1Y7RA

1.7 a crystal structure of protein of unknown function sa2161 from meticillin-resistant staphylococcus aureus, probable acetyltransferase
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
133
structure length
133
Chain Sequence
b'MVKVTYDIPTCEDYCALRINAGMSPKTREAAEKGLPNALFTVTLYDKDRLIGMGRVIGDGGTVFQIVDIAVLKSYQGQAYGSLIMEHIMKYIKNVSVESVYVSLIADYPADKLYVKFGFMPTEPDSGGMYIKY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein SA2161
molecule tags Structural genomics, unknown function
source organism Staphylococcus aureus
publication title 1.7A Crystal Structure of Hypothetical Protein SA2161 from Meticillin-Resistant Staphylococcus aureus
rcsb
total genus 27
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13673 Acetyltransf_10 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1y7rA00
2ZW4A 4IUSA 2Q7BA 3IWGA 4AB7A 2ZW5A 2PQ8A 2CNMA 3PP9A 4BMHA 4CRYB 3FXTA 3F5BA 5F49A 2B5GB 4U5YA 5KTCA 4U9YA 2BSWA 3UY5A 3FNCA 2P0WA 3MGDA 1MJ9A 3I3GA 1QSMA 4OADA 3G3SA 3C26A 3BJ8A 4M85A 2R7HA 1IICA 4MY3A 2BL1A 2QIRA 5F46A 3TO6A 3PGPA 4QC6A 5GCNA 4KOWA 3SXNA 2GANA 1XMTA 5H84A 4KOSA 2Z11A 5JPHA 3V8IA 2D4PA 2PR8A 2GE3A 2P6GA 1IIDA 5F48A 1XE4A 2Q4VA 1CJWA 4AVAA 2ZW6A 1M1DA 2B3VA 2IL4A 3TO7A 1WK4A 1CM0A 5J8FA 2J8RA 2VXKA 2ZPAA 3S6FA 1R57A 2OU2A 4R3LA 1XIXA 4U9ZA 4AG7A 5C88A 1IYKA 2RC4A 4H6ZA 2F5IA 4CAXA 4PSXA 4UA3A 5KTDA 3TE4A 1Z4RA 1TIQA 1KZFA 1S7NA 3GKRA 2KCWA 2ATRA 3LODA 3QB8A 1Z9UA 4M3SA 1Y7RA 5C82A 4UBRA 2HUZA 4KVOE 4CAWA 2B3UA 1I1DA 4MY0A 3R9GA 1M44A 4NF1A 3DSBA 4UWJA 2R98A 2HV2A 5I0CA 3FIXA 1V0CA 2OZGA 4E2AA 3R9FA 1YLEA 2O28A 4YRHA 1NSLA 4KVME 3TOAA 2D4OA 2JDCA 4ZBGA 1LRZA 1B87A 1NMTA 3BLNA 3D2PA 4KOYA 3CXQA 3EO4A 4ORFA 2PRBA 2QECA 2B58A 4R9MA 2EVNA 1L0CA 2JLMA 4E8OA 2Q0YA 3EC4A 3W6XA 3VWEA 1XF8A 3NE7A 4I49A 1MJBA 4R57A 1VKCA 4JLYA 5HH1A 3D8PA 2Z0ZA 1YK3A 4KOUA 4R87A 5IX3A 2PDOA 4JWPA 2EUIA 1N71A 2NMTA 3JUWA 4IF5A 3ZJ0A 2G0BA 5E96A 3CXSA 3GY9A 2R1IA 1YVKA 2Q4YA 4AG9A 4B5PA 1YX0A 1XEBA 4JD6A 1B6BA 3S6KA 5CNPA 4MI4A 1IYLA 3D2MA 2R8VA 3CXPA 4F6AA 4DNCA 3P2HA 1PU9A 3F0AA 4II9A 4QUSA 2P6EA 3DR8A 4EVYA 4HNWB 2G3AA 1S60A 1KUYA 3TTHA 1QSRA 4UWIA 2OB0A 3FB3A 2X7BA 4XPLA 2VZYA 5EBVA 4PSWA 4XPDB 3N7ZA 4CRZB 1MJAA 4KORA 4CS0B 3FBUA 3DNSA 2A4NA 2HQYA 2P6FA 2FE7A 5HMNA 2FS5A 4JXQA 2C27A 2ARHA 1YR0A 5FVJA 4KZTA 3TOBA 3S6HA 2AJ6A 1BOBA 2OH1A 5IB0A 1YVOA 3R95A 3FRMA 4FD7A 4ONUA 4KUBA 1MK4A 4KLWA 4MHDA 3E0KA 3FYNA 1ON0A 4FD6A 1Z4EA 2I79A 3KKWA 4KOVA 2BUEA 2FIAA 3P2FA 1KUVA 2DXQA 4K30A 4YGOA 1QSTA 4CAVA 3W91A 2B5GA 4KUAA 2CY2A 4XPDC 2OZUA 3DR6A 5J8CA 3EXNA 2VBQA 4YFJA 5ISVA 2I00A 2AE6A 3TFYA 1YREA 3T90A 2FSRA 2FT0A 2REEA 4HNYB 4QBJA 2J8NA 3SHPA 5JQ4A 3QAHA 3T9YA 2PR1A 2FXFA 2VZZA 1S3ZA 1QSNA 4PK2A 1OZPA 4X5KA 2Q44A 4RI1A 4J3GA 1YGHA 4KVXA 1WWZA 3G8WA 1Q2YA 4MJ8A 3EY5A 4XNHB 4R3KA 2Y0MA 4LX9A 2JEVA 4FD5A 1PUAA 2REFA 2Q04A 4F0YA 4JJXA 4B5PB 1S7LA 5F47A 3DDDA 4XNHC 3TCVA 1SQHA 4E0AA 2J8MA 1BO4A 4Y49B 2CNTA 4JXRA 5KTAA 3LD2A 5H86A 2OZHA 2VI7A 5IV0A 4NCZA 4Y49C 4LUAA 5DWNA 4NSQA 2BEIA 1IB1E 3VWDA 2B4DA 4RS2A 4L8AA 3EFAA 4MBUA 1FY7A 1M4IA 3W6SA 1P0HA 2ZW7A 5EC4A 3OWCA 1U6MA 4NEXA 3SXOA 1Q2CA 4H6UA 4AVCA 1I21A 3B8GA 1P4NA 1S5KA 3F8KA 1VHSA 3R96A 3JVNA 4KOXA 2PSWA 3WR7A 1GHEA 1Y9KA 4H89A 2B4BA 2GIVA 1M4DA 3R1KA 3ZZIA 3R9EA 3D3SA 4PK3A 4QVTA 2CNSA 1M4GA 2JDDA 4KOTA 5DWMA 2B4DB 1S7KA 3S6GA 2Z10A 2WPWA 3H4QA 2ZXVA 2PC1A 1Q2DA 4B5OA 1Y9WA 1UFHA 4QB9A 3TO9A 4XPKA 4HNXB 4FD4A 4PV6A 2FCKA 2FIWA 2QMLA 4L89A 1KUXA 3BJ7A 3RYOA 4AVBA 2VQYA 3PZJA 1I12A 3IGRA 2G3TA 4KLVA 2H5MA 1QSOA 3GYAA 3I9SA 3K9UA 4OLLA 2FL4A 4OAEA 1RXTA 1RO5A 1S7FA 3TT2A 1NE9A 1K4JA 1J4JA 4GS4A 2K5TA 4NXYA 4HKFA 2VEZA 2WPXA
chains in the Genus database with same CATH superfamily
