1Y7RA

1.7 a crystal structure of protein of unknown function sa2161 from meticillin-resistant staphylococcus aureus, probable acetyltransferase
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
133
structure length
133
Chain Sequence
MVKVTYDIPTCEDYCALRINAGMSPKTREAAEKGLPNALFTVTLYDKDRLIGMGRVIGDGGTVFQIVDIAVLKSYQGQAYGSLIMEHIMKYIKNVSVESVYVSLIADYPADKLYVKFGFMPTEPDSGGMYIKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1.7A Crystal Structure of Hypothetical Protein SA2161 from Meticillin-Resistant Staphylococcus aureus
rcsb
molecule keywords hypothetical protein SA2161
molecule tags Structural genomics, unknown function
source organism Staphylococcus aureus
total genus 27
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13673 Acetyltransf_10 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1y7rA00
3R95A 5IX3A 5F47A 1N71A 3GKRA 4IF5A 5KTDA 2PR1A 2I00A 2G0BA 5H86A 4UWJA 2EUIA 4KVME 2R7HA 4E0AA 1CJWA 3FNCA 5KTCA 4XPDB 1KUXA 3H4QA 3D8PA 1KUYA 1S5KA 2J8NA 4B5OA 2ZPAA 1BO4A 2G3AA 1U6MA 2OZGA 3D3SA 3GY9A 3I3GA 3R1KA 5H84A 4B5PB 2O28A 4KOVA 4R3KA 2P6GA 3DR6A 1Q2YA 3TFYA 4NCZA 3JUWA 1M4IA 3EXNA 4FD5A 1Z9UA 2B58A 2P6EA 2AJ6A 4AVCA 2D4PA 3TO9A 1XF8A 4MBUA 1LRZA 1FY7A 3OWCA 4RS2A 3TE4A 4JD6A 4PV6A 1RXTA 1MK4A 4K30A 2PQ8A 2J8RA 4KUBA 3R96A 4YFJA 4QB9A 2Q4YA 1TIQA 1WK4A 4FD6A 1IB1E 2OU2A 3F8KA 3PP9A 4QUSA 1XE4A 2OB0A 4E2AA 1J4JA 2B3UA 2GANA 5DWMA 4DNCA 1M1DA 1XEBA 2ATRA 3CXSA 4NSQA 3D2MA 4XNHC 2Q4VA 3DR8A 4FD4A 4M85A 3C26A 3ZZIA 2OZUA 4H6ZA 2PC1A 4HNXB 1S7KA 3FRMA 1VKCA 1YR0A 2R1IA 4KOXA 4PSWA 2JEVA 2WPWA 2PSWA 4OADA 1M4GA 4XPKA 2ZXVA 2R98A 5HMNA 2HV2A 3S6HA 2Q44A 2C27A 3CXPA 1XMTA 3FB3A 2P0WA 3W91A 2F5IA 4RI1A 3MGDA 3JVNA 4GS4A 1PUAA 3TO6A 5I0CA 2NMTA 3DSBA 5F49A 1NE9A 2ARHA 4KOUA 3TCVA 1CM0A 1Q2CA 2PRBA 4JXQA 4KOSA 5KTAA 5ISVA 1I21A 2PR8A 4HKFA 3VWDA 1NSLA 4F0YA 2GIVA 2FSRA 3P2FA 2K5TA 1QSNA 2VXKA 3LD2A 1MJ9A 4AVAA 1I12A 2Q04A 2D4OA 1R57A 3S6GA 3FYNA 1NMTA 1IIDA 5J8FA 2QECA 4U9ZA 4AB7A 1P4NA 4JWPA 4XPDC 3R9EA 4L8AA 3F0AA 3ZJ0A 4KUAA 2FE7A 2ZW5A 1YX0A 4U9YA 5F46A 1M44A 4KVOE 2FIAA 3SXNA 3NE7A 4QBJA 2H5MA 2REEA 4JXRA 3FIXA 1YVOA 3P2HA 5J8CA 1Y7RA 1ON0A 3IWGA 1WWZA 4AG7A 1XIXA 2B4DA 1RO5A 1QSOA 4MY3A 5C88A 1YGHA 2VEZA 4KOWA 1QSMA 1SQHA 4YRHA 3TOBA 4NEXA 3BJ7A 5C82A 3EC4A 4HNYB 2A4NA 2J8MA 4II9A 1VHSA 3QAHA 3SHPA 4AG9A 2ZW6A 2B4BA 1UFHA 5F48A 5FVJA 1B6BA 2Q0YA 4HNWB 2OH1A 2Q7BA 1S7FA 2B5GA 2I79A 3PZJA 2BUEA 4B5PA 1B87A 2FIWA 5IV0A 1S7NA 4ZBGA 4KLWA 2JDCA 3F5BA 2HQYA 2QIRA 2BEIA 2Z10A 2VZYA 2WPXA 2BSWA 4R57A 2CNSA 4KOYA 4F6AA 2Y0MA 4M3SA 5DWNA 2VI7A 4ONUA 3SXOA 2ZW4A 3CXQA 4H89A 4MI4A 2VQYA 4KOTA 4XPLA 3T90A 4MHDA 4E8OA 4UA3A 1YK3A 4LX9A 3FXTA 4PK3A 2BL1A 4ORFA 2Z0ZA 4EVYA 2CY2A 4Y49C 3IGRA 4IUSA 4UWIA 3WR7A 2VBQA 2X7BA 2CNTA 4NXYA 1V0CA 3RYOA 4R3LA 3BJ8A 3K9UA 1KZFA 4KLVA 2FS5A 1YLEA 1Y9KA 2AE6A 1P0HA 3LODA 2B4DB 4MY0A 2OZHA 5GCNA 4J3GA 3TTHA 3B8GA 2PDOA 2VZZA 3GYAA 1QSRA 3R9GA 3TO7A 3TOAA 4KVXA 4CS0B 2B3VA 2ZW7A 4JJXA 1I1DA 3UY5A 1IYKA 3G8WA 3I9SA 4AVBA 4L89A 4YGOA 3EY5A 4FD7A 5JQ4A 2JLMA 1MJBA 1Z4RA 1BOBA 4R87A 1S7LA 2B5GB 2Z11A 4QVTA 2RC4A 4OLLA 2FL4A 2G3TA 3R9FA 3EO4A 1Q2DA 4QC6A 3S6KA 1Z4EA 4JLYA 4KZTA 3EFAA 3DDDA 5IB0A 1QSTA 3W6XA 3N7ZA 1S3ZA 3S6FA 2FXFA 4H6UA 1M4DA 1OZPA 2QMLA 5JPHA 1YREA 4LUAA 4PK2A 1KUVA 4MJ8A 5E96A 4NF1A 3D2PA 4BMHA 3QB8A 4XNHB 5HH1A 2EVNA 4PSXA 2GE3A 3V8IA 4R9MA 1PU9A 4CAWA 3VWEA 2IL4A 5CNPA 1Y9WA 4CRZB 2KCWA 3DNSA 3FBUA 2DXQA 2FT0A 2HUZA 2P6FA 4OAEA 1L0CA 2JDDA 3KKWA 4CRYB 4U5YA 1K4JA 3G3SA 4I49A 3T9YA 2FCKA 2CNMA 3PGPA 3TT2A 4X5KA 3BLNA 4Y49B 2REFA 1MJAA 4UBRA 4KORA 1IYLA 3W6SA 1YVKA 4CAXA 1IICA 5EC4A 1GHEA 4CAVA 2R8VA 5EBVA 1S60A 3E0KA
chains in the Genus database with same CATH superfamily
