1Y7YA

High-resolution crystal structure of the restriction-modification controller protein c.ahdi from aeromonas hydrophila
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
69
structure length
69
Chain Sequence
HDHYADLVKFGQRLRELRTAKGLSQETLAFLSGLDRSYVGGVERGQRNVSLVNILKLATALDIEPRELF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution crystal structure of the restriction-modification controller protein C.AhdI from Aeromonas hydrophila.
pubmed doi rcsb
source organism Aeromonas hydrophila
molecule tags Transcription regulator
molecule keywords C.AhdI
total genus 27
structure length 69
sequence length 69
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1y7yA00
4NDWA 2HSGA 2L49A 3B7HA 2LYPA 3LISA 4Z5DA 4F8DA 1BDHA 1L1MA 2BJCA 2AXUA 1X2LA 3JXCL 1RZSA 4Y42A 3OQNA 2IVQA 1PNRA 2PUAA 1YSEA 2IVBA 2AUWA 2R63A 2XI8A 3S8QA 4JCYA 1ZPQA 4J1WA 3DNVB 3FMYA 3SCFA 4IVZA 1CJGA 1JWLA 3CROL 1AU7A 3RZZA 2GRMA 4X4HA 2AXVA 1ZZBA 3JXBC 3QF3A 2PIJA 1NEQA 4Z58A 1RZRD 1WETA 1QP4A 2LYLA 4X4GA 3L1PA 1Y7YA 2H8RA 3CLCA 2CSFA 1JFSA 3FYAA 3CECA 2MQKA 3QYXA 1LLIA 2D5VA 4YBAA 1ZZ9A 3BS3A 1PRAA 2GRLA 4PU7A 3GN5B 2PPXA 2KEKA 3VK0A 2KEJA 3GBFA 2IU7A 2LYKA 4I6RA 2PUGA 2PUDA 3OQMA 2FJRA 1R69A 3HZIB 4YG1A 1POUA 1JH9A 2O38A 1R63A 1QQBA 4Z5HA 2L8NA 4IWRA 2LYSA 3FYMA 4X4FA 4Z5CA 1PRUA 2GZUA 2XSDC 3GN5A 4FBIA 3EUSA 1BDIA 1QP7A 4YG7B 2AWIA 3ZHMA 1QP0A 4YARA 3QWGA 1DW9A 3H5TA 4JQDA 2KEIA 1O4XA 3D1NI 1NERA 3KJXA 5A7LA 1DWKA 4PU4C 1Y9QA 4JCXA 3SCHA 1CQTA 1IC8A 1WH8A 1LMB3 2R1JL 1B0NA 2AW6A 4X4BA 2BNNA 2IV1A 1XWRA 2AXZA 3F52A 3G5GA 1QPZA 2BNMA 1PERL 3PXPA 3TRBA 1RIOA 2XCJA 1ZZCA 2CROA 1HF0A 2ICPA 2IVGA 2OFYA 2PE5A 2OR1L 1E3OC 3F6WA 3IVPA 4PU8A 2MEZA 2WIUB 4O8BA 4PU3C 3G7DA 1S7EA 1ZZ6A 1QQAA 4X4CA 2XIUA 1ZVVA 2LYQA 2WUSR 1X57A 3UFDA 2PUEA 2XJ3A 1RPEL 2O4AA 3JXDL 4X4IA 4I8TA 1ZZ7A 2EWTA 1UTXA 2JVLA 3KXAA 3U3WA 1LCDA 3BD1A 3QQ6A 1JFTA 1LCCA 4IA8A 3OQOA 2PUCA 3OP9A 2HINA 2KPJA 3SCGA 2LYRA 3LFPA 1EFAA 2B5AA 4J1XA 4GQMA 3ZHIA 5K98B 1VPWA 1PRVA 3R1FA 1ZUGA 4X4DA 3ZKCA 4Z59A 1GT0C 1RZRA 2A6CA 2ICTA 2KZ8A 1LQCA 2EF8A 1UXDA 1SQ8A 2BNOA 2LCVA 3F51A 3O9XA 1UXCA 4I6UA 2PUFA 2O49A 1WIZA 1OCTC 1ZAYA 1ZZ8A 4FN3A 1ADRA 1ZS4A 2EBYA 4I6TA 4MCTA 2IUOA 2JCGA 4OB4A 1WH6A 4YG4A 4X4EA 3MLFA 4GHJA 2PUBA 3KZ3A 4MCXA 3OMTA 1OSLA 2LYJA 3BDNA