2ZW4A 1DE4C 4IUSA 5CBMA 2Q7BA 1ZLIA 3IWGA 2HB6A 1VHOA 4JYWA 4AB7A 4CYQA 2ZW5A 3D68A 5AGEA 2PQ8A 1Q7LA 2CNMA 3D67A 3PB9X 3PP9A 3WC5A 4A31A 4BMHA 3IFEA 4CRYB 3FXTA 2PVWA 3F5BA 5F49A 2Z3KA 3NE8A 4NGRA 4F9VA 1R43A 4ZGYB 2B5GB 4U5YA 5KTCA 4U9YA 5K8OA 2BSWA 4UCPA 4C7IA 4W9YA 1VHEA 3MN8A 3UY5A 4B12A 3FNCA 2P0WA 3MGDA 1MJ9A 3I3GA 1QSMA 2PJ2A 4IHMA 1LFWA 4ONWA 2C6GA 4P4FA 5LRJA 1YW6A 4NGNA 1RTQA 5AG6A 4OADA 1CP6A 3G3SA 2ZEMA 3SI2A 3C26A 3BJ8A 4M85A 2BO9A 2R7HA 4BD9A 1IICA 2PIYA 4MY3A 4FUUA 4X2TA 4UFXA 2BL1A 2QIRA 4A39A 1Z2LA 1Z8XA 3CPAA 5F46A 4UEEA 3IU2A 2OR4A 2PJ1A 3TO6A 3PGPA 1ZG9A 4QC6A 3T8WA 5GCNA 4KOWA 3WC7A 3SXNA 4CAFA 2GANA 3PBBA 3BI1A 1XMTA 2C6PA 2C6CA 4AXVA 5H84A 4KOSA 2Z11A 1JQGA 4B14A 2PJ8A 5JPHA 3RO0A 1XRYA 4NJQA 3V8IA 3S9LA 2D4PA 3WABA 2CTCA 2PR8A 3DGVA 4KSIA 4UFVA 2GE3A 2P6GA 1IIDA 4KSAA 5F48A 2WZNA 4UFWA 1TF8A 2V8DA 3B7IA 1TKHA 1XE4A 1CJWA 2Q4VA 4C2ZA 3HUVA 3PB8X 4AVAA 1IOIA 2ZW6A 5BWAB 1M1DA 2B3VA 2IL4A 3TO7A 1WK4A 5D8NA 2WUUA 4F8ZA 3IJ3A 4NFRA 1CM0A 4C2XA 5J8FA 2J8RA 2VXKA 5AG4A 4ZX8A 2GU2A 2ZPAA 4NGPA 5CPAA 3S6FA 1R57A 2OU2A 4WWVA 4IK2A 1YSJA 3PFEA 3B35A 4OIDA 1XIXA 4R3LA 4U9ZA 4AG7A 1AUGA 3CPXA 1A2ZA 3B3VA 3HLPA 5LYIA 5C88A 1IYKA 2RC4A 4H6ZA 4TWEA 2F5IA 2XEFA 5AG5A 5DS0A 4B6ZA 4CAXA 4PSXA 4UA3A 5KTDA 3TE4A 1Z4RA 1TIQA 1KZFA 1S7NA 4P4IA 5HVFA 3GKRA 1IY7A 2KCWA 2ABZA 2ATRA 4ZY1A 3LODA 3QB8A 4RN7A 2BCOA 1Z9UA 3IIBA 4M3SA 1Y7RA 4A32A 5C82A 4UBRA 2HUZA 4TNUA 3RBUA 3FMCA 4KVOE 4CAWA 2B3UA 1I1DA 4MY0A 2CTBA 3R9GA 1M44A 2VL1A 4NF1A 1X12A 3DSBA 3NA6A 4UWJA 2R98A 2HV2A 2ODFA 3A9LA 2XEIA 5A28A 3RAMA 5I0CA 3RNZA 5G22A 4MMOA 3FIXA 1KWMA 4OC2A 4OC5A 5LYFA 1V0CA 3PEIA 1CPXA 2OZGA 3H5ZA 4MCQA 5HXDA 4E2AA 3D7HA 3R9FA 1PCAA 1YLEA 2O28A 3LACA 2J9AA 2DF5A 4YRHA 4A38A 2Z3PA 4A2ZA 2XEJA 2QJ8A 4PPZA 1NSLA 3B3SA 4P4BA 2ZEEA 1EE3P 2AFUA 2PJ6A 2POKA 3GUXA 3ISZA 3TC8A 4KVME 3TOAA 1TF9A 4LQ6A 2QYVA 2JBJA 1CBXA 2D4OA 1Y0RA 2AFXA 2JDCA 4EWTA 4PQAA 4ZBGA 1LOKA 1PYTB 3PB6X 4P4EA 1LRZA 1B87A 1NMTA 3BLNA 3D2PA 4KOYA 2G9DA 3CXQA 3EO4A 4ORFA 4PXBA 2PRBA 2QECA 2B58A 4R9MA 2EVNA 1L0CA 4OKOA 4MRIA 4B11A 3KQZA 2YNCC 2YNDA 1Z5RA 3MRUA 1BPMA 4CGLA 4M6GA 4CYOA 4MFJA 4OMEA 2JLMA 4E8OA 3CDXA 2PJ3A 2ZOGA 2Q0YA 1VGYA 3EC4A 3VWEA 3W6XA 1XF8A 3NE7A 3H8FA 4I49A 1MJBA 4R57A 1VKCA 3D66A 3LMSA 3WC6A 4JLYA 5HH1A 2EK8A 3D8PA 2Z0ZA 1CPSA 5IB9A 3IWEA 3K2KA 1CX8A 1YK3A 4F9UA 4Q36A 4MXUA 4KOUA 2DPTA 3SI1A 3WT4A 4R87A 3BI0A 2ZOFA 5IX3A 2PDOA 4JWPA 2EUIA 1N71A 4Q7AA 2NMTA 8CPAA 3JUWA 4ZYQA 1QQ9A 4IF5A 3ZJ0A 2OOTA 2G0BA 2ZEFA 4MCSA 4YU9A 3CXSA 5E96A 3GY9A 2R1IA 1YVKA 2BOAA 2Q4YA 4AG9A 4B5PA 4ZY0A 6CPAA 2Q51A 1YX0A 1XEBA 2C1CA 4IAVA 4JD6A 4A37A 1B6BA 3S6KA 1IU8A 5CNPA 5J1QA 4MI4A 4B10A 2Q4ZA 4C68A 1IYLA 1ZO0A 4MFZA 5G1ZA 3VARA 3K9TA 2JEWA 4MFLA 3D2MA 2R8VA 4M6IA 3CXPA 1DTDA 4F6AA 4DNCA 1YLOA 3P2HA 1PU9A 3F0AA 4II9A 4QUSA 2EWBA 1H8LA 2Z3MA 4K3NA 4CAEA 1TKJA 3PFOA 2P6EA 2AFWA 3DR8A 4EVYA 1FNOA 4HNWB 5ELYA 4A33A 4JZ0A 4X3RA 3S9MA 2G3AA 3KZWA 1S60A 4FAIA 1KUYA 2CIJA 3FH4A 1QSRA 3FEEA 2OB0A 3FB3A 4UWIA 1ELLP 3TTHA 4PXCA 1XOVA 3S9NA 2X7BA 4XPLA 2VZYA 5EBVA 1LANA 4CGPA 4PSWA 4XPDB 3N7ZA 1IGBA 3IO1A 4CRZB 1MJAA 4F0XA 4KORA 4DYOA 4CS0B 3IWWA 1Y7EA 2PJ7A 1GYTA 3D7GA 1ARLA 3FBUA 3DNSA 2ZELA 2A4NA 4MHYA 2HQYA 2P6FA 1ZG7A 2FE7A 5HMNA 3ISXA 3NH8A 3LWUA 4PXEA 2FS5A 4JXQA 4UIAA 4CGNA 2C27A 1YMEA 1HEEA 2ARHA 2RB7A 1YQEA 3FVLA 3IC1A 4GM5A 4UCMA 1TXRA 2GLFA 1LCPA 1YR0A 5LYDA 1YW4A 3GLJA 3FECA 1ARMA 3NFZA 3SI0A 5FVJA 4UCNA 4KZTA 3TOBA 4RUHA 3V38A 3S6HA 3FEDA 2AJ6A 2EK9A 3V7ZA 1BOBA 4R76A 4MCRA 2OH1A 5IB0A 1YVOA 2PJ5A 3NH4A 3FRMA 3R95A 4CYPA 2IMOA 4FD7A 4Q38A 4ONUA 2PE3A 1MK4A 4KUBA 2CXAA 4KLWA 4OC3A 1BLLE 1AYEA 3NH5A 4EFDA 1TKFA 4MHDA 2ZENA 3IU1A 3E0KA 3FYNA 1ON0A 2F7VA 4FD6A 3PRTA 4OC1A 2GREA 1Z4EA 3RZAA 2I79A 3KKWA 4KOVA 2BUEA 2FIAA 3KR5A 3P2FA 3SJEA 4CYNA 2O53A 1KUVA 3FF3A 5THWA 2DXQA 3D7FA 2PJAA 4K30A 1QMUA 3FJUA 1QSTA 1Z8WA 4YGOA 1LAPA 4CAVA 3W91A 2B5GA 4KUAA 3D7DA 2CY2A 3QAYA 2PJ4A 3CZXA 4XPDC 1HDQA 2ZEPA 5K8MA 2AFZA 2DPSA 1OBRA 3SJXA 2V8HA 2OZUA 4P4DA 4A95A 3DR6A 4MHPA 3EXNA 1Z8TA 2VBQA 4YFJA 5J8CA 5ISVA 2I00A 2AE6A 4KS9A 1YREA 4X8IA 3TFYA 3T90A 5F09A 3H8EA 2FSRA 4MCPA 2FT0A 2REEA 4GXHA 4HNYB 4QBJA 2J8NA 2ZEHA 2AFSA 4A94A 3B3WA 2PJ0A 4P45A 4LQGA 3SHPA 5JQ4A 3QAHA 4OIWA 2CF4A 3T9YA 2DEAA 2YGWA 2PR1A 3JRUA 1ELMP 2FXFA 2VZZA 1BPNA 1S3ZA 4OC0A 2AFMA 4P6YA 1QSNA 4PK2A 4DUKA 1OZPA 4X5KA 1CP7A 2Q44A 