1F57A 3R95A 5K8MA 5IX3A 5F47A 1N71A 3GKRA 4MXUA 4IF5A 5KTDA 2PR1A 5D29A 2CXAA 2I00A 3CZXA 1X12A 1LANA 2G0BA 3NA6A 5H86A 4ONWA 4UWJA 3QAYA 2EUIA 4KVME 2R7HA 3CPAA 4MHZA 3BI0A 4P10A 1YW6A 5HVFA 4E0AA 1F2PA 4ZYQA 1CJWA 3FNCA 4OIDA 6CPAA 5KTCA 4XPDB 1KUXA 4WWVA 4OC4A 3H4QA 2CTCA 3D8PA 1KUYA 1Z5RA 1CX8A 2YNCC 1S5KA 2J8NA 4CYNA 3WABA 2GLFA 4B5OA 3GB0A 3PBEA 1LOKA 2ZPAA 2V8HA 1BO4A 2G3AA 3B3SA 4P4DA 4HPSA 1U6MA 4TWEA 2OZGA 2PJAA 3D3SA 3GY9A 3I3GA 3R1KA 5AG4A 5H84A 3FX6A 3N5FA 5I4MA 4B5PB 2O28A 3FEEA 4NJQA 4P45A 4MHPA 4CGNA 3B3TA 4KOVA 4GM5A 4R3KA 4CYQA 1ELLP 2P6GA 1TXRA 3DR6A 5ELYA 1Q2YA 3TFYA 5AGEA 1LFWA 3LACA 4Q38A 3K9TA 2PJ4A 2Z3NA 3DGVA 3IC1A 3JUWA 4NCZA 1M4IA 3EXNA 4FD5A 1Z9UA 2B58A 2P6EA 1ZG7A 1R43A 2AJ6A 4AVCA 2ZEHA 4MFJA 2D4PA 1CPSA 3TO9A 1ELMP 5LYDA 3FJUA 1XF8A 4MBUA 1LRZA 4DUKA 1FY7A 3OWCA 3NE8A 4RS2A 4NGSA 3TE4A 4JD6A 4KSAA 4PV6A 4OP4A 4OC2A 1RXTA 1MK4A 4K30A 2PQ8A 2BO9A 2J8RA 4KUBA 4ZY0A 3R96A 2NSMA 4F9VA 4YFJA 2HB6A 3B2YA 4QB9A 2Q4YA 4Q7AA 1TIQA 2IMOA 2GFQA 2C6PA 1WK4A 5J1QA 1IU8A 3V7ZA 4A37A 4UEFA 4FD6A 1IB1E 2OU2A 3F8KA 3K2KA 3PP9A 4QUSA 1LAMA 1XE4A 1XMBA 2OB0A 4MFQA 4CYOA 4X3RA 4M6HA 3B3VA 5AG5A 4BBHA 3CT9A 1J4JA 1Y0YA 2B3UA 2GANA 5DWMA 1M1DA 1XEBA 2ATRA 3CXSA 3IWWA 4NSQA 4DNCA 2JBJA 4FAIA 3D2MA 1Z2LA 4XNHC 5A27A 2Q4VA 3DR8A 4FD4A 3PFOA 4M85A 2PE3A 5LRKA 3C26A 3ZZIA 3B3CA 2OZUA 1YSJA 4H6ZA 2IJZA 5IB9A 2PC1A 4HNXB 2ZEMA 5AG7A 1S7KA 4JZ0A 3FRMA 4UCMA 4MCQA 1VKCA 1PCAA 2C1CA 1YR0A 2R1IA 2CIJA 4KOXA 2V8VA 1YLOA 4PSWA 2JEVA 1TKJA 4OKOA 4A39A 2WPWA 2PSWA 4OADA 1ZG8A 3KR4A 4CGLA 1M4GA 2ZEPA 4XPKA 3PEIA 2PVWA 2Z3PA 2ZXVA 2R98A 2YNEA 4NGMA 7CPAA 2ODFA 2HV2A 4OC0A 3S6HA 2Q44A 5HMNA 3NFZA 2C27A 1ZO0A 5F09A 3CXPA 1DTDA 4P4FA 2PCUA 1XMTA 3FB3A 2POKA 4NGQA 2P0WA 1QMUA 5CBMA 4A94A 3W91A 3VARA 4B12A 2F5IA 3IJ3A 4P6YA 4RI1A 2JBKA 3KZWA 3MGDA 4OC3A 4P4IA 3JVNA 4CAFA 4DJLA 4GS4A 1PUAA 3FEDA 3SJGA 1IOFA 4PXEA 2PJ2A 3TO6A 5I0CA 1BPMA 2NMTA 3DSBA 3LMSA 2PJCA 5F49A 1NE9A 3VATA 2ARHA 4KOUA 3TCVA 4C7HA 1CM0A 1Q2CA 2PRBA 1ZG9A 3KR5A 4JXQA 4KOSA 5KTAA 4E2AA 4MCSA 4KS9A 4P44A 1RTQA 2XEGA 5ISVA 1I21A 3H5ZA 4LQ6A 2ZEDA 4A30A 1CG2A 2PR8A 4MFZA 1XRYA 4HKFA 1F2OA 1HDUA 1YW4A 3FECA 1NSLA 3VWDA 2ZEEA 3KGQA 4F0YA 2O4HA 1IOIA 2FSRA 2GIVA 3P2FA 4NJRA 4UIAA 2K5TA 1QSNA 2VXKA 3LD2A 4YU9A 4ZY1A 1MJ9A 3GIUA 1I12A 3H8FA 3BI1A 2Q04A 4OIWA 4AVAA 2D4OA 1R57A 5LYFA 2ZOGA 5LYIA 3S6GA 4OMEA 3FYNA 4X2TA 1NMTA 1IIDA 2V77A 5J8FA 2PIZA 2QECA 4U9ZA 4UIBA 5AG6A 4AB7A 1P4NA 2DPTA 4JWPA 2GREA 4XPDC 3R9EA 4L8AA 4R6TA 3F0AA 1CBXA 4W9YA 1KWMA 3ZJ0A 4BINA 3KQXA 4KUAA 2FE7A 2ZW5A 1YX0A 1XOVA 2G9DA 4U9YA 3IO1A 3TX8A 2AFSA 2ZENA 5F46A 1M44A 3D7HA 2NYQA 4KVOE 1YMEA 2FIAA 5THWA 3SXNA 3WC6A 3NE7A 4QBJA 4C2XA 2H5MA 2REEA 2YNDA 4JXRA 2J9AA 3FIXA 1YVOA 3P2HA 5J8CA 1Y7RA 1ON0A 1TKFA 1VHOA 3IWGA 1VIXA 1WWZA 4AG7A 1XIXA 2B4DA 4UEZA 1RO5A 1CPXA 1QSOA 4MY3A 4EFDA 4PQAA 3S9MA 2DPSA 4JYWA 5C88A 2WZNA 1BPNA 1YGHA 5LYLA 1X10A 2VEZA 1LAPA 2Q51A 2C6CA 4B11A 1Y0RA 1LCPA 4KOWA 3B7IA 1QSMA 1SQHA 4MCRA 4YRHA 2YNCA 4X8IA 3TOBA 4ZI6A 3H8GA 4NEXA 3BJ7A 2XEFA 4MCPA 3GUXA 3EC4A 5C82A 4HNYB 1GYTA 2A4NA 1TF9A 2J8MA 1DE4C 4II9A 1VHSA 4MHNA 3QAHA 3SHPA 4AG9A 4C7IA 4C2YA 2ZW6A 1VGYA 2B4BA 4IK2A 1UFHA 4IHMA 4MFLA 3FF3A 5F48A 3RO0A 5FVJA 1B6BA 2CTBA 3BXMA 5JGFA 5LRGA 4KSIA 1XJOA 2Q0YA 3CPXA 4DYOA 4HNWB 2OH1A 2PIYA 2PJ7A 2Q7BA 4EWTA 4F0XA 1HDQA 1EE3P 1S7FA 3NH4A 2B5GA 2I79A 4H2KA 3PZJA 2BUEA 4B5PA 1B87A 4UEEA 2FIWA 3S9NA 1FNOA 5IV0A 1S7NA 1Z8XA 4M6IA 1AMPA 3DLJA 2Z3MA 4KLWA 2JDCA 4ZBGA 3F5BA 4F9UA 2HQYA 4ZGYB 3BHXA 2QIRA 4P4BA 3V38A 2C6GA 1CP6A 2BEIA 2Z10A 2VZYA 2EBJA 2PJ3A 2WPXA 4F8ZA 2BSWA 2PJ6A 4MFPA 2CNSA 3ISZA 4KOYA 4R57A 4PXBA 3MN8A 4YWYA 4F6AA 2Y0MA 4M3SA 5DWNA 3SI1A 2ANPA 2VI7A 3GLJA 4ONUA 3SXOA 2ZW4A 3CXQA 4H89A 2XEJA 4AXVA 4MI4A 2VQYA 2PJBA 4KOTA 4NGTA 4A95A 1AUGA 2PVVA 4XPLA 3SJFA 3T90A 4MHDA 2ZEFA 4BD9A 2ZELA 1Y7EA 3KL9A 4KSFA 4E8OA 4UA3A 4O23A 2WSAA 1YK3A 4R7MA 1R3NA 1UWYA 4LX9A 3FXTA 3IFEA 4PK3A 3PB8X 2BL1A 4ORFA 3D7FA 2OOTA 2Z0ZA 4EVYA 3IEHA 3IU1A 2EO8A 3D66A 2CY2A 2PJ1A 2Q43A 2YGWA 2Z3OA 4Y49C 3IGRA 4IUSA 4UWIA 4RN7A 1XBUA 3WR7A 5JH9A 2VBQA 2OR4A 1CP7A 2X7BA 2CNTA 4NXYA 1V0CA 2QVPA 1M4LA 3PRTA 2JEWA 2AFUA 3BJ8A 3K9UA 2ABZA 2AFMA 2QYVA 4R3LA 4P4JA 3SJXA 1KZFA 2Z3KA 4KLVA 2FS5A 3RNZA 1YLEA 1Y9KA 1Z8TA 4CPAA 2AE6A 2EK9A 1P0HA 2XEIA 5HXDA 4FBEA 2Q7SA 3LODA 2AFZA 2B4DB 4MY0A 4R76A 2OZHA 5GCNA 