBA 5BR4A 2GA7A 2GO1A 4Z99A 1AUVA 1KQFB 3DZJA 1ZVKA 3JQRA 5M04A 1J5OA 2JCSA 2G0TA 2B4PA 2NM0A 4MLCA 4MWSA 1DUSA 2VXYA 3BJEA 1CPZA 2IYOA 2OQVA 3OM8A 2HHHB 1XMJA 3SQOP 1KRWA 5HIIA 5L3RA 2OEPA 3PP8A 2XHWA 2MSSA 5DHPA 1NC1A 3V2UA 2YKGA 4MGZR 3DC7A 1U48A 1YCFA 5LYJA 1T3OA 2VNKA 4XWTA 4UZCA 3ZVLA 2WABA 2IZ6A 2PR7A 1Q83A 1BQMA 4G4SO 2JHFA 3QPDA 3G0HA 1TRHA 3FMWA 4H4EA 1U1IA 1B0AA 3DDNA 4BC0A 3MJCA 2FLPA 1AB6A 1U7LA 1NNEA 1N3YA 2ZB4A 2NMVA 1ZD4A 3BBBA 1JDNA 2Z56B 1K73T 3IVRA 3NHWA 2I9SA 2CUYA 4YJGA 4BAUA 3ZTPA 1ZIPA 2Q99A 1A9XB 3A9CA 3OFNA 1LV8A 1NLYA 2CK3D 3D3NA 3UJ8A 2JJMA 1L3KA 4J1QA 1Y6ZA 3P9CA 4DOZA 2FPPA 3DKIA 2HG4A 4WK2B 1EVQA 4Y6SA 3MR6A 5DWDA 4NBLA 4KAXA 1DMRA 1GWNA 4MTCA 3SXUA 3WYEA 3JRWA 4HUQA 5ALKA 4UNRA 4DS3A 4HACA 4MKBA 3CINA 2FETA 1TMYA 2G17A 3QXSA 2WG2A 1NQ5A 4F4AA 5LM7E 4P83A 5CA1F 2IDEA 3B2EA 4CKBA 1YQQA 1U31A 3H6HA 1K6MA 4DU7A 2YZNA 3X1YA 3V4MA 4MMZB 5ADVA 2DNHA 2L08A 1T1RA 1YOVA 3TB6A 1CBKA 5IUJC 1TPYA 3DMHA 4D4MA 4RF5A 4N76A 4CO4A 1UKZA 5EIFA 3TAHA 4I2NA 4TV8F 4NLWA 2D0OB 3F1KA 4RELA 3MT8A 4W9MC 3IXMA 3KTDA 3ASYA 1QYIA 3QU9A 4ZV7A 5DHQA 2BW2A 1R31A 4EBEA 4V3CA 4D8VA 2QMYA 1DKUA 3GPIA 4ZICA 4LAFA 4NV3A 2IYIA 4F93B 2XZWA 1YBVA 1T2FA 3N6NA 4PGHA 1NNDA 1BQEA 4PQGA 3BGWA 1T9UA 4MZDA 3RUPA 1UA0A 3L5OA 4NLPA 1JB9A 2IYXA 1E6KA 2QRHA 3LC7O 3IP6A 1Z0FA 3DKDA 4QDZA 1H8HD 4O4GA 3UVJB 2BA9A 1OC2A 4ZVUB 3DOJA 2VJQA 4M8SA 3M8SA 2H9YA 4PGAA 3DUWA 2AP6A 4G1MB 2J3KA 3ET6A 3OKCA 4HBZA 2XT6A 4PYMA 3I4HX 1NVAA 4X54A 4DR6B 1CNEA 2O05A 1R9JA 2ZIZA 3RG8A 2VA9A 3MBKA 4AKSA 1F60A 2F3SA 2G71A 3B3FA 5DLGA 2P11A 4DUYB 3MUOA 4OJNA 1UQRA 4D9FA 3RIYA 1BTOA 2MYPA 2P6SA 2AN9A 4UCFA 1RQ2A 1ZM3A 3IO5A 3LUAA 3IB3A 2EJUA 5BR8J 3T9FA 1OH8A 5T6MA 5EE1A 4BMZA 5KT5A 3MJEA 4MZXA 4OVKA 4AJOA 4BV2A 1YVUA 2ZIUB 4S1OA 1LDNA 1WCIB 1VSVA 2DNPA 4G5FA 1NQVA 2JEIA 2H52A 2HZVA 4MS1A 5KCZA 1JDPA 3GSIA 3WL4A 3CRMA 3MUMP 5KFFA 2Z09A 3WKDA 2ZJ2A 1OA1A 2Q7DA 1ORRA 3R3XA 3M5WA 3G0BA 1X7WB 3UHFA 3Q88A 1GPKA 3FHOA 4JFAA 4BNWA 1LBQA 1I4DD 4DARA 3TD9A 2ZQZA 2L82A 