4RI1A 4J3GA 1YGHA 4B13A 2JBKA 4KVXA 3KGQA 1WWZA 2V77A 4KSFA 3G8WA 1Q2YA 4MJ8A 3EY5A 4XNHB 1F2PA 4R3KA 2Y0MA 2RFHA 4LX9A 2JEVA 4FD5A 2Q43A 4UIBA 1PUAA 2REFA 4NGTA 2Q04A 1XFOA 2GFQA 3I1UA 4R6TA 4UEZA 4JJXA 4C2YA 4F0YA 4B5PB 1S7LA 5F47A 2ZEGA 3DDDA 4XNHC 2PJ9A 3TCVA 3VH9A 1HDUA 4H2KA 1SQHA 4E0AA 1R3NA 2J8MA 1BO4A 2PVVA 4Y49B 2HC9A 1X10A 4Z65A 2CNTA 4JXRA 2ZEDA 3DLJA 4MFPA 2WSAA 5KTAA 3LD2A 4UEFA 2F8HA 2OZHA 5H86A 4YWYA 2VI7A 5IV0A 3PB4X 4NCZA 5LRKA 3IEHA 4Y49C 3VATA 4LUAA 5DWNA 2PJBA 4NSQA 1NSAA 2BEIA 5K8NA 1IB1E 1JWQA 1XBUA 5JGFA 4C7HA 5D29A 3VWDA 2B4DA 4MFKA 4MHZA 1FT7A 4RS2A 5A27A 4L8AA 3EFAA 2NYQA 5LYLA 3BHXA 4MBUA 2PCUA 7CPAA 4FWUA 1M4LA 2Z3OA 1FY7A 1M4IA 4NGMA 2FVGA 3W6SA 1P0HA 2ZW7A 4OP4A 5EC4A 1BAVA 3OWCA 1U6MA 1ZLHA 2Z3NA 4CGOA 1ZG8A 3QNVA 4NEXA 3SXOA 2PRQA 4HPSA 1Q2CA 4OC4A 2ZEOA 4H6UA 5K8PA 4CPAA 1F2OA 4AVCA 4NGQA 3KI9A 4NGSA 1I21A 3B8GA 1P4NA 1S5KA 5JH9A 3F8KA 1VHSA 2IJZA 3KQXA 3R96A 3JVNA 4KOXA 5I4MA 4R7MA 2PSWA 3WR7A 1GHEA 1Y9KA 3B3CA 4PXDA 4H89A 2B4BA 2GIVA 1M4DA 3R1KA 3ZZIA 2QVPA 3N5FA 3R9EA 3D3SA 4PK3A 4QVTA 2CNSA 1M4GA 5EMIA 2JDDA 4WJBA 4KOTA 5DWMA 2IQ6A 3GB0A 2B4DB 4MFQA 1S7KA 2YNCA 2Z10A 3KL9A 4O23A 3S6GA 3KASA 4P4JA 3H8GA 2WPWA 3H4QA 2ZXVA 3SJFA 4BBHA 5G21A 4ZY2A 2PIZA 3GIUA 2PC1A 1Q2DA 4ZI6A 5AG7A 4MHNA 2PJCA 5G20A 4B5OA 1F57A 2Q7SA 1Y9WA 1UFHA 3B2YA 4QB9A 3TO9A 2V8VA 1IOFA 4XPKA 5HVHA 4HNXB 2AFOA 4FD4A 4PV6A 4EMEA 2FCKA 1LAMA 1Z8LA 2WYRA 2Z3LA 3PB7X 4CGMA 2FIWA 2QMLA 3TX8A 3D4UA 4L89A 1KUXA 1CG2A 2I3CA 3BJ7A 2XEGA 3RYOA 4AVBA 2VQYA 3JTKA 3PZJA 1I12A 5LRGA 1UWYA 4A30A 3IGRA 3KHXA 2V8GA 2G3TA 3PBEA 2ANPA 3KHZA 4KLVA 2H5MA 1QSOA 3BXMA 3GYAA 3I9SA 2GLJA 3K9UA 4G1PA 3L2NA 4NJRA 5HVGA 4P10A 3B3TA 1XJOA 1Y0YA 2EO8A 2YNEA 4OLLA 2FL4A 4OAEA 4P44A 1RXTA 1RO5A 1S7FA 2EBJA 4R8FA 4M6HA 1NE9A 3TT2A 1XMBA 2O4HA 1AMPA 3CT9A 4FBEA 5JM6A 1K4JA 1J4JA 4GS4A 2K5TA 4NXYA 4HKFA 2VEZA 2NSMA 4ZX9A 4UF4A 3SJGA 3FX6A 2WPXA 4BINA 4DJLA 1VIXA 3KR4A
chains in the Genus database with same CATH topology
2ZW4A 4IUSA 2Q7BA 3IWGA 4AB7A 4CYQA 2ZW5A 5AGEA 2PQ8A 2CNMA 3PP9A 4A31A 4BMHA 4CRYB 3FXTA 3F5BA 5F49A 2Z3KA 4ZGYB 2B5GB 4U5YA 5KTCA 4U9YA 2BSWA 4UCPA 4C7IA 4B12A 3UY5A 3FNCA 2P0WA 3MGDA 1MJ9A 3I3GA 1QSMA 5AG6A 4OADA 3G3SA 3C26A 3BJ8A 4M85A 2R7HA 1IICA 4MY3A 4UFXA 2BL1A 2QIRA 5F46A 3IU2A 3TO6A 3PGPA 4QC6A 4CAFA 5GCNA 4KOWA 3SXNA 2GANA 1XMTA 5H84A 4KOSA 2Z11A 4B14A 5JPHA 3V8IA 2D4PA 2PR8A 4UFVA 2GE3A 2P6GA 1IIDA 4KSAA 5F48A 4UFWA 1XE4A 2Q4VA 1CJWA 4C2ZA 4AVAA 2ZW6A 5BWAB 1M1DA 2B3VA 2IL4A 3TO7A 1WK4A 2WUUA 1CM0A 4C2XA 5J8FA 2J8RA 2VXKA 5AG4A 2ZPAA 3S6FA 1R57A 2OU2A 4R3LA 1XIXA 4U9ZA 4AG7A 5C88A 1IYKA 2RC4A 4H6ZA 2F5IA 5AG5A 4CAXA 4PSXA 4UA3A 5KTDA 3TE4A 1Z4RA 1TIQA 1KZFA 1S7NA 3GKRA 2KCWA 2ATRA 3LODA 3QB8A 1Z9UA 4M3SA 1Y7RA 4A32A 5C82A 4UBRA 2HUZA 4KVOE 4CAWA 2B3UA 1I1DA 4MY0A 3R9GA 1M44A 4NF1A 3DSBA 4UWJA 2R98A 2HV2A 3A9LA 5A28A 5I0CA 5G22A 3FIXA 1V0CA 2OZGA 3H5ZA 4E2AA 3R9FA 1YLEA 2O28A 4YRHA 2Z3PA 4A2ZA 1NSLA 4KVME 3TOAA 2D4OA 2JDCA 4ZBGA 1LRZA 1B87A 1NMTA 3BLNA 3D2PA 4KOYA 3CXQA 3EO4A 4ORFA 2PRBA 2QECA 2B58A 4R9MA 2EVNA 1L0CA 4B11A 2YNCC 2YNDA 4CGLA 4CYOA 4MFJA 2JLMA 4E8OA 2Q0YA 3EC4A 3W6XA 3VWEA 1XF8A 3NE7A 4I49A 1MJBA 4R57A 1VKCA 4JLYA 5HH1A 3D8PA 2Z0ZA 3IWEA 1YK3A 4Q36A 4KOUA 2DPTA 4R87A 5IX3A 2PDOA 4JWPA 2EUIA 1N71A 2NMTA 3JUWA 4IF5A 3ZJ0A 2G0BA 5E96A 3CXSA 3GY9A 2R1IA 1YVKA 2Q4YA 4AG9A 4B5PA 1YX0A 1XEBA 4JD6A 1B6BA 3S6KA 5CNPA 4MI4A 4B10A 4C68A 1IYLA 1ZO0A 4MFZA 5G1ZA 4MFLA 3D2MA 2R8VA 3CXPA 4F6AA 4DNCA 3P2HA 1PU9A 3F0AA 4II9A 4QUSA 2Z3MA 4CAEA 2P6EA 3DR8A 4EVYA 4HNWB 4A33A 2G3AA 1S60A 1KUYA 3TTHA 1QSRA 4UWIA 2OB0A 3FB3A 2X7BA 4XPLA 2VZYA 5EBVA 4CGPA 4PSWA 4XPDB 3N7ZA 4F0XA 4CRZB 1MJAA 4KORA 4CS0B 3FBUA 3DNSA 2A4NA 2HQYA 2P6FA 2FE7A 5HMNA 2FS5A 4JXQA 4CGNA 2C27A 2ARHA 4UCMA 1YR0A 5FVJA 4UCNA 4KZTA 3TOBA 3S6HA 2AJ6A 1BOBA 2OH1A 5IB0A 1YVOA 3R95A 3FRMA 4CYPA 4FD7A 4Q38A 4ONUA 4KUBA 1MK4A 2CXAA 4KLWA 4MHDA 3IU1A 3E0KA 3FYNA 1ON0A 4FD6A 1Z4EA 4KOVA 2I79A 3KKWA 2BUEA 2FIAA 3P2FA 4CYNA 1KUVA 2DXQA 4K30A 4YGOA 1QSTA 4CAVA 3W91A 