3PB9X 1BAVA 3IU2A 4J3GA 3TTHA 3B8GA 4CYPA 1AYEA 2QJ8A 4LQGA 4FWUA 2PDOA 3D68A 2VZZA 3GYAA 3CDXA 3NH5A 1QSRA 4B13A 3R9GA 3I1UA 3PB6X 5G1ZA 5K8NA 4NGRA 3TO7A 3TOAA 4KVXA 2DEAA 4CS0B 2B3VA 4NFRA 2ZW7A 2GLJA 4ZX8A 4A32A 2BCOA 4JJXA 4A31A 2WUUA 1I1DA 3UY5A 3LWUA 3SI2A 4OC5A 4CAEA 1IYKA 3G8WA 3I9SA 1HEEA 2PJ5A 3KI9A 4L89A 1TF8A 4A2ZA 4YGOA 3IWEA 3EY5A 4AVBA 5K8OA 1PYTB 3B3WA 2BOAA 3RYOA 4FD7A 5JQ4A 3JRUA 2JLMA 3FVLA 3A9LA 1MJBA 1Z4RA 1BOBA 4R87A 4WJBA 1S7LA 2B5GB 4UFVA 4ZY2A 2ZEGA 2Z11A 3SI0A 1VHEA 4QVTA 2F7VA 2RC4A 4OLLA 3WT4A 2ZEOA 2FL4A 2O53A 5G22A 1FT7A 3KHXA 5CPAA 2G3TA 3R9FA 3EO4A 2F8HA 1Q2DA 4QC6A 4P4EA 3S6KA 1Z4EA 4JLYA 3JTKA 4KZTA 5D8NA 1OBRA 4PPZA 2ZOFA 1Q7LA 3EFAA 2PJ9A 2HC9A 4CGMA 4R8FA 3DDDA 3PFEA 5IB0A 4B14A 2Z3LA 1QQ9A 4G1PA 1QSTA 3W6XA 3D4UA 3HUVA 3N7ZA 4NGNA 1S3ZA 3S6FA 5BWAB 4MFKA 1BLLE 1IGBA 2FXFA 3PBBA 4FUUA 4H6UA 1M4DA 1OZPA 4NGPA 3SJEA 3B35A 2QMLA 5JPHA 3L2NA 3RBUA 3RZAA 1A2ZA 1YREA 3PB7X 3D7GA 1IY7A 3WC7A 4K3NA 2EWBA 3KQZA 1NSAA 3HLPA 4LUAA 4M6GA 4PK2A 5DS0A 4IAVA 1KUVA 4MJ8A 3T8WA 5E96A 5HVHA 1ARMA 2VL1A 4NF1A 3D2PA 8CPAA 4OC1A 4BMHA 3QB8A 4MRIA 4XNHB 5HH1A 2EVNA 4PSXA 3RAMA 1ARLA 2GE3A 4B10A 4C2ZA 3V8IA 1Z8LA 2I3CA 1XFOA 4R9MA 1PU9A 4CAWA 3VWEA 4MHYA 2DF5A 2IL4A 4PXCA 5CNPA 2PRQA 1Y9WA 2EK8A 2PJ8A 2RFHA 4PXDA 4A38A 4CRZB 2KCWA 3DNSA 3FBUA 5G20A 3WC5A 4Q36A 3PB4X 2DXQA 3FH4A 3TC8A 2FT0A 4UCPA 2HUZA 2P6FA 4UFXA 1H8LA 3D7DA 3QNVA 4B6ZA 3MRUA 4OAEA 4CGOA 3IIBA 2CF4A 5HVGA 4MMOA 1L0CA 3KASA 5LRJA 2WYRA 4Z65A 2JDDA 3KHZA 3KKWA 4ZX9A 4CGPA 4CRYB 4U5YA 1K4JA 2PJ0A 3G3SA 2AFWA 3VH9A 3NH8A 5A28A 4I49A 3T9YA 2FCKA 1ZLHA 1ZLIA 2RB7A 2CNMA 3PGPA 3TT2A 4UCNA 3FMCA 1YQEA 1JWQA 4X5KA 4UF4A 4EMEA 3BLNA 3ISXA 4Y49B 2AFXA 1JQGA 2REFA 1MJAA 4UBRA 5K8PA 3H8EA 1TKHA 5G21A 4KORA 4C68A 2AFOA 2FVGA 2GU2A 1IYLA 3W6SA 4UFWA 1Z8WA 4A33A 1YVKA 2V8GA 4CAXA 2IQ6A 3S9LA 1IICA 5EC4A 4TNUA 1GHEA 2V8DA 4RUHA 5EMIA 4CAVA 5JM6A 2R8VA 5EBVA 1S60A 3E0KA 3D67A 4GXHA 2Q4ZA
chains in the Genus database with same CATH topology
3R95A 5IX3A 5F47A 1N71A 3GKRA 4IF5A 5KTDA 2PR1A 2CXAA 2I00A 2G0BA 5H86A 4UWJA 2EUIA 4KVME 2R7HA 4E0AA 1CJWA 3FNCA 5KTCA 4XPDB 1KUXA 3H4QA 3D8PA 1KUYA 2YNCC 1S5KA 2J8NA 4CYNA 4B5OA 2ZPAA 1BO4A 2G3AA 1U6MA 2OZGA 3D3SA 3GY9A 3I3GA 3R1KA 5AG4A 5H84A 4B5PB 2O28A 4CGNA 4KOVA 4R3KA 4CYQA 2P6GA 3DR6A 1Q2YA 3TFYA 5AGEA 4Q38A 2Z3NA 4NCZA 3JUWA 1M4IA 3EXNA 4FD5A 1Z9UA 2B58A 2P6EA 2AJ6A 4AVCA 4MFJA 2D4PA 3TO9A 1XF8A 4MBUA 1LRZA 1FY7A 3OWCA 4RS2A 3TE4A 4JD6A 4KSAA 4PV6A 1RXTA 1MK4A 4K30A 2PQ8A 2J8RA 4KUBA 3R96A 4YFJA 4QB9A 2Q4YA 1TIQA 1WK4A 4FD6A 1IB1E 2OU2A 3F8KA 3PP9A 4QUSA 1XE4A 2OB0A 4MFQA 4CYOA 5AG5A 4BBHA 4E2AA 1J4JA 2B3UA 2GANA 5DWMA 4DNCA 1M1DA 1XEBA 2ATRA 3CXSA 4NSQA 3D2MA 4XNHC 5A27A 2Q4VA 3DR8A 4FD4A 4M85A 3C26A 3ZZIA 2OZUA 4H6ZA 2PC1A 4HNXB 5AG7A 1S7KA 4UCMA 3FRMA 1VKCA 1YR0A 2R1IA 4KOXA 4PSWA 2JEVA 2WPWA 2PSWA 4OADA 4CGLA 1M4GA 4XPKA 2Z3PA 2ZXVA 2R98A 2YNEA 5HMNA 2HV2A 3S6HA 2Q44A 2C27A 1ZO0A 3CXPA 1XMTA 3FB3A 2P0WA 3W91A 4B12A 2F5IA 4RI1A 3MGDA 3JVNA 4CAFA 4GS4A 1PUAA 3TO6A 5I0CA 2NMTA 3DSBA 5F49A 1NE9A 2ARHA 4KOUA 3TCVA 4C7HA 1CM0A 1Q2CA 2PRBA 4JXQA 4KOSA 5KTAA 4KS9A 5ISVA 1I21A 3H5ZA 4A30A 2PR8A 4MFZA 4HKFA 3VWDA 1NSLA 4F0YA 2GIVA 2FSRA 3P2FA 2K5TA 1QSNA 2VXKA 3LD2A 1MJ9A 4AVAA 1I12A 2Q04A 2D4OA 1R57A 3S6GA 3FYNA 1NMTA 1IIDA 5J8FA 2QECA 4U9ZA 4AB7A 5AG6A 1P4NA 2DPTA 4JWPA 4XPDC 3R9EA 4L8AA 3F0AA 3ZJ0A 4KUAA 2FE7A 2ZW5A 1YX0A 4U9YA 5F46A 1M44A 4KVOE 2FIAA 3SXNA 3NE7A 4QBJA 4C2XA 2H5MA 2REEA 2YNDA 4JXRA 3FIXA 1YVOA 3P2HA 5J8CA 1Y7RA 1ON0A 3IWGA 1WWZA 4AG7A 1XIXA 2B4DA 1RO5A 1QSOA 4MY3A 2DPSA 5C88A 1YGHA 2VEZA 4B11A 4KOWA 1QSMA 1SQHA 4YRHA 3TOBA 2YNCA 4NEXA 3BJ7A 5C82A 3EC4A 4HNYB 2A4NA 2J8MA 4II9A 1VHSA 3QAHA 3SHPA 4AG9A 4C7IA 4C2YA 2ZW6A 2B4BA 1UFHA 4MFLA 5F48A 5FVJA 1B6BA 2Q0YA 4HNWB 2OH1A 2Q7BA 4F0XA 1S7FA 2B5GA 2I79A 3PZJA 2BUEA 4B5PA 1B87A 2FIWA 5IV0A 1S7NA 2Z3MA 4KLWA 2JDCA 4ZBGA 3F5BA 2HQYA 4ZGYB 2QIRA 2BEIA 2Z10A 2VZYA 2WPXA 2BSWA 4MFPA 4R57A 2CNSA 4KOYA 4F6AA 2Y0MA 4M3SA 5DWNA 2VI7A 4ONUA 3SXOA 2ZW4A 3CXQA 4H89A 