chains in the Genus database with same CATH superfamily
4NDWA 2HSGA 1X2LA 3JXCL 3A9YA 2R63A 2ODRD 3DNVB 4IVZA 2AXVA 1ZZBA 3QF3A 2PIJA 1RZRD 4DE9A 3L1PA 3CLCA 1JFSA 2PXKA 3BS3A 3TFLA 3GN5B 4ER6A 2O38A 4Z5HA 4IWRA 3NXHA 4EQZA 4X4FA 2GZUA 3GN5A 4FBIA 5DTRA 1BDIA 4EKGA 1U2ZA 4YARA 2KEIA 1O4XA 5A7LA 1CQTA 1IC8A 1B0NA 3G5GA 2AXZA 4OBMA 3TRBA 2XCJA 1ZZCA 2ICPA 2IVGA 3F6WA 3IVPA 2MEZA 2LNMA 1S7EA 1ZZ6A 2HFZA 2XIUA 1ZVVA 2MXDA 2JQEA 3U3WA 1LCDA 3BD1A 3KL4A 3OQOA 2PUCA 3OP9A 2KPJA 2LYRA 3OKZA 3ZHIA 3TEPA 3R1FA 1ZUGA 4X4DA 3ZKCA 2XXQA 1AU7A 3O9XA 2PXDA 2O49A 1WIZA 1ADRA 2IUOA 4YG4A 1WH6A 4X4EA 4GHJA 3BDNA 2PXEA 3QFIA 3NZLA 2FFHA 2PXBA 2IVQA 2IVBA 2AUWA 2PXUA 3CROL 3VWSA 2LLVA 1WETA 3G0TA 4EK9A 1QP4A 4X4GA 2H8RA 2CSFA 3CECA 2MQKA 3M9LA 1LLIA 5DTQA 1ZZ9A 1PRAA 4PU7A 2PPXA 3GBFA 2IU7A 2LYKA 3A9ZA 2PUDA 2FJRA 3HZIB 3UWPA 4YG1A 2LYSA 3FYMA 4Z5CA 1QP7A 1QP0A 3QWGA 1DW9A 3H5TA 4Q2JA 3KJXA 1DWKA 4ER0A 2AW6A 5JUWA 3LQXA 2IV1A 3F52A 2OFYA 2OR1L 4PU8A 2WIUB 4O8BA 3G7DA 2LYQA 3UFDA 4EKIA 3A9XA 3JXDL 4X4IA 4ER7A 1UTXA 2JVLA 3TELA 2B5AA 5K98B 2ICTA 2KZ8A 1LQCA 4WVLA 1UXDA 2BNOA 2LCVA 5DT2A 4FN3A 4MCTA 1MFQC 3LISA 1L1MA 2PXPA 1PNRA 3OQNA 2XI8A 2VEOA 2J7UA 3FMYA 1CJGA 1JWLA 2HCSA 3QOWA 1NEQA 4Z58A 2LYLA 1Y7YA 2PXQA 2KEKA 3MEJA 4I6RA 4DE8A 3ZPXA 3OQMA 1R69A 2J7WA 5DTMA 1POUA 1JH9A 1QQBA 1R63A 2XXPA 2L8NA 3DM5A 2XSDC 3ZHMA 4JQDA 1NERA 5GAGi 3SCHA 1WH8A 3GUUA 1LMB3 4X4BA 1NW3A 1QPZA 1PERL 3PXPA 1RIOA 2CROA 1HQ1A 3GZDC 4PU3C 5DRYA 1QQAA 2XJ3A 1DULA 4I8TA 1ZZ7A 2EWTA 4EZIA 4HRAA 3KXAA 3QOXA 1QZXA 5DRTA 2HINA 3OWQA 3LFPA 4J1XA 4GQMA 2XXAA 4Z59A 1RZRA 2A6CA 3F51A 1SQ8A 3GZCA 2PUFA 2M4HA 1OCTC 4I6TA 2JCGA 3R09A 2PUBA 3MLFA 4MCXA 1OSLA 1XWRA 2L49A 4ER3A 3B7HA 2LYPA 4Z5DA 4F8DA 1BDHA 2BJCA 2AXUA 1RZSA 4Y42A 2PUAA 1YSEA 3S8QA 4JCYA 1ZPQA 4J1WA 3SCFA 2V3CC 3RZZA 2GRMA 4X4HA 3JXBC 3NDBB 5GAHi 3NROA 3FYAA 3ME5A 3QYXA 2HCNA 2D5VA 4YBAA 2GRLA 3VK0A 2KEJA 3GZDA 2PXLA 5DSXA 2PUGA 3SX0A 2PXTA 1PRUA 3EUSA 4YG7B 2AWIA 2PXFA 2L1PA 3D1NI 4JCXA 4PU4C 1Y9QA 2R1JL 1QB2A 2BNNA 2BNMA 1HF0A 2PE5A 1E3OC 4X4CA 2PXVA 2WUSR 1X57A 2PUEA 1RPEL 2O4AA 3QQ6A 1JFTA 1LCCA 4IA8A 3SCGA 1EFAA 1VPWA 1PRVA 4ER5A 1GT0C 2EF8A 3PE5A 1UXCA 2LLWA 4I6UA 1ZAYA 1ZZ8A 3SR4A 1ZS4A 2EBYA 4OB4A 2YBDA 3KZ3A 3OMTA 2LYJA