2B5GA 4KUAA 2CY2A 4XPDC 2DPSA 2OZUA 4A95A 3DR6A 5J8CA 3EXNA 2VBQA 4YFJA 5ISVA 2I00A 4KS9A 2AE6A 1YREA 3TFYA 3T90A 2FSRA 2FT0A 2REEA 4HNYB 4QBJA 2J8NA 3SHPA 5JQ4A 3QAHA 3T9YA 2YGWA 2PR1A 2FXFA 2VZZA 1S3ZA 1QSNA 4PK2A 1OZPA 4X5KA 2Q44A 4RI1A 4J3GA 1YGHA 4B13A 4KVXA 1WWZA 4KSFA 3G8WA 1Q2YA 4MJ8A 3EY5A 4XNHB 4R3KA 2Y0MA 4LX9A 2JEVA 4FD5A 1PUAA 2REFA 2Q04A 4F0YA 4C2YA 4JJXA 4B5PB 1S7LA 5F47A 3DDDA 4XNHC 3TCVA 1SQHA 4E0AA 2J8MA 1BO4A 4Y49B 2CNTA 4JXRA 4MFPA 2WSAA 5KTAA 3LD2A 5H86A 2OZHA 2VI7A 5IV0A 4NCZA 4Y49C 4LUAA 5DWNA 4NSQA 2BEIA 1IB1E 4C7HA 3VWDA 2B4DA 4MFKA 4RS2A 5A27A 4L8AA 3EFAA 4MBUA 2Z3OA 1FY7A 1M4IA 3W6SA 1P0HA 2ZW7A 5EC4A 3OWCA 1U6MA 2Z3NA 4CGOA 4NEXA 3SXOA 1Q2CA 4H6UA 4AVCA 1I21A 3B8GA 1P4NA 1S5KA 3F8KA 1VHSA 3R96A 3JVNA 4KOXA 2PSWA 3WR7A 1GHEA 1Y9KA 4H89A 2B4BA 2GIVA 1M4DA 3R1KA 3ZZIA 3R9EA 3D3SA 4PK3A 4QVTA 2CNSA 1M4GA 2JDDA 4KOTA 5DWMA 2B4DB 4MFQA 1S7KA 2YNCA 2Z10A 3S6GA 2WPWA 3H4QA 2ZXVA 4BBHA 5G21A 2PC1A 1Q2DA 5AG7A 5G20A 4B5OA 1Y9WA 1UFHA 4QB9A 3TO9A 4XPKA 4HNXB 4FD4A 4PV6A 2FCKA 2Z3LA 4CGMA 2FIWA 2QMLA 4L89A 1KUXA 3BJ7A 3RYOA 4AVBA 2VQYA 3JTKA 3PZJA 1I12A 4A30A 3IGRA 2G3TA 4KLVA 2H5MA 1QSOA 3GYAA 3I9SA 3K9UA 2YNEA 4OLLA 2FL4A 4OAEA 1RXTA 1RO5A 1S7FA 3TT2A 1NE9A 1K4JA 1J4JA 4GS4A 2K5TA 4NXYA 4HKFA 2VEZA 2WPXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZW4 A;  4IUS A;  2Q7B A;  3IWG A;  4AB7 A;  2ZW5 A;  2PQ8 A;  2CNM A;  3PP9 A;  4BMH A;  4CRY B;  3FXT A;  3F5B A;  5F49 A;  2B5G B;  4U5Y A;  5KTC A;  4U9Y A;  2BSW A;  3UY5 A;  3FNC A;  2P0W A;  3MGD A;  1MJ9 A;  3I3G A;  1QSM A;  4OAD A;  3G3S A;  3C26 A;  3BJ8 A;  4M85 A;  2R7H A;  1IIC A;  4MY3 A;  2BL1 A;  2QIR A;  5F46 A;  3TO6 A;  3PGP A;  4QC6 A;  5GCN A;  4KOW A;  3SXN A;  2GAN A;  1XMT A;  5H84 A;  4KOS A;  2Z11 A;  5JPH A;  3V8I A;  2D4P A;  2PR8 A;  2GE3 A;  2P6G A;  1IID A;  5F48 A;  1XE4 A;  2Q4V A;  1CJW A;  4AVA A;  2ZW6 A;  1M1D A;  2B3V A;  2IL4 A;  3TO7 A;  1WK4 A;  1CM0 A;  5J8F A;  2J8R A;  2VXK A;  2ZPA A;  3S6F A;  1R57 A;  2OU2 A;  4R3L A;  1XIX A;  4U9Z A;  4AG7 A;  5C88 A;  1IYK A;  2RC4 A;  4H6Z A;  2F5I A;  4CAX A;  4PSX A;  4UA3 A;  5KTD A;  3TE4 A;  1Z4R A;  1TIQ A;  1KZF A;  1S7N A;  3GKR A;  2KCW A;  2ATR A;  3LOD A;  3QB8 A;  1Z9U A;  4M3S A;  1Y7R A;  5C82 A;  4UBR A;  2HUZ A;  4KVO E;  4CAW A;  2B3U A;  1I1D A;  4MY0 A;  3R9G A;  1M44 A;  4NF1 A;  3DSB A;  4UWJ A;  2R98 A;  2HV2 A;  5I0C A;  3FIX A;  1V0C A;  2OZG A;  4E2A A;  3R9F A;  1YLE A;  2O28 A;  4YRH A;  1NSL A;  4KVM E;  3TOA A;  2D4O A;  2JDC A;  4ZBG A;  1LRZ A;  1B87 A;  1NMT A;  3BLN A;  3D2P A;  4KOY A;  3CXQ A;  3EO4 A;  4ORF A;  2PRB A;  2QEC A;  2B58 A;  4R9M A;  2EVN A;  1L0C A;  2JLM A;  4E8O A;  2Q0Y A;  3EC4 A;  3W6X A;  3VWE A;  1XF8 A;  3NE7 A;  4I49 A;  1MJB A;  4R57 A;  1VKC A;  4JLY A;  5HH1 A;  3D8P A;  2Z0Z A;  1YK3 A;  4KOU A;  4R87 A;  5IX3 A;  2PDO A;  4JWP A;  2EUI A;  1N71 A;  2NMT A;  3JUW A;  4IF5 A;  3ZJ0 A;  2G0B A;  5E96 A;  3CXS A;  3GY9 A;  2R1I A;  1YVK A;  2Q4Y A;  4AG9 A;  4B5P A;  1YX0 A;  1XEB A;  4JD6 A;  1B6B A;  3S6K A;  5CNP A;  4MI4 A;  1IYL A;  3D2M A;  2R8V A;  3CXP A;  4F6A A;  4DNC A;  3P2H A;  1PU9 A;  3F0A A;  4II9 A;  4QUS A;  2P6E A;  3DR8 A;  4EVY A;  4HNW B;  2G3A A;  1S60 A;  1KUY A;  3TTH A;  1QSR A;  4UWI A;  2OB0 A;  3FB3 A;  2X7B A;  4XPL A;  2VZY A;  5EBV A;  4PSW A;  4XPD B;  3N7Z A;  4CRZ B;  1MJA A;  4KOR A;  4CS0 B;  3FBU A;  3DNS A;  2A4N A;  2HQY A;  2P6F A;  2FE7 A;  5HMN A;  2FS5 A;  4JXQ A;  2C27 A;  2ARH A;  1YR0 A;  5FVJ A;  4KZT A;  3TOB A;  3S6H A;  2AJ6 A;  1BOB A;  2OH1 A;  5IB0 A;  1YVO A;  3R95 A;  3FRM A;  4FD7 A;  4ONU A;  4KUB A;  1MK4 A;  4KLW A;  4MHD A;  3E0K A;  3FYN A;  1ON0 A;  4FD6 A;  1Z4E A;  2I79 A;  3KKW A;  4KOV A;  2BUE A;  2FIA A;  3P2F A;  1KUV A;  2DXQ A;  4K30 A;  4YGO A;  1QST A;  4CAV A;  3W91 A;  2B5G A;  4KUA A;  2CY2 A;  4XPD C;  2OZU A;  3DR6 A;  5J8C A;  3EXN A;  2VBQ A;  4YFJ A;  5ISV A;  2I00 A;  2AE6 A;  3TFY A;  1YRE A;  3T90 A;  2FSR A;  2FT0 A;  2REE