4MI4A 2VQYA 4A95A 4KOTA 4XPLA 3T90A 4MHDA 4KSFA 4E8OA 4UA3A 2WSAA 1YK3A 4LX9A 3FXTA 4PK3A 2BL1A 4ORFA 2Z0ZA 4EVYA 3IU1A 2CY2A 2YGWA 2Z3OA 4Y49C 3IGRA 4IUSA 4UWIA 3WR7A 2VBQA 2X7BA 2CNTA 4NXYA 1V0CA 3RYOA 4R3LA 3BJ8A 3K9UA 1KZFA 2Z3KA 4KLVA 2FS5A 1YLEA 1Y9KA 2AE6A 1P0HA 3LODA 2B4DB 4MY0A 2OZHA 5GCNA 3IU2A 4J3GA 3TTHA 3B8GA 4CYPA 2PDOA 2VZZA 3GYAA 1QSRA 4B13A 3R9GA 5G1ZA 3TO7A 3TOAA 4KVXA 4CS0B 2B3VA 2ZW7A 4A32A 4JJXA 4A31A 2WUUA 1I1DA 3UY5A 4CAEA 1IYKA 3G8WA 3I9SA 4AVBA 4L89A 4A2ZA 4YGOA 3IWEA 3EY5A 4FD7A 5JQ4A 2JLMA 3A9LA 1MJBA 1Z4RA 1BOBA 4R87A 1S7LA 2B5GB 4UFVA 2Z11A 4QVTA 2RC4A 4OLLA 2FL4A 5G22A 2G3TA 3R9FA 3EO4A 1Q2DA 4QC6A 3S6KA 1Z4EA 4JLYA 3JTKA 4KZTA 3EFAA 4CGMA 3DDDA 5IB0A 4B14A 2Z3LA 1QSTA 3W6XA 3N7ZA 1S3ZA 3S6FA 5BWAB 4MFKA 2FXFA 4H6UA 1M4DA 1OZPA 2QMLA 5JPHA 1YREA 4LUAA 4PK2A 1KUVA 4MJ8A 5E96A 4NF1A 3D2PA 4BMHA 3QB8A 4XNHB 5HH1A 2EVNA 4PSXA 2GE3A 4B10A 4C2ZA 3V8IA 4R9MA 1PU9A 4CAWA 3VWEA 2IL4A 5CNPA 1Y9WA 4CRZB 2KCWA 3DNSA 3FBUA 5G20A 4Q36A 2DXQA 2FT0A 4UCPA 2HUZA 2P6FA 4UFXA 4OAEA 4CGOA 1L0CA 2JDDA 3KKWA 4CGPA 4CRYB 4U5YA 1K4JA 3G3SA 5A28A 4I49A 3T9YA 2FCKA 2CNMA 3PGPA 3TT2A 4UCNA 4X5KA 3BLNA 4Y49B 2REFA 1MJAA 4UBRA 5G21A 4KORA 4C68A 1IYLA 3W6SA 4UFWA 4A33A 1YVKA 4CAXA 1IICA 5EC4A 1GHEA 4CAVA 2R8VA 5EBVA 1S60A 3E0KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R95 A;  5IX3 A;  5F47 A;  1N71 A;  3GKR A;  4IF5 A;  5KTD A;  2PR1 A;  2I00 A;  2G0B A;  5H86 A;  4UWJ A;  2EUI A;  4KVM E;  2R7H A;  4E0A A;  1CJW A;  3FNC A;  5KTC A;  4XPD B;  1KUX A;  3H4Q A;  3D8P A;  1KUY A;  1S5K A;  2J8N A;  4B5O A;  2ZPA A;  1BO4 A;  2G3A A;  1U6M A;  2OZG A;  3D3S A;  3GY9 A;  3I3G A;  3R1K A;  5H84 A;  4B5P B;  2O28 A;  4KOV A;  4R3K A;  2P6G A;  3DR6 A;  1Q2Y A;  3TFY A;  4NCZ A;  3JUW A;  1M4I A;  3EXN A;  4FD5 A;  1Z9U A;  2B58 A;  2P6E A;  2AJ6 A;  4AVC A;  2D4P A;  3TO9 A;  1XF8 A;  4MBU A;  1LRZ A;  1FY7 A;  3OWC A;  4RS2 A;  3TE4 A;  4JD6 A;  4PV6 A;  1RXT A;  1MK4 A;  4K30 A;  2PQ8 A;  2J8R A;  4KUB A;  3R96 A;  4YFJ A;  4QB9 A;  2Q4Y A;  1TIQ A;  1WK4 A;  4FD6 A;  1IB1 E;  2OU2 A;  3F8K A;  3PP9 A;  4QUS A;  1XE4 A;  2OB0 A;  4E2A A;  1J4J A;  2B3U A;  2GAN A;  5DWM A;  4DNC A;  1M1D A;  1XEB A;  2ATR A;  3CXS A;  4NSQ A;  3D2M A;  4XNH C;  2Q4V A;  3DR8 A;  4FD4 A;  4M85 A;  3C26 A;  3ZZI A;  2OZU A;  4H6Z A;  2PC1 A;  4HNX B;  1S7K A;  3FRM A;  1VKC A;  1YR0 A;  2R1I A;  4KOX A;  4PSW A;  2JEV A;  2WPW A;  2PSW A;  4OAD A;  1M4G A;  4XPK A;  2ZXV A;  2R98 A;  5HMN A;  2HV2 A;  3S6H A;  2Q44 A;  2C27 A;  3CXP A;  1XMT A;  3FB3 A;  2P0W A;  3W91 A;  2F5I A;  4RI1 A;  3MGD A;  3JVN A;  4GS4 A;  1PUA A;  3TO6 A;  5I0C A;  2NMT A;  3DSB A;  5F49 A;  1NE9 A;  2ARH A;  4KOU A;  3TCV A;  1CM0 A;  1Q2C A;  2PRB A;  4JXQ A;  4KOS A;  5KTA A;  5ISV A;  1I21 A;  2PR8 A;  4HKF A;  3VWD A;  1NSL A;  4F0Y A;  2GIV A;  2FSR A;  3P2F A;  2K5T A;  1QSN A;  2VXK A;  3LD2 A;  1MJ9 A;  4AVA A;  1I12 A;  2Q04 A;  2D4O A;  1R57 A;  3S6G A;  3FYN A;  1NMT A;  1IID A;  5J8F A;  2QEC A;  4U9Z A;  4AB7 A;  1P4N A;  4JWP A;  4XPD C;  3R9E A;  4L8A A;  3F0A A;  3ZJ0 A;  4KUA A;  2FE7 A;  2ZW5 A;  1YX0 A;  4U9Y A;  5F46 A;  1M44 A;  4KVO E;  2FIA A;  3SXN A;  3NE7 A;  4QBJ A;  2H5M A;  2REE A;  4JXR A;  3FIX A;  1YVO A;  3P2H A;  5J8C A;  1Y7R A;  1ON0 A;  3IWG A;  1WWZ A;  4AG7 A;  1XIX A;  2B4D A;  1RO5 A;  1QSO A;  4MY3 A;  5C88 A;  1YGH A;  2VEZ A;  4KOW A;  1QSM A;  1SQH A;  4YRH A;  3TOB A;  4NEX A;  3BJ7 A;  5C82 A;  3EC4 A;  4HNY B;  2A4N A;  2J8M A;  4II9 A;  1VHS A;  3QAH A;  3SHP A;  4AG9 A;  2ZW6 A;  2B4B A;  1UFH A;  5F48 A;  5FVJ A;  1B6B A;  2Q0Y A;  4HNW B;  2OH1 A;  2Q7B A;  1S7F A;  2B5G A;  2I79 A;  3PZJ A;  2BUE A;  4B5P A;  1B87 A;  2FIW A;  5IV0 A;  1S7N A;  4ZBG A;  4KLW A;  2JDC A;  3F5B A;  2HQY A;  2QIR A;  2BEI A;  2Z10 A;  2VZY A;  2WPX A;  2BSW A;  4R57 A;  2CNS A;  4KOY A;  4F6A A;  2Y0M A;  4M3S A;  5DWN A;  2VI7 A;  4ONU A;  3SXO A;  2ZW4 A;  3CXQ A;  4H89 A;  4MI4 A;  2VQY A;  4KOT A;  4XPL A;  3T90 