4HWTA 3EZ7A 2RONA 4EFMA 3WLNA 4DR6J 2OE2A 4GZMA 3EGOA 3DZDA 3B6KA 1DDIA 2R8YA 1RABB 1JAXA 2R7UA 4D9HA 4DUPA 2RQ4A 5K0ZA 2JAWA 2BEUB 2ZRLA 4LHXA 5AIBA 3W5HA 1I13A 3VZIA 4B73A 4X7BA 2LA6A 1NVEA 5E7IA 2EG9A 5DX8A 2OAEA 3QWFA 2V2KA 1MB3A 4JKYA 3HSGA 4FMDF 5BR8B 2R00A 4JVMA 1QU3A 3UR0A 3VR5H 2SHKA 1FD8A 1CLFA 5DFAA 3ZTRA 3NDIA 4L50A 4HQOA 2QUBA 1Z2CA 2YYSA 1JIKA 4ECSA 1H4QA 3N01A 4H4MB 1ORVA 5TSDA 2DNRA 2QM0A 5DCYA 2ZYWX 3IILA 4LHEA 5JISA 5DT9A 2CSXA 4YB5A 5FLXU 4KH0A 2HBYA 2ZKTA 1U3GA 4OHZA 1X7DA 3IGVA 1CX9B 3Q7SA 2J7KA 4KXFB 5K3EA 4C14A 1S2NA 3PVXA 4X60A 3OZWA 4C7JA 4KHMA 4K2JA 1CP3A 4B7UA 1UKAA 3D8TA 4S1WA 3MELA 4ZCQA 3HHLD 3VVTA 2NXNA 2XLJA 3GJXC 3JARB 4IEFB 4M8KA 4J2OA 2NQTA 4R9NA 2JBWA 2WA1A 4IRKA 2VDMB 4G1UC 1S6PA 3TL3A 2NXWA 1NW4A 4CTJA 3J80Y 3IPAA 1T11A 4A0RA 4D0RA 1U3DA 1QFYA 5B6PA 4DLGA 2Y1LA 3DOFA 3KJNB 1GT6A 4OHUA 1FK8A 1N5YA 1G63A 1F0XA 5G4KB 1M7HA 4OYZA 3BFKA 3F6SA 3RR8A 2B7CB 3PFKA 5LC1A 4F9FA 3P2EA 3QK7A 4XB1A 4D43A 3TX0A 3WO0A 4ZT6A 1C0UB 4FVMA 2QQFA 2CQBA 2I7XA 4CCYB 2ZTHA 5D6NA 2PLWA 1PG2A 1UZNA 1ZJYA 3DM2B 1H1TA 1RKVA 1ESEA 2BEKA 6FD1A 4BNMA 5HOEA 1ESMA 2PX4A 2VWGA 4G09A 4L72A 3WB0A 2CL0X 4Y2YA 1R5BA 3NVDA 3EWGA 4UUOA 2ZG6A 2BP7A 1MQ8B 1VSQA 4QWEA 5E2AA 5C34B 3ZDZB 2OM6A 1X9GA 4RDHA 4B71A 4G65A 3PCTA 3KNGA 3MFHA 1GNSA 1E99A 4M1ZA 1L7XA 1VMIA 3BHJA 1L7DA 2P5YA 2XTJP 5E1MA 1NSYA 3NC1C 1KSJA 4MIEA 5FFFA 5ABPA 4OAOA 3FCSB 4RJKA 4QVIA 1Y1TA 2G0AA 4IW3B 3Q11A 4X94A 2Q5HA 4JXXA 2ZBQA 1AGYA 4MR7A 2NVOA 5B0FA 2A58A 3EGXA 4FNAA 5D0HA 2JIMA 3CH5A 2ZUTA 4X66F 4JI6J 3BPDA 1MPTA 4DR5F 3G4SS 2O54A 2REOA 2E5WA 1PQPA 1RLJA 2XSZD 1TADA 3CEDA 4FT2A 3H4IA 6ADHA 5LPNA 1K75A 4UHJA 1XCJA 5LP6B 3KDOA 3R3HA 3DLGB 3E0XA 3GP3A 2SXLA 4OX8A 1VIAA 2XYHA 3NGDA 2SBTA 4W98A 1WA5A 1WSWA 4IDBA 1ZNXA 2AHOA 2H4WA 4BHQA 1NW8A 1Y11A 1MN6A 2C4KA 3L4EA 2GC8A 4PC1A 4PZZA 1U80A 4MLDA 1BMQA 1GRQA 3WKEA 1W29A 3HCAA 3SX0A 5IC4A 4MOWA 4IIHA 4JP8A 3OCJA 2X5OA 3ZK7A 3GJQB 1U8WA 1Q84A 1L5SA 1LSSA 1J0EA 1ZR2A 4XM1A 2A5GA 3LF2A 1N34J 4KRWA 2R9LA 5EHGA