A;  4HNY B;  4QBJ A;  2J8N A;  3SHP A;  5JQ4 A;  3QAH A;  3T9Y A;  2PR1 A;  2FXF A;  2VZZ A;  1S3Z A;  1QSN A;  4PK2 A;  1OZP A;  4X5K A;  2Q44 A;  4RI1 A;  4J3G A;  1YGH A;  4KVX A;  1WWZ A;  3G8W A;  1Q2Y A;  4MJ8 A;  3EY5 A;  4XNH B;  4R3K A;  2Y0M A;  4LX9 A;  2JEV A;  4FD5 A;  1PUA A;  2REF A;  2Q04 A;  4F0Y A;  4JJX A;  4B5P B;  1S7L A;  5F47 A;  3DDD A;  4XNH C;  3TCV A;  1SQH A;  4E0A A;  2J8M A;  1BO4 A;  4Y49 B;  2CNT A;  4JXR A;  5KTA A;  3LD2 A;  5H86 A;  2OZH A;  2VI7 A;  5IV0 A;  4NCZ A;  4Y49 C;  4LUA A;  5DWN A;  4NSQ A;  2BEI A;  1IB1 E;  3VWD A;  2B4D A;  4RS2 A;  4L8A A;  3EFA A;  4MBU A;  1FY7 A;  1M4I A;  3W6S A;  1P0H A;  2ZW7 A;  5EC4 A;  3OWC A;  1U6M A;  4NEX A;  3SXO A;  1Q2C A;  4H6U A;  4AVC A;  1I21 A;  3B8G A;  1P4N A;  1S5K A;  3F8K A;  1VHS A;  3R96 A;  3JVN A;  4KOX A;  2PSW A;  3WR7 A;  1GHE A;  1Y9K A;  4H89 A;  2B4B A;  2GIV A;  1M4D A;  3R1K A;  3ZZI A;  3R9E A;  3D3S A;  4PK3 A;  4QVT A;  2CNS A;  1M4G A;  2JDD A;  4KOT A;  5DWM A;  2B4D B;  1S7K A;  3S6G A;  2Z10 A;  2WPW A;  3H4Q A;  2ZXV A;  2PC1 A;  1Q2D A;  4B5O A;  1Y9W A;  1UFH A;  4QB9 A;  3TO9 A;  4XPK A;  4HNX B;  4FD4 A;  4PV6 A;  2FCK A;  2FIW A;  2QML A;  4L89 A;  1KUX A;  3BJ7 A;  3RYO A;  4AVB A;  2VQY A;  3PZJ A;  1I12 A;  3IGR A;  2G3T A;  4KLV A;  2H5M A;  1QSO A;  3GYA A;  3I9S A;  3K9U A;  4OLL A;  2FL4 A;  4OAE A;  1RXT A;  1RO5 A;  1S7F A;  3TT2 A;  1NE9 A;  1K4J A;  1J4J A;  4GS4 A;  2K5T A;  4NXY A;  4HKF A;  2VEZ A;  2WPX A; 
#chains in the Genus database with same CATH topology
 2ZW4 A;  1DE4 C;  4IUS A;  5CBM A;  2Q7B A;  1ZLI A;  3IWG A;  2HB6 A;  1VHO A;  4JYW A;  4AB7 A;  4CYQ A;  2ZW5 A;  3D68 A;  5AGE A;  2PQ8 A;  1Q7L A;  2CNM A;  3D67 A;  3PB9 X;  3PP9 A;  3WC5 A;  4A31 A;  4BMH A;  3IFE A;  4CRY B;  3FXT A;  2PVW A;  3F5B A;  5F49 A;  2Z3K A;  3NE8 A;  4NGR A;  4F9V A;  1R43 A;  4ZGY B;  2B5G B;  4U5Y A;  5KTC A;  4U9Y A;  5K8O A;  2BSW A;  4UCP A;  4C7I A;  4W9Y A;  1VHE A;  3MN8 A;  3UY5 A;  4B12 A;  3FNC A;  2P0W A;  3MGD A;  1MJ9 A;  3I3G A;  1QSM A;  2PJ2 A;  4IHM A;  1LFW A;  4ONW A;  2C6G A;  4P4F A;  5LRJ A;  1YW6 A;  4NGN A;  1RTQ A;  5AG6 A;  4OAD A;  1CP6 A;  3G3S A;  2ZEM A;  3SI2 A;  3C26 A;  3BJ8 A;  4M85 A;  2BO9 A;  2R7H A;  4BD9 A;  1IIC A;  2PIY A;  4MY3 A;  4FUU A;  4X2T A;  4UFX A;  2BL1 A;  2QIR A;  4A39 A;  1Z2L A;  1Z8X A;  3CPA A;  5F46 A;  4UEE A;  3IU2 A;  2OR4 A;  2PJ1 A;  3TO6 A;  3PGP A;  1ZG9 A;  4QC6 A;  3T8W A;  5GCN A;  4KOW A;  3WC7 A;  3SXN A;  4CAF A;  2GAN A;  3PBB A;  3BI1 A;  1XMT A;  2C6P A;  2C6C A;  4AXV A;  5H84 A;  4KOS A;  2Z11 A;  1JQG A;  4B14 A;  2PJ8 A;  5JPH A;  3RO0 A;  1XRY A;  4NJQ A;  3V8I A;  3S9L A;  2D4P A;  3WAB A;  2CTC A;  2PR8 A;  3DGV A;  4KSI A;  4UFV A;  2GE3 A;  2P6G A;  1IID A;  4KSA A;  5F48 A;  2WZN A;  4UFW A;  1TF8 A;  2V8D A;  3B7I A;  1TKH A;  1XE4 A;  1CJW A;  2Q4V A;  4C2Z A;  3HUV A;  3PB8 X;  4AVA A;  1IOI A;  2ZW6 A;  5BWA B;  1M1D A;  2B3V A;  2IL4 A;  3TO7 A;  1WK4 A;  5D8N A;  2WUU A;  4F8Z A;  3IJ3 A;  4NFR A;  1CM0 A;  4C2X A;  5J8F A;  2J8R A;  2VXK A;  5AG4 A;  4ZX8 A;  2GU2 A;  2ZPA A;  4NGP A;  5CPA A;  3S6F A;  1R57 A;  2OU2 A;  4WWV A;  4IK2 A;  1YSJ A;  3PFE A;  3B35 A;  4OID A;  1XIX A;  4R3L A;  4U9Z A;  4AG7 A;  1AUG A;  3CPX A;  1A2Z A;  3B3V A;  3HLP A;  5LYI A;  5C88 A;  1IYK A;  2RC4 A;  4H6Z A;  4TWE A;  2F5I A;  2XEF A;  5AG5 A;  5DS0 A;  4B6Z A;  4CAX A;  4PSX A;  4UA3 A;  5KTD A;  3TE4 A;  1Z4R A;  1TIQ A;  1KZF A;  1S7N A;  4P4I A;  5HVF A;  3GKR A;  1IY7 A;  2KCW A;  2ABZ A;  2ATR A;  4ZY1 A;  3LOD A;  3QB8 A;  4RN7 A;  2BCO A;  1Z9U A;  3IIB A;  4M3S A;  1Y7R A;  4A32 A;  5C82 A;  4UBR A;  2HUZ A;  4TNU A;  3RBU A;  3FMC A;  4KVO E;  4CAW A;  2B3U A;  1I1D A;  4MY0 A;  2CTB A;  3R9G A;  1M44 A;  2VL1 A;  4NF1 A;  1X12 A;  3DSB A;  3NA6 A;  4UWJ A;  2R98 A;  2HV2 A;  2ODF A;  3A9L A;  2XEI A;  5A28 A;  3RAM A;  5I0C A;  3RNZ A;  5G22 A;  4MMO A;  3FIX A;  1KWM A;  4OC2 A;  4OC5 A;  5LYF A;  