A;  4MHD A;  4E8O A;  4UA3 A;  1YK3 A;  4LX9 A;  3FXT A;  4PK3 A;  2BL1 A;  4ORF A;  2Z0Z A;  4EVY A;  2CY2 A;  4Y49 C;  3IGR A;  4IUS A;  4UWI A;  3WR7 A;  2VBQ A;  2X7B A;  2CNT A;  4NXY A;  1V0C A;  3RYO A;  4R3L A;  3BJ8 A;  3K9U A;  1KZF A;  4KLV A;  2FS5 A;  1YLE A;  1Y9K A;  2AE6 A;  1P0H A;  3LOD A;  2B4D B;  4MY0 A;  2OZH A;  5GCN A;  4J3G A;  3TTH A;  3B8G A;  2PDO A;  2VZZ A;  3GYA A;  1QSR A;  3R9G A;  3TO7 A;  3TOA A;  4KVX A;  4CS0 B;  2B3V A;  2ZW7 A;  4JJX A;  1I1D A;  3UY5 A;  1IYK A;  3G8W A;  3I9S A;  4AVB A;  4L89 A;  4YGO A;  3EY5 A;  4FD7 A;  5JQ4 A;  2JLM A;  1MJB A;  1Z4R A;  1BOB A;  4R87 A;  1S7L A;  2B5G B;  2Z11 A;  4QVT A;  2RC4 A;  4OLL A;  2FL4 A;  2G3T A;  3R9F A;  3EO4 A;  1Q2D A;  4QC6 A;  3S6K A;  1Z4E A;  4JLY A;  4KZT A;  3EFA A;  3DDD A;  5IB0 A;  1QST A;  3W6X A;  3N7Z A;  1S3Z A;  3S6F A;  2FXF A;  4H6U A;  1M4D A;  1OZP A;  2QML A;  5JPH A;  1YRE A;  4LUA A;  4PK2 A;  1KUV A;  4MJ8 A;  5E96 A;  4NF1 A;  3D2P A;  4BMH A;  3QB8 A;  4XNH B;  5HH1 A;  2EVN A;  4PSX A;  2GE3 A;  3V8I A;  4R9M A;  1PU9 A;  4CAW A;  3VWE A;  2IL4 A;  5CNP A;  1Y9W A;  4CRZ B;  2KCW A;  3DNS A;  3FBU A;  2DXQ A;  2FT0 A;  2HUZ A;  2P6F A;  4OAE A;  1L0C A;  2JDD A;  3KKW A;  4CRY B;  4U5Y A;  1K4J A;  3G3S A;  4I49 A;  3T9Y A;  2FCK A;  2CNM A;  3PGP A;  3TT2 A;  4X5K A;  3BLN A;  4Y49 B;  2REF A;  1MJA A;  4UBR A;  4KOR A;  1IYL A;  3W6S A;  1YVK A;  4CAX A;  1IIC A;  5EC4 A;  1GHE A;  4CAV A;  2R8V A;  5EBV A;  1S60 A;  3E0K A; 
#chains in the Genus database with same CATH topology
 1F57 A;  3R95 A;  5K8M A;  5IX3 A;  5F47 A;  1N71 A;  3GKR A;  4MXU A;  4IF5 A;  5KTD A;  2PR1 A;  5D29 A;  2CXA A;  2I00 A;  3CZX A;  1X12 A;  1LAN A;  2G0B A;  3NA6 A;  5H86 A;  4ONW A;  4UWJ A;  3QAY A;  2EUI A;  4KVM E;  2R7H A;  3CPA A;  4MHZ A;  3BI0 A;  4P10 A;  1YW6 A;  5HVF A;  4E0A A;  1F2P A;  4ZYQ A;  1CJW A;  3FNC A;  4OID A;  6CPA A;  5KTC A;  4XPD B;  1KUX A;  4WWV A;  4OC4 A;  3H4Q A;  2CTC A;  3D8P A;  1KUY A;  1Z5R A;  1CX8 A;  2YNC C;  1S5K A;  2J8N A;  4CYN A;  3WAB A;  2GLF A;  4B5O A;  3GB0 A;  3PBE A;  1LOK A;  2ZPA A;  2V8H A;  1BO4 A;  2G3A A;  3B3S A;  4P4D A;  4HPS A;  1U6M A;  4TWE A;  2OZG A;  2PJA A;  3D3S A;  3GY9 A;  3I3G A;  3R1K A;  5AG4 A;  5H84 A;  3FX6 A;  3N5F A;  5I4M A;  4B5P B;  2O28 A;  3FEE A;  4NJQ A;  4P45 A;  4MHP A;  4CGN A;  3B3T A;  4KOV A;  4GM5 A;  4R3K A;  4CYQ A;  1ELL P;  2P6G A;  1TXR A;  3DR6 A;  5ELY A;  1Q2Y A;  3TFY A;  5AGE A;  1LFW A;  3LAC A;  4Q38 A;  3K9T A;  2PJ4 A;  2Z3N A;  3DGV A;  3IC1 A;  3JUW A;  4NCZ A;  1M4I A;  3EXN A;  4FD5 A;  1Z9U A;  2B58 A;  2P6E A;  1ZG7 A;  1R43 A;  2AJ6 A;  4AVC A;  2ZEH A;  4MFJ A;  2D4P A;  1CPS A;  3TO9 A;  1ELM P;  5LYD A;  3FJU A;  1XF8 A;  4MBU A;  1LRZ A;  4DUK A;  1FY7 A;  3OWC A;  3NE8 A;  4RS2 A;  4NGS A;  3TE4 A;  4JD6 A;  4KSA A;  4PV6 A;  4OP4 A;  4OC2 A;  1RXT A;  1MK4 A;  4K30 A;  2PQ8 A;  2BO9 A;  2J8R A;  4KUB A;  4ZY0 A;  3R96 A;  2NSM A;  4F9V A;  4YFJ A;  2HB6 A;  3B2Y A;  4QB9 A;  2Q4Y A;  4Q7A A;  1TIQ A;  2IMO A;  2GFQ A;  2C6P A;  1WK4 A;  5J1Q A;  1IU8 A;  3V7Z A;  4A37 A;  4UEF A;  4FD6 A;  1IB1 E;  2OU2 A;  3F8K A;  3K2K A;  3PP9 A;  4QUS A;  1LAM A;  1XE4 A;  1XMB A;  2OB0 A;  4MFQ A;  4CYO A;  4X3R A;  4M6H A;  3B3V A;  5AG5 A;  4BBH A;  3CT9 A;  1J4J A;  1Y0Y A;  2B3U A;  2GAN A;  5DWM A;  1M1D A;  1XEB A;  2ATR A;  3CXS A;  3IWW A;  4NSQ A;  4DNC A;  2JBJ A;  4FAI A;  3D2M A;  1Z2L A;  4XNH C;  5A27 A;  2Q4V A;  3DR8 A;  4FD4 A;  3PFO A;  4M85 A;  2PE3 A;  5LRK A;  3C26 A;  3ZZI A;  3B3C A;  2OZU A;  1YSJ A;  4H6Z A;  2IJZ A;  5IB9 A;  2PC1 A;  4HNX B;  2ZEM A;  5AG7 A;  1S7K A;  4JZ0 A;  3FRM A;  4UCM A;  4MCQ A;  1VKC A;  1PCA A;  2C1C A;  1YR0 A;  2R1I A;  2CIJ A;  4KOX A;  2V8V A;  1YLO A;  4PSW A;  2JEV A;  1TKJ A;  4OKO A;  4A39 A;  2WPW A;  2PSW A;  4OAD A;  1ZG8 A;  3KR4 A;  4CGL A;  1M4G A;  2ZEP A;  4XPK A;  3PEI A;  2PVW A;  2Z3P A;  2ZXV A;  2R98 A;  2YNE A;  4NGM A;  7CPA A;  2ODF