chains in the Genus database with same CATH topology
4NDWA 2HSGA 2L49A 3B7HA 2LYPA 3LISA 4Z5DA 4F8DA 1BDHA 1L1MA 2BJCA 2AXUA 1X2LA 3JXCL 1RZSA 4Y42A 3OQNA 2IVQA 1PNRA 2PUAA 1YSEA 2IVBA 2AUWA 2R63A 2XI8A 3S8QA 4JCYA 1ZPQA 4J1WA 3DNVB 3FMYA 3SCFA 4IVZA 1CJGA 1JWLA 3CROL 1AU7A 3RZZA 2GRMA 4X4HA 2AXVA 1ZZBA 3JXBC 3QF3A 2PIJA 1NEQA 4Z58A 1RZRD 1WETA 1QP4A 2LYLA 4X4GA 3L1PA 1Y7YA 2H8RA 3CLCA 2CSFA 1JFSA 3FYAA 3CECA 2MQKA 3QYXA 1LLIA 2D5VA 4YBAA 1ZZ9A 3BS3A 1PRAA 2GRLA 4PU7A 3GN5B 2PPXA 2KEKA 3VK0A 2KEJA 3GBFA 2IU7A 2LYKA 4I6RA 2PUGA 2PUDA 3OQMA 2FJRA 1R69A 3HZIB 4YG1A 1POUA 1JH9A 2O38A 1R63A 1QQBA 4Z5HA 2L8NA 4IWRA 2LYSA 3FYMA 4X4FA 4Z5CA 1PRUA 2GZUA 2XSDC 3GN5A 4FBIA 3EUSA 1BDIA 1QP7A 4YG7B 2AWIA 3ZHMA 1QP0A 4YARA 3QWGA 1DW9A 3H5TA 4JQDA 2KEIA 1O4XA 3D1NI 1NERA 3KJXA 5A7LA 1DWKA 4PU4C 1Y9QA 4JCXA 3SCHA 1CQTA 1IC8A 1WH8A 1LMB3 2R1JL 1B0NA 2AW6A 4X4BA 2BNNA 2IV1A 1XWRA 2AXZA 3F52A 3G5GA 1QPZA 2BNMA 1PERL 3PXPA 3TRBA 1RIOA 2XCJA 1ZZCA 2CROA 1HF0A 2ICPA 2IVGA 2OFYA 2PE5A 2OR1L 1E3OC 3F6WA 3IVPA 4PU8A 2MEZA 2WIUB 4O8BA 4PU3C 3G7DA 1S7EA 1ZZ6A 1QQAA 4X4CA 2XIUA 1ZVVA 2LYQA 2WUSR 1X57A 3UFDA 2PUEA 2XJ3A 1RPEL 2O4AA 3JXDL 4X4IA 4I8TA 1ZZ7A 2EWTA 1UTXA 2JVLA 3KXAA 3U3WA 1LCDA 3BD1A 3QQ6A 1JFTA 1LCCA 4IA8A 3OQOA 2PUCA 3OP9A 2HINA 2KPJA 3SCGA 2LYRA 3LFPA 1EFAA 2B5AA 4J1XA 4GQMA 3ZHIA 5K98B 1VPWA 1PRVA 3R1FA 1ZUGA 4X4DA 3ZKCA 4Z59A 1GT0C 1RZRA 2A6CA 2ICTA 2KZ8A 1LQCA 2EF8A 1UXDA 1SQ8A 2BNOA 2LCVA 3F51A 3O9XA 1UXCA 4I6UA 2PUFA 2O49A 1WIZA 1OCTC 1ZAYA 1ZZ8A 4FN3A 1ADRA 1ZS4A 2EBYA 4I6TA 4MCTA 2IUOA 2JCGA 4OB4A 1WH6A 4YG4A 4X4EA 3MLFA 4GHJA 2PUBA 3KZ3A 4MCXA 3OMTA 1OSLA 2LYJA 3BDNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NDW A;  2HSG A;  2L49 A;  3B7H A;  2LYP A;  3LIS A;  4Z5D A;  4F8D A;  1BDH A;  1L1M A;  2BJC A;  2AXU A;  1X2L A;  3JXC L;  1RZS A;  4Y42 A;  3OQN A;  2IVQ A;  1PNR A;  2PUA A;  1YSE A;  2IVB A;  2AUW A;  2R63 A;  2XI8 A;  3S8Q A;  4JCY A;  1ZPQ A;  4J1W A;  3DNV B;  3FMY A;  3SCF A;  4IVZ A;  1CJG A;  1JWL A;  3CRO L;  1AU7 A;  3RZZ A;  2GRM