1V0C A;  3PEI A;  1CPX A;  2OZG A;  3H5Z A;  4MCQ A;  5HXD A;  4E2A A;  3D7H A;  3R9F A;  1PCA A;  1YLE A;  2O28 A;  3LAC A;  2J9A A;  2DF5 A;  4YRH A;  4A38 A;  2Z3P A;  4A2Z A;  2XEJ A;  2QJ8 A;  4PPZ A;  1NSL A;  3B3S A;  4P4B A;  2ZEE A;  1EE3 P;  2AFU A;  2PJ6 A;  2POK A;  3GUX A;  3ISZ A;  3TC8 A;  4KVM E;  3TOA A;  1TF9 A;  4LQ6 A;  2QYV A;  2JBJ A;  1CBX A;  2D4O A;  1Y0R A;  2AFX A;  2JDC A;  4EWT A;  4PQA A;  4ZBG A;  1LOK A;  1PYT B;  3PB6 X;  4P4E A;  1LRZ A;  1B87 A;  1NMT A;  3BLN A;  3D2P A;  4KOY A;  2G9D A;  3CXQ A;  3EO4 A;  4ORF A;  4PXB A;  2PRB A;  2QEC A;  2B58 A;  4R9M A;  2EVN A;  1L0C A;  4OKO A;  4MRI A;  4B11 A;  3KQZ A;  2YNC C;  2YND A;  1Z5R A;  3MRU A;  1BPM A;  4CGL A;  4M6G A;  4CYO A;  4MFJ A;  4OME A;  2JLM A;  4E8O A;  3CDX A;  2PJ3 A;  2ZOG A;  2Q0Y A;  1VGY A;  3EC4 A;  3VWE A;  3W6X A;  1XF8 A;  3NE7 A;  3H8F A;  4I49 A;  1MJB A;  4R57 A;  1VKC A;  3D66 A;  3LMS A;  3WC6 A;  4JLY A;  5HH1 A;  2EK8 A;  3D8P A;  2Z0Z A;  1CPS A;  5IB9 A;  3IWE A;  3K2K A;  1CX8 A;  1YK3 A;  4F9U A;  4Q36 A;  4MXU A;  4KOU A;  2DPT A;  3SI1 A;  3WT4 A;  4R87 A;  3BI0 A;  2ZOF A;  5IX3 A;  2PDO A;  4JWP A;  2EUI A;  1N71 A;  4Q7A A;  2NMT A;  8CPA A;  3JUW A;  4ZYQ A;  1QQ9 A;  4IF5 A;  3ZJ0 A;  2OOT A;  2G0B A;  2ZEF A;  4MCS A;  4YU9 A;  3CXS A;  5E96 A;  3GY9 A;  2R1I A;  1YVK A;  2BOA A;  2Q4Y A;  4AG9 A;  4B5P A;  4ZY0 A;  6CPA A;  2Q51 A;  1YX0 A;  1XEB A;  2C1C A;  4IAV A;  4JD6 A;  4A37 A;  1B6B A;  3S6K A;  1IU8 A;  5CNP A;  5J1Q A;  4MI4 A;  4B10 A;  2Q4Z A;  4C68 A;  1IYL A;  1ZO0 A;  4MFZ A;  5G1Z A;  3VAR A;  3K9T A;  2JEW A;  4MFL A;  3D2M A;  2R8V A;  4M6I A;  3CXP A;  1DTD A;  4F6A A;  4DNC A;  1YLO A;  3P2H A;  1PU9 A;  3F0A A;  4II9 A;  4QUS A;  2EWB A;  1H8L A;  2Z3M A;  4K3N A;  4CAE A;  1TKJ A;  3PFO A;  2P6E A;  2AFW A;  3DR8 A;  4EVY A;  1FNO A;  4HNW B;  5ELY A;  4A33 A;  4JZ0 A;  4X3R A;  3S9M A;  2G3A A;  3KZW A;  1S60 A;  4FAI A;  1KUY A;  2CIJ A;  3FH4 A;  1QSR A;  3FEE A;  2OB0 A;  3FB3 A;  4UWI A;  1ELL P;  3TTH A;  4PXC A;  1XOV A;  3S9N A;  2X7B A;  4XPL A;  2VZY A;  5EBV A;  1LAN A;  4CGP A;  4PSW A;  4XPD B;  3N7Z A;  1IGB A;  3IO1 A;  4CRZ B;  1MJA A;  4F0X A;  4KOR A;  4DYO A;  4CS0 B;  3IWW A;  1Y7E A;  2PJ7 A;  1GYT A;  3D7G A;  1ARL A;  3FBU A;  3DNS A;  2ZEL A;  2A4N A;  4MHY A;  2HQY A;  2P6F A;  1ZG7 A;  2FE7 A;  5HMN A;  3ISX A;  3NH8 A;  3LWU A;  4PXE A;  2FS5 A;  4JXQ A;  4UIA A;  4CGN A;  2C27 A;  1YME A;  1HEE A;  2ARH A;  2RB7 A;  1YQE A;  3FVL A;  3IC1 A;  4GM5 A;  4UCM A;  1TXR A;  2GLF A;  1LCP A;  1YR0 A;  5LYD A;  1YW4 A;  3GLJ A;  3FEC A;  1ARM A;  3NFZ A;  3SI0 A;  5FVJ A;  4UCN A;  4KZT A;  3TOB A;  4RUH A;  3V38 A;  3S6H A;  3FED A;  2AJ6 A;  2EK9 A;  3V7Z A;  1BOB A;  4R76 A;  4MCR A;  2OH1 A;  5IB0 A;  1YVO A;  2PJ5 A;  3NH4 A;  3FRM A;  3R95 A;  4CYP A;  2IMO A;  4FD7 A;  4Q38 A;  4ONU A;  2PE3 A;  1MK4 A;  4KUB A;  2CXA A;  4KLW A;  4OC3 A;  1BLL E;  1AYE A;  3NH5 A;  4EFD A;  1TKF A;  4MHD A;  2ZEN A;  3IU1 A;  3E0K A;  3FYN A;  1ON0 A;  2F7V A;  4FD6 A;  3PRT A;  4OC1 A;  2GRE A;  1Z4E A;  3RZA A;  2I79 A;  3KKW A;  4KOV A;  2BUE A;  2FIA A;  3KR5 A;  3P2F A;  3SJE A;  4CYN A;  2O53 A;  1KUV A;  3FF3 A;  5THW A;  2DXQ A;  3D7F A;  2PJA A;  4K30 A;  1QMU A;  3FJU A;  1QST A;  1Z8W A;  4YGO A;  1LAP A;  4CAV A;  3W91 A;  2B5G A;  4KUA A;  3D7D A;  2CY2 A;  3QAY A;  2PJ4 A;  3CZX A;  4XPD C;  1HDQ A;  2ZEP A;  5K8M A;  2AFZ A;  2DPS A;  1OBR A;  3SJX A;  2V8H A;  2OZU A;  4P4D A;  4A95 A;  3DR6 A;  4MHP A;  3EXN A;  1Z8T A;  2VBQ A;  4YFJ A;  5J8C A;  5ISV A;  2I00 A;  2AE6 A;  4KS9 A;  1YRE A;  4X8I A;  3TFY A;  3T90 A;  5F09 A;  3H8E A;  2FSR A;  4MCP A;  2FT0 A;  2REE A;  4GXH A;  4HNY B;  4QBJ A;  2J8N A;  2ZEH A;  2AFS A;  4A94 A;  3B3W A;  2PJ0 A;  4P45 A;  4LQG A;  3SHP A;  5JQ4 A;  3QAH A;  4OIW A;  2CF4 A;  3T9Y A;  2DEA A;  2YGW A;  2PR1 A;  3JRU A;  1ELM P;  2FXF A;  2VZZ A;  1BPN A;  1S3Z A;  4OC0 A;  2AFM A;  4P6Y A;  1QSN A;  