A;  2HV2 A;  4OC0 A;  3S6H A;  2Q44 A;  5HMN A;  3NFZ A;  2C27 A;  1ZO0 A;  5F09 A;  3CXP A;  1DTD A;  4P4F A;  2PCU A;  1XMT A;  3FB3 A;  2POK A;  4NGQ A;  2P0W A;  1QMU A;  5CBM A;  4A94 A;  3W91 A;  3VAR A;  4B12 A;  2F5I A;  3IJ3 A;  4P6Y A;  4RI1 A;  2JBK A;  3KZW A;  3MGD A;  4OC3 A;  4P4I A;  3JVN A;  4CAF A;  4DJL A;  4GS4 A;  1PUA A;  3FED A;  3SJG A;  1IOF A;  4PXE A;  2PJ2 A;  3TO6 A;  5I0C A;  1BPM A;  2NMT A;  3DSB A;  3LMS A;  2PJC A;  5F49 A;  1NE9 A;  3VAT A;  2ARH A;  4KOU A;  3TCV A;  4C7H A;  1CM0 A;  1Q2C A;  2PRB A;  1ZG9 A;  3KR5 A;  4JXQ A;  4KOS A;  5KTA A;  4E2A A;  4MCS A;  4KS9 A;  4P44 A;  1RTQ A;  2XEG A;  5ISV A;  1I21 A;  3H5Z A;  4LQ6 A;  2ZED A;  4A30 A;  1CG2 A;  2PR8 A;  4MFZ A;  1XRY A;  4HKF A;  1F2O A;  1HDU A;  1YW4 A;  3FEC A;  1NSL A;  3VWD A;  2ZEE A;  3KGQ A;  4F0Y A;  2O4H A;  1IOI A;  2FSR A;  2GIV A;  3P2F A;  4NJR A;  4UIA A;  2K5T A;  1QSN A;  2VXK A;  3LD2 A;  4YU9 A;  4ZY1 A;  1MJ9 A;  3GIU A;  1I12 A;  3H8F A;  3BI1 A;  2Q04 A;  4OIW A;  4AVA A;  2D4O A;  1R57 A;  5LYF A;  2ZOG A;  5LYI A;  3S6G A;  4OME A;  3FYN A;  4X2T A;  1NMT A;  1IID A;  2V77 A;  5J8F A;  2PIZ A;  2QEC A;  4U9Z A;  4UIB A;  5AG6 A;  4AB7 A;  1P4N A;  2DPT A;  4JWP A;  2GRE A;  4XPD C;  3R9E A;  4L8A A;  4R6T A;  3F0A A;  1CBX A;  4W9Y A;  1KWM A;  3ZJ0 A;  4BIN A;  3KQX A;  4KUA A;  2FE7 A;  2ZW5 A;  1YX0 A;  1XOV A;  2G9D A;  4U9Y A;  3IO1 A;  3TX8 A;  2AFS A;  2ZEN A;  5F46 A;  1M44 A;  3D7H A;  2NYQ A;  4KVO E;  1YME A;  2FIA A;  5THW A;  3SXN A;  3WC6 A;  3NE7 A;  4QBJ A;  4C2X A;  2H5M A;  2REE A;  2YND A;  4JXR A;  2J9A A;  3FIX A;  1YVO A;  3P2H A;  5J8C A;  1Y7R A;  1ON0 A;  1TKF A;  1VHO A;  3IWG A;  1VIX A;  1WWZ A;  4AG7 A;  1XIX A;  2B4D A;  4UEZ A;  1RO5 A;  1CPX A;  1QSO A;  4MY3 A;  4EFD A;  4PQA A;  3S9M A;  2DPS A;  4JYW A;  5C88 A;  2WZN A;  1BPN A;  1YGH A;  5LYL A;  1X10 A;  2VEZ A;  1LAP A;  2Q51 A;  2C6C A;  4B11 A;  1Y0R A;  1LCP A;  4KOW A;  3B7I A;  1QSM A;  1SQH A;  4MCR A;  4YRH A;  2YNC A;  4X8I A;  3TOB A;  4ZI6 A;  3H8G A;  4NEX A;  3BJ7 A;  2XEF A;  4MCP A;  3GUX A;  3EC4 A;  5C82 A;  4HNY B;  1GYT A;  2A4N A;  1TF9 A;  2J8M A;  1DE4 C;  4II9 A;  1VHS A;  4MHN A;  3QAH A;  3SHP A;  4AG9 A;  4C7I A;  4C2Y A;  2ZW6 A;  1VGY A;  2B4B A;  4IK2 A;  1UFH A;  4IHM A;  4MFL A;  3FF3 A;  5F48 A;  3RO0 A;  5FVJ A;  1B6B A;  2CTB A;  3BXM A;  5JGF A;  5LRG A;  4KSI A;  1XJO A;  2Q0Y A;  3CPX A;  4DYO A;  4HNW B;  2OH1 A;  2PIY A;  2PJ7 A;  2Q7B A;  4EWT A;  4F0X A;  1HDQ A;  1EE3 P;  1S7F A;  3NH4 A;  2B5G A;  2I79 A;  4H2K A;  3PZJ A;  2BUE A;  4B5P A;  1B87 A;  4UEE A;  2FIW A;  3S9N A;  1FNO A;  5IV0 A;  1S7N A;  1Z8X A;  4M6I A;  1AMP A;  3DLJ A;  2Z3M A;  4KLW A;  2JDC A;  4ZBG A;  3F5B A;  4F9U A;  2HQY A;  4ZGY B;  3BHX A;  2QIR A;  4P4B A;  3V38 A;  2C6G A;  1CP6 A;  2BEI A;  2Z10 A;  2VZY A;  2EBJ A;  2PJ3 A;  2WPX A;  4F8Z A;  2BSW A;  2PJ6 A;  4MFP A;  2CNS A;  3ISZ A;  4KOY A;  4R57 A;  4PXB A;  3MN8 A;  4YWY A;  4F6A A;  2Y0M A;  4M3S A;  5DWN A;  3SI1 A;  2ANP A;  2VI7 A;  3GLJ A;  4ONU A;  3SXO A;  2ZW4 A;  3CXQ A;  4H89 A;  2XEJ A;  4AXV A;  4MI4 A;  2VQY A;  2PJB A;  4KOT A;  4NGT A;  4A95 A;  1AUG A;  2PVV A;  4XPL A;  3SJF A;  3T90 A;  4MHD A;  2ZEF A;  4BD9 A;  2ZEL A;  1Y7E A;  3KL9 A;  4KSF A;  4E8O A;  4UA3 A;  4O23 A;  2WSA A;  1YK3 A;  4R7M A;  1R3N A;  1UWY A;  4LX9 A;  3FXT A;  3IFE A;  4PK3 A;  3PB8 X;  2BL1 A;  4ORF A;  3D7F A;  2OOT A;  2Z0Z A;  4EVY A;  3IEH A;  3IU1 A;  2EO8 A;  3D66 A;  2CY2 A;  2PJ1 A;  2Q43 A;  2YGW A;  2Z3O A;  4Y49 C;  3IGR A;  4IUS A;  4UWI A;  4RN7 A;  1XBU A;  3WR7 A;  5JH9 A;  2VBQ A;  2OR4 A;  1CP7 A;  2X7B A;  2CNT A;  4NXY A;  1V0C A;  2QVP A;  1M4L A;  3PRT A;  2JEW A;  2AFU A;  3BJ8 A;  3K9U A;  2ABZ A;  2AFM A;  2QYV A;  4R3L A;  4P4J A;  3SJX A;  1KZF A;  2Z3K A;  4KLV A;  2FS5 A;  3RNZ A;  1YLE A;  1Y9K A;  1Z8T A;  4CPA A;  2AE6 A;  2EK9 A;  1P0H A;  2XEI A;  5HXD A;  4FBE A;  2Q7S A;  3LOD A;  2AFZ A;  2B4D B;  4MY0 A;  4R76 A;  2OZH A;  5GCN A;  3PB9 X;  1BAV A;  3IU2 A;  4J3G A;  3TTH A;  3B8G A;  4CYP A;  1AYE A;  2QJ8 A;  4LQG A;  4FWU A;  2PDO A;  3D68 A;  2VZZ A;  3GYA A;  3CDX A;  3NH5 A;  1QSR A;  4B13 A;  3R9G A;  3I1U A;  3PB6 X;  5G1Z A;  5K8N A;  4NGR A;  3TO7 A;  3TOA A;  4KVX A;  2DEA A;  4CS0 B;  2B3V A;  4NFR A;  2ZW7 A;  2GLJ A;  4ZX8 A;  4A32 A;  2BCO A;  4JJX A;  4A31 A;  2WUU A;  1I1D A;  3UY5 A;  3LWU A;  3SI2 A;  4OC5 A;  4CAE A;  1IYK A;  3G8W A;  3I9S A;  1HEE A;  2PJ5 A;  3KI9 A;  4L89 A;  1TF8 A;  4A2Z A;  4YGO A;  3IWE A;  3EY5 A;  4AVB A;  5K8O A;  1PYT B;  3B3W A;  2BOA A;  3RYO A;  4FD7 A;  5JQ4 A;  3JRU A;  2JLM A;  3FVL A;  3A9L A;  1MJB A;  1Z4R A;  1BOB A;  4R87 A;  4WJB A;  1S7L A;  2B5G B;  4UFV A;  4ZY2 A;  2ZEG A;  2Z11 A;  3SI0 A;  1VHE A;  4QVT A;  2F7V A;  2RC4 A;  4OLL A;  3WT4 A;  2ZEO A;  2FL4 A;  2O53 A;  5G22 A;  1FT7 A;  3KHX A;  5CPA A;  2G3T A;  3R9F A;  3EO4 A;  2F8H A;  1Q2D A;  4QC6 A;  4P4E A;  3S6K A;  1Z4E A;  4JLY A;  3JTK A;  4KZT A;  5D8N A;  1OBR A;  4PPZ A;  2ZOF A;  1Q7L A;  3EFA A;  2PJ9 A;  2HC9 A;  4CGM A;  4R8F A;  3DDD A;  3PFE A;  5IB0 A;  4B14 A;  2Z3L A;  1QQ9 A;  4G1P A;  1QST A;  3W6X A;  3D4U A;  3HUV A;  3N7Z A;  4NGN A;  1S3Z A;  3S6F A;  5BWA B;  4MFK A;  1BLL E;  1IGB A;  2FXF A;  3PBB A;  4FUU A;  4H6U A;  1M4D A;  1OZP A;  4NGP A;  3SJE A;  3B35 A;  2QML A;  5JPH A;  3L2N A;  3RBU A;  3RZA A;  1A2Z A;  1YRE A;  3PB7 X;  3D7G A;  1IY7 A;  3WC7 A;  4K3N A;  2EWB A;  3KQZ A;  1NSA A;  3HLP A;  4LUA A;  4M6G A;  4PK2 A;  5DS0 A;  4IAV A;  1KUV A;  4MJ8 A;  3T8W A;  5E96 A;  5HVH A;  1ARM A;  2VL1 A;  4NF1 A;  3D2P A;  8CPA A;  4OC1 A;  4BMH A;  3QB8 A;  4MRI A;  4XNH B;  5HH1 A;  2EVN A;  4PSX A;  3RAM A;  1ARL A;  2GE3 A;  4B10 A;  4C2Z A;  3V8I A;  1Z8L A;  2I3C A;  1XFO A;  4R9M A;  1PU9 A;  4CAW A;  3VWE A;  4MHY A;  2DF5 A;  2IL4 A;  4PXC A;  5CNP A;  2PRQ A;  1Y9W A;  2EK8 A;  2PJ8 A;  2RFH A;  4PXD A;  4A38 A;  4CRZ B;  2KCW A;  3DNS A;  3FBU A;  5G20 A;  3WC5 A;  4Q36 A;  3PB4 X;  2DXQ A;  3FH4 A;  3TC8 A;  2FT0 A;  4UCP A;  2HUZ A;  2P6F A;  4UFX A;  1H8L A;  3D7D A;  3QNV A;  4B6Z A;  3MRU A;  4OAE A;  4CGO A;  3IIB A;  2CF4 A;  5HVG A;  4MMO A;  1L0C A;  3KAS A;  5LRJ A;  2WYR A;  4Z65 A;  2JDD A;  3KHZ A;  3KKW A;  4ZX9 A;  4CGP A;  4CRY B;  4U5Y A;  1K4J A;  2PJ0 A;  3G3S A;  2AFW A;  3VH9 A;  3NH8 A;  5A28 A;  4I49 A;  3T9Y A;  2FCK A;  1ZLH A;  1ZLI A;  2RB7 A;  2CNM A;  3PGP A;  3TT2 A;  4UCN A;  3FMC A;  1YQE A;  1JWQ A;  4X5K A;  4UF4 A;  4EME A;  3BLN A;  3ISX A;  4Y49 B;  2AFX A;  1JQG A;  2REF A;  1MJA A;  4UBR A;  5K8P A;  3H8E A;  1TKH A;  5G21 A;  4KOR A;  4C68 A;  2AFO A;  2FVG A;  2GU2 A;  1IYL A;  3W6S A;  4UFW A;  1Z8W A;  4A33 A;  1YVK A;  2V8G A;  4CAX A;  2IQ6 A;  3S9L A;  1IIC A;  5EC4 A;  4TNU A;  1GHE A;  2V8D A;  4RUH A;  5EMI A;  4CAV A;  5JM6 A;  2R8V A;  5EBV A;  1S60 A;  3E0K A;  3D67 A;  4GXH A;  2Q4Z A; 
#chains in the Genus database with same CATH homology
 3R95 A;  5IX3 A;  5F47 A;  1N71 A;  3GKR A;  4IF5 A;  5KTD A;  2PR1 A;  2CXA A;  2I00 A;  2G0B A;  5H86 A;  4UWJ A;  2EUI A;  4KVM E;  2R7H A;  4E0A A;  1CJW A;  3FNC A;  5KTC A;  4XPD B;  1KUX A;  3H4Q A;  3D8P A;  1KUY A;  2YNC C;  1S5K A;  2J8N A;  4CYN A;  4B5O A;  2ZPA A;  1BO4 A;  2G3A A;  1U6M A;  2OZG A;  3D3S A;  3GY9 A;  3I3G A;  3R1K A;  5AG4 A;  5H84 A;  4B5P B;  2O28 A;  4CGN A;  4KOV A;  4R3K A;  4CYQ A;  2P6G A;  3DR6 A;  1Q2Y A;  3TFY A;  5AGE A;  4Q38 A;  2Z3N A;  4NCZ A;  3JUW A;  1M4I A;  3EXN A;  4FD5 A;  1Z9U A;  2B58 A;  2P6E A;  2AJ6 A;  4AVC A;  4MFJ A;  2D4P A;  3TO9 A;  1XF8 A;  4MBU A;  1LRZ A;  1FY7 A;  3OWC A;  4RS2 A;  3TE4 A;  4JD6 A;  4KSA A;  4PV6 A;  1RXT A;  1MK4 A;  4K30 A;  2PQ8 A;  2J8R A;  4KUB A;  3R96 A;  4YFJ A;  4QB9 A;  2Q4Y A;  1TIQ A;  1WK4 A;  4FD6 A;  1IB1 E;  2OU2 A;  3F8K A;  3PP9 A;  4QUS A;  1XE4 A;  2OB0 A;  4MFQ A;  4CYO A;  5AG5 A;  4BBH A;  4E2A A;  1J4J A;  2B3U A;  2GAN A;  5DWM A;  4DNC A;  1M1D