4PK2 A;  4DUK A;  1OZP A;  4X5K A;  1CP7 A;  2Q44 A;  4RI1 A;  4J3G A;  1YGH A;  4B13 A;  2JBK A;  4KVX A;  3KGQ A;  1WWZ A;  2V77 A;  4KSF A;  3G8W A;  1Q2Y A;  4MJ8 A;  3EY5 A;  4XNH B;  1F2P A;  4R3K A;  2Y0M A;  2RFH A;  4LX9 A;  2JEV A;  4FD5 A;  2Q43 A;  4UIB A;  1PUA A;  2REF A;  4NGT A;  2Q04 A;  1XFO A;  2GFQ A;  3I1U A;  4R6T A;  4UEZ A;  4JJX A;  4C2Y A;  4F0Y A;  4B5P B;  1S7L A;  5F47 A;  2ZEG A;  3DDD A;  4XNH C;  2PJ9 A;  3TCV A;  3VH9 A;  1HDU A;  4H2K A;  1SQH A;  4E0A A;  1R3N A;  2J8M A;  1BO4 A;  2PVV A;  4Y49 B;  2HC9 A;  1X10 A;  4Z65 A;  2CNT A;  4JXR A;  2ZED A;  3DLJ A;  4MFP A;  2WSA A;  5KTA A;  3LD2 A;  4UEF A;  2F8H A;  2OZH A;  5H86 A;  4YWY A;  2VI7 A;  5IV0 A;  3PB4 X;  4NCZ A;  5LRK A;  3IEH A;  4Y49 C;  3VAT A;  4LUA A;  5DWN A;  2PJB A;  4NSQ A;  1NSA A;  2BEI A;  5K8N A;  1IB1 E;  1JWQ A;  1XBU A;  5JGF A;  4C7H A;  5D29 A;  3VWD A;  2B4D A;  4MFK A;  4MHZ A;  1FT7 A;  4RS2 A;  5A27 A;  4L8A A;  3EFA A;  2NYQ A;  5LYL A;  3BHX A;  4MBU A;  2PCU A;  7CPA A;  4FWU A;  1M4L A;  2Z3O A;  1FY7 A;  1M4I A;  4NGM A;  2FVG A;  3W6S A;  1P0H A;  2ZW7 A;  4OP4 A;  5EC4 A;  1BAV A;  3OWC A;  1U6M A;  1ZLH A;  2Z3N A;  4CGO A;  1ZG8 A;  3QNV A;  4NEX A;  3SXO A;  2PRQ A;  4HPS A;  1Q2C A;  4OC4 A;  2ZEO A;  4H6U A;  5K8P A;  4CPA A;  1F2O A;  4AVC A;  4NGQ A;  3KI9 A;  4NGS A;  1I21 A;  3B8G A;  1P4N A;  1S5K A;  5JH9 A;  3F8K A;  1VHS A;  2IJZ A;  3KQX A;  3R96 A;  3JVN A;  4KOX A;  5I4M A;  4R7M A;  2PSW A;  3WR7 A;  1GHE A;  1Y9K A;  3B3C A;  4PXD A;  4H89 A;  2B4B A;  2GIV A;  1M4D A;  3R1K A;  3ZZI A;  2QVP A;  3N5F A;  3R9E A;  3D3S A;  4PK3 A;  4QVT A;  2CNS A;  1M4G A;  5EMI A;  2JDD A;  4WJB A;  4KOT A;  5DWM A;  2IQ6 A;  3GB0 A;  2B4D B;  4MFQ A;  1S7K A;  2YNC A;  2Z10 A;  3KL9 A;  4O23 A;  3S6G A;  3KAS A;  4P4J A;  3H8G A;  2WPW A;  3H4Q A;  2ZXV A;  3SJF A;  4BBH A;  5G21 A;  4ZY2 A;  2PIZ A;  3GIU A;  2PC1 A;  1Q2D A;  4ZI6 A;  5AG7 A;  4MHN A;  2PJC A;  5G20 A;  4B5O A;  1F57 A;  2Q7S A;  1Y9W A;  1UFH A;  3B2Y A;  4QB9 A;  3TO9 A;  2V8V A;  1IOF A;  4XPK A;  5HVH A;  4HNX B;  2AFO A;  4FD4 A;  4PV6 A;  4EME A;  2FCK A;  1LAM A;  1Z8L A;  2WYR A;  2Z3L A;  3PB7 X;  4CGM A;  2FIW A;  2QML A;  3TX8 A;  3D4U A;  4L89 A;  1KUX A;  1CG2 A;  2I3C A;  3BJ7 A;  2XEG A;  3RYO A;  4AVB A;  2VQY A;  3JTK A;  3PZJ A;  1I12 A;  5LRG A;  1UWY A;  4A30 A;  3IGR A;  3KHX A;  2V8G A;  2G3T A;  3PBE A;  2ANP A;  3KHZ A;  4KLV A;  2H5M A;  1QSO A;  3BXM A;  3GYA A;  3I9S A;  2GLJ A;  3K9U A;  4G1P A;  3L2N A;  4NJR A;  5HVG A;  4P10 A;  3B3T A;  1XJO A;  1Y0Y A;  2EO8 A;  2YNE A;  4OLL A;  2FL4 A;  4OAE A;  4P44 A;  1RXT A;  1RO5 A;  1S7F A;  2EBJ A;  4R8F A;  4M6H A;  1NE9 A;  3TT2 A;  1XMB A;  2O4H A;  1AMP A;  3CT9 A;  4FBE A;  5JM6 A;  1K4J A;  1J4J A;  4GS4 A;  2K5T A;  4NXY A;  4HKF A;  2VEZ A;  2NSM A;  4ZX9 A;  4UF4 A;  3SJG A;  3FX6 A;  2WPX A;  4BIN A;  4DJL A;  1VIX A;  3KR4 A; 
#chains in the Genus database with same CATH homology
 2ZW4 A;  4IUS A;  2Q7B A;  3IWG A;  4AB7 A;  4CYQ A;  2ZW5 A;  5AGE A;  2PQ8 A;  2CNM A;  3PP9 A;  4A31 A;  4BMH A;  4CRY B;  3FXT A;  3F5B A;  5F49 A;  2Z3K A;  4ZGY B;  2B5G B;  4U5Y A;  5KTC A;  4U9Y A;  2BSW A;  4UCP A;  4C7I A;  4B12 A;  3UY5 A;  3FNC A;  2P0W A;  3MGD A;  1MJ9 A;  3I3G A;  1QSM A;  5AG6 A;  4OAD A;  3G3S A;  3C26 A;  3BJ8 A;  4M85 A;  2R7H A;  1IIC A;  4MY3 A;  4UFX A;  2BL1 A;  2QIR A;  5F46 A;  3IU2 A;  3TO6 A;  3PGP A;  4QC6 A;  4CAF A;  5GCN A;  4KOW A;  3SXN A;  2GAN A;  1XMT A;  5H84 A;  4KOS A;  2Z11 A;  4B14 A;  5JPH A;  3V8I A;  2D4P A;  2PR8 A;  4UFV A;  2GE3 A;  2P6G A;  1IID A;  4KSA A;  5F48 A;  4UFW A;  1XE4 A;  2Q4V A;  1CJW A;  4C2Z A;  4AVA A;  2ZW6 A;  5BWA B;  1M1D A;  2B3V A;  2IL4 A;  3TO7 A;  1WK4 A;  2WUU A;  1CM0 A;  4C2X A;  5J8F A;  2J8R A;  2VXK A;  5AG4 A;  2ZPA A;  3S6F A;  1R57 A;  2OU2 A;  4R3L A;  1XIX A;  4U9Z A;  4AG7 A;  5C88 A;  1IYK A;  2RC4 A;  4H6Z A;  2F5I A;  5AG5 A;  4CAX A;  4PSX A;  4UA3 A;  