A;  1XEB A;  2ATR A;  3CXS A;  4NSQ A;  3D2M A;  4XNH C;  5A27 A;  2Q4V A;  3DR8 A;  4FD4 A;  4M85 A;  3C26 A;  3ZZI A;  2OZU A;  4H6Z A;  2PC1 A;  4HNX B;  5AG7 A;  1S7K A;  4UCM A;  3FRM A;  1VKC A;  1YR0 A;  2R1I A;  4KOX A;  4PSW A;  2JEV A;  2WPW A;  2PSW A;  4OAD A;  4CGL A;  1M4G A;  4XPK A;  2Z3P A;  2ZXV A;  2R98 A;  2YNE A;  5HMN A;  2HV2 A;  3S6H A;  2Q44 A;  2C27 A;  1ZO0 A;  3CXP A;  1XMT A;  3FB3 A;  2P0W A;  3W91 A;  4B12 A;  2F5I A;  4RI1 A;  3MGD A;  3JVN A;  4CAF A;  4GS4 A;  1PUA A;  3TO6 A;  5I0C A;  2NMT A;  3DSB A;  5F49 A;  1NE9 A;  2ARH A;  4KOU A;  3TCV A;  4C7H A;  1CM0 A;  1Q2C A;  2PRB A;  4JXQ A;  4KOS A;  5KTA A;  4KS9 A;  5ISV A;  1I21 A;  3H5Z A;  4A30 A;  2PR8 A;  4MFZ A;  4HKF A;  3VWD A;  1NSL A;  4F0Y A;  2GIV A;  2FSR A;  3P2F A;  2K5T A;  1QSN A;  2VXK A;  3LD2 A;  1MJ9 A;  4AVA A;  1I12 A;  2Q04 A;  2D4O A;  1R57 A;  3S6G A;  3FYN A;  1NMT A;  1IID A;  5J8F A;  2QEC A;  4U9Z A;  4AB7 A;  5AG6 A;  1P4N A;  2DPT A;  4JWP A;  4XPD C;  3R9E A;  4L8A A;  3F0A A;  3ZJ0 A;  4KUA A;  2FE7 A;  2ZW5 A;  1YX0 A;  4U9Y A;  5F46 A;  1M44 A;  4KVO E;  2FIA A;  3SXN A;  3NE7 A;  4QBJ A;  4C2X A;  2H5M A;  2REE A;  2YND A;  4JXR A;  3FIX A;  1YVO A;  3P2H A;  5J8C A;  1Y7R A;  1ON0 A;  3IWG A;  1WWZ A;  4AG7 A;  1XIX A;  2B4D A;  1RO5 A;  1QSO A;  4MY3 A;  2DPS A;  5C88 A;  1YGH A;  2VEZ A;  4B11 A;  4KOW A;  1QSM A;  1SQH A;  4YRH A;  3TOB A;  2YNC A;  4NEX A;  3BJ7 A;  5C82 A;  3EC4 A;  4HNY B;  2A4N A;  2J8M A;  4II9 A;  1VHS A;  3QAH A;  3SHP A;  4AG9 A;  4C7I A;  4C2Y A;  2ZW6 A;  2B4B A;  1UFH A;  4MFL A;  5F48 A;  5FVJ A;  1B6B A;  2Q0Y A;  4HNW B;  2OH1 A;  2Q7B A;  4F0X A;  1S7F A;  2B5G A;  2I79 A;  3PZJ A;  2BUE A;  4B5P A;  1B87 A;  2FIW A;  5IV0 A;  1S7N A;  2Z3M A;  4KLW A;  2JDC A;  4ZBG A;  3F5B A;  2HQY A;  4ZGY B;  2QIR A;  2BEI A;  2Z10 A;  2VZY A;  2WPX A;  2BSW A;  4MFP A;  4R57 A;  2CNS A;  4KOY A;  4F6A A;  2Y0M A;  4M3S A;  5DWN A;  2VI7 A;  4ONU A;  3SXO A;  2ZW4 A;  3CXQ A;  4H89 A;  4MI4 A;  2VQY A;  4A95 A;  4KOT A;  4XPL A;  3T90 A;  4MHD A;  4KSF A;  4E8O A;  4UA3 A;  2WSA A;  1YK3 A;  4LX9 A;  3FXT A;  4PK3 A;  2BL1 A;  4ORF A;  2Z0Z A;  4EVY A;  3IU1 A;  2CY2 A;  2YGW A;  2Z3O A;  4Y49 C;  3IGR A;  4IUS A;  4UWI A;  3WR7 A;  2VBQ A;  2X7B A;  2CNT A;  4NXY A;  1V0C A;  3RYO A;  4R3L A;  3BJ8 A;  3K9U A;  1KZF A;  2Z3K A;  4KLV A;  2FS5 A;  1YLE A;  1Y9K A;  2AE6 A;  1P0H A;  3LOD A;  2B4D B;  4MY0 A;  2OZH A;  5GCN A;  3IU2 A;  4J3G A;  3TTH A;  3B8G A;  4CYP A;  2PDO A;  2VZZ A;  3GYA A;  1QSR A;  4B13 A;  3R9G A;  5G1Z A;  3TO7 A;  3TOA A;  4KVX A;  4CS0 B;  2B3V A;  2ZW7 A;  4A32 A;  4JJX A;  4A31 A;  2WUU A;  1I1D A;  3UY5 A;  4CAE A;  1IYK A;  3G8W A;  3I9S A;  4AVB A;  4L89 A;  4A2Z A;  4YGO A;  3IWE A;  3EY5 A;  4FD7 A;  5JQ4 A;  2JLM A;  3A9L A;  1MJB A;  1Z4R A;  1BOB A;  4R87 A;  1S7L A;  2B5G B;  4UFV A;  2Z11 A;  4QVT A;  2RC4 A;  4OLL A;  2FL4 A;  5G22 A;  2G3T A;  3R9F A;  3EO4 A;  1Q2D A;  4QC6 A;  3S6K A;  1Z4E A;  4JLY A;  3JTK A;  4KZT A;  3EFA A;  4CGM A;  3DDD A;  5IB0 A;  4B14 A;  2Z3L A;  1QST A;  3W6X A;  3N7Z A;  1S3Z A;  3S6F A;  5BWA B;  4MFK A;  2FXF A;  4H6U A;  1M4D A;  1OZP A;  2QML A;  5JPH A;  1YRE A;  4LUA A;  4PK2 A;  1KUV A;  4MJ8 A;  5E96 A;  4NF1 A;  3D2P A;  4BMH A;  3QB8 A;  4XNH B;  5HH1 A;  2EVN A;  4PSX A;  2GE3 A;  4B10 A;  4C2Z A;  3V8I A;  4R9M A;  1PU9 A;  4CAW A;  3VWE A;  2IL4 A;  5CNP A;  1Y9W A;  4CRZ B;  2KCW A;  3DNS A;  3FBU A;  5G20 A;  4Q36 A;  2DXQ A;  2FT0 A;  4UCP A;  2HUZ A;  2P6F A;  4UFX A;  4OAE A;  4CGO A;  1L0C A;  2JDD A;  3KKW A;  4CGP A;  4CRY B;  4U5Y A;  1K4J A;  3G3S A;  5A28 A;  4I49 A;  3T9Y A;  2FCK A;  2CNM A;  3PGP A;  3TT2 A;  4UCN A;  4X5K A;  3BLN A;  4Y49 B;  2REF A;  1MJA A;  4UBR A;  5G21 A;  4KOR A;  4C68 A;  1IYL A;  3W6S A;  4UFW A;  4A33 A;  1YVK A;  4CAX A;  1IIC A;  5EC4 A;  1GHE A;  4CAV A;  2R8V A;  5EBV A;  1S60 A;  3E0K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...