5KTD A;  3TE4 A;  1Z4R A;  1TIQ A;  1KZF A;  1S7N A;  3GKR A;  2KCW A;  2ATR A;  3LOD A;  3QB8 A;  1Z9U A;  4M3S A;  1Y7R A;  4A32 A;  5C82 A;  4UBR A;  2HUZ A;  4KVO E;  4CAW A;  2B3U A;  1I1D A;  4MY0 A;  3R9G A;  1M44 A;  4NF1 A;  3DSB A;  4UWJ A;  2R98 A;  2HV2 A;  3A9L A;  5A28 A;  5I0C A;  5G22 A;  3FIX A;  1V0C A;  2OZG A;  3H5Z A;  4E2A A;  3R9F A;  1YLE A;  2O28 A;  4YRH A;  2Z3P A;  4A2Z A;  1NSL A;  4KVM E;  3TOA A;  2D4O A;  2JDC A;  4ZBG A;  1LRZ A;  1B87 A;  1NMT A;  3BLN A;  3D2P A;  4KOY A;  3CXQ A;  3EO4 A;  4ORF A;  2PRB A;  2QEC A;  2B58 A;  4R9M A;  2EVN A;  1L0C A;  4B11 A;  2YNC C;  2YND A;  4CGL A;  4CYO A;  4MFJ A;  2JLM A;  4E8O A;  2Q0Y A;  3EC4 A;  3W6X A;  3VWE A;  1XF8 A;  3NE7 A;  4I49 A;  1MJB A;  4R57 A;  1VKC A;  4JLY A;  5HH1 A;  3D8P A;  2Z0Z A;  3IWE A;  1YK3 A;  4Q36 A;  4KOU A;  2DPT A;  4R87 A;  5IX3 A;  2PDO A;  4JWP A;  2EUI A;  1N71 A;  2NMT A;  3JUW A;  4IF5 A;  3ZJ0 A;  2G0B A;  5E96 A;  3CXS A;  3GY9 A;  2R1I A;  1YVK A;  2Q4Y A;  4AG9 A;  4B5P A;  1YX0 A;  1XEB A;  4JD6 A;  1B6B A;  3S6K A;  5CNP A;  4MI4 A;  4B10 A;  4C68 A;  1IYL A;  1ZO0 A;  4MFZ A;  5G1Z A;  4MFL A;  3D2M A;  2R8V A;  3CXP A;  4F6A A;  4DNC A;  3P2H A;  1PU9 A;  3F0A A;  4II9 A;  4QUS A;  2Z3M A;  4CAE A;  2P6E A;  3DR8 A;  4EVY A;  4HNW B;  4A33 A;  2G3A A;  1S60 A;  1KUY A;  3TTH A;  1QSR A;  4UWI A;  2OB0 A;  3FB3 A;  2X7B A;  4XPL A;  2VZY A;  5EBV A;  4CGP A;  4PSW A;  4XPD B;  3N7Z A;  4F0X A;  4CRZ B;  1MJA A;  4KOR A;  4CS0 B;  3FBU A;  3DNS A;  2A4N A;  2HQY A;  2P6F A;  2FE7 A;  5HMN A;  2FS5 A;  4JXQ A;  4CGN A;  2C27 A;  2ARH A;  4UCM A;  1YR0 A;  5FVJ A;  4UCN A;  4KZT A;  3TOB A;  3S6H A;  2AJ6 A;  1BOB A;  2OH1 A;  5IB0 A;  1YVO A;  3R95 A;  3FRM A;  4CYP A;  4FD7 A;  4Q38 A;  4ONU A;  4KUB A;  1MK4 A;  2CXA A;  4KLW A;  4MHD A;  3IU1 A;  3E0K A;  3FYN A;  1ON0 A;  4FD6 A;  1Z4E A;  4KOV A;  2I79 A;  3KKW A;  2BUE A;  2FIA A;  3P2F A;  4CYN A;  1KUV A;  2DXQ A;  4K30 A;  4YGO A;  1QST A;  4CAV A;  3W91 A;  2B5G A;  4KUA A;  2CY2 A;  4XPD C;  2DPS A;  2OZU A;  4A95 A;  3DR6 A;  5J8C A;  3EXN A;  2VBQ A;  4YFJ A;  5ISV A;  2I00 A;  4KS9 A;  2AE6 A;  1YRE A;  3TFY A;  3T90 A;  2FSR A;  2FT0 A;  2REE A;  4HNY B;  4QBJ A;  2J8N A;  3SHP A;  5JQ4 A;  3QAH A;  3T9Y A;  2YGW A;  2PR1 A;  2FXF A;  2VZZ A;  1S3Z A;  1QSN A;  4PK2 A;  1OZP A;  4X5K A;  2Q44 A;  4RI1 A;  4J3G A;  1YGH A;  4B13 A;  4KVX A;  1WWZ A;  4KSF A;  3G8W A;  1Q2Y A;  4MJ8 A;  3EY5 A;  4XNH B;  4R3K A;  2Y0M A;  4LX9 A;  2JEV A;  4FD5 A;  1PUA A;  2REF A;  2Q04 A;  4F0Y A;  4C2Y A;  4JJX A;  4B5P B;  1S7L A;  5F47 A;  3DDD A;  4XNH C;  3TCV A;  1SQH A;  4E0A A;  2J8M A;  1BO4 A;  4Y49 B;  2CNT A;  4JXR A;  4MFP A;  2WSA A;  5KTA A;  3LD2 A;  5H86 A;  2OZH A;  2VI7 A;  5IV0 A;  4NCZ A;  4Y49 C;  4LUA A;  5DWN A;  4NSQ A;  2BEI A;  1IB1 E;  4C7H A;  3VWD A;  2B4D A;  4MFK A;  4RS2 A;  5A27 A;  4L8A A;  3EFA A;  4MBU A;  2Z3O A;  1FY7 A;  1M4I A;  3W6S A;  1P0H A;  2ZW7 A;  5EC4 A;  3OWC A;  1U6M A;  2Z3N A;  4CGO A;  4NEX A;  3SXO A;  1Q2C A;  4H6U A;  4AVC A;  1I21 A;  3B8G A;  1P4N A;  1S5K A;  3F8K A;  1VHS A;  3R96 A;  3JVN A;  4KOX A;  2PSW A;  3WR7 A;  1GHE A;  1Y9K A;  4H89 A;  2B4B A;  2GIV A;  1M4D A;  3R1K A;  3ZZI A;  3R9E A;  3D3S A;  4PK3 A;  4QVT A;  2CNS A;  1M4G A;  2JDD A;  4KOT A;  5DWM A;  2B4D B;  4MFQ A;  1S7K A;  2YNC A;  2Z10 A;  3S6G A;  2WPW A;  3H4Q A;  2ZXV A;  4BBH A;  5G21 A;  2PC1 A;  1Q2D A;  5AG7 A;  5G20 A;  4B5O A;  1Y9W A;  1UFH A;  4QB9 A;  3TO9 A;  4XPK A;  4HNX B;  4FD4 A;  4PV6 A;  2FCK A;  2Z3L A;  4CGM A;  2FIW A;  2QML A;  4L89 A;  1KUX A;  3BJ7 A;  3RYO A;  4AVB A;  2VQY A;  3JTK A;  3PZJ A;  1I12 A;  4A30 A;  3IGR A;  2G3T A;  4KLV A;  2H5M A;  1QSO A;  3GYA A;  3I9S A;  3K9U A;  2YNE A;  4OLL A;  2FL4 A;  4OAE A;  1RXT A;  1RO5 A;  1S7F A;  3TT2 A;  1NE9 A;  1K4J A;  1J4J A;  4GS4 A;  2K5T A;  4NXY A;  4HKF A;  2VEZ A;  2WPX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...