A;  4X4H A;  2AXV A;  1ZZB A;  3JXB C;  3QF3 A;  2PIJ A;  1NEQ A;  4Z58 A;  1RZR D;  1WET A;  1QP4 A;  2LYL A;  4X4G A;  3L1P A;  1Y7Y A;  2H8R A;  3CLC A;  2CSF A;  1JFS A;  3FYA A;  3CEC A;  2MQK A;  3QYX A;  1LLI A;  2D5V A;  4YBA A;  1ZZ9 A;  3BS3 A;  1PRA A;  2GRL A;  4PU7 A;  3GN5 B;  2PPX A;  2KEK A;  3VK0 A;  2KEJ A;  3GBF A;  2IU7 A;  2LYK A;  4I6R A;  2PUG A;  2PUD A;  3OQM A;  2FJR A;  1R69 A;  3HZI B;  4YG1 A;  1POU A;  1JH9 A;  2O38 A;  1R63 A;  1QQB A;  4Z5H A;  2L8N A;  4IWR A;  2LYS A;  3FYM A;  4X4F A;  4Z5C A;  1PRU A;  2GZU A;  2XSD C;  3GN5 A;  4FBI A;  3EUS A;  1BDI A;  1QP7 A;  4YG7 B;  2AWI A;  3ZHM A;  1QP0 A;  4YAR A;  3QWG A;  1DW9 A;  3H5T A;  4JQD A;  2KEI A;  1O4X A;  3D1N I;  1NER A;  3KJX A;  5A7L A;  1DWK A;  4PU4 C;  1Y9Q A;  4JCX A;  3SCH A;  1CQT A;  1IC8 A;  1WH8 A;  1LMB 3;  2R1J L;  1B0N A;  2AW6 A;  4X4B A;  2BNN A;  2IV1 A;  1XWR A;  2AXZ A;  3F52 A;  3G5G A;  1QPZ A;  2BNM A;  1PER L;  3PXP A;  3TRB A;  1RIO A;  2XCJ A;  1ZZC A;  2CRO A;  1HF0 A;  2ICP A;  2IVG A;  2OFY A;  2PE5 A;  2OR1 L;  1E3O C;  3F6W A;  3IVP A;  4PU8 A;  2MEZ A;  2WIU B;  4O8B A;  4PU3 C;  3G7D A;  1S7E A;  1ZZ6 A;  1QQA A;  4X4C A;  2XIU A;  1ZVV A;  2LYQ A;  2WUS R;  1X57 A;  3UFD A;  2PUE A;  2XJ3 A;  1RPE L;  2O4A A;  3JXD L;  4X4I A;  4I8T A;  1ZZ7 A;  2EWT A;  1UTX A;  2JVL A;  3KXA A;  3U3W A;  1LCD A;  3BD1 A;  3QQ6 A;  1JFT A;  1LCC A;  4IA8 A;  3OQO A;  2PUC A;  3OP9 A;  2HIN A;  2KPJ A;  3SCG A;  2LYR A;  3LFP A;  1EFA A;  2B5A A;  4J1X A;  4GQM A;  3ZHI A;  5K98 B;  1VPW A;  1PRV A;  3R1F A;  1ZUG A;  4X4D A;  3ZKC A;  4Z59 A;  1GT0 C;  1RZR A;  2A6C A;  2ICT A;  2KZ8 A;  1LQC A;  2EF8 A;  1UXD A;  1SQ8 A;  2BNO A;  2LCV A;  3F51 A;  3O9X A;  1UXC A;  4I6U A;  2PUF A;  2O49 A;  1WIZ A;  1OCT C;  1ZAY A;  1ZZ8 A;  4FN3 A;  1ADR A;  1ZS4 A;  2EBY A;  4I6T A;  4MCT A;  2IUO A;  2JCG A;  4OB4 A;  1WH6 A;  4YG4 A;  4X4E A;  3MLF A;  4GHJ A;  2PUB A;  3KZ3 A;  4MCX A;  3OMT A;  1OSL A;  2LYJ A;  3BDN A; 
#chains in the Genus database with same CATH topology
 4NDW A;  2HSG A;  1X2L A;  3JXC L;  3A9Y A;  2R63 A;  2ODR D;  3DNV B;  4IVZ A;  2AXV A;  1ZZB A;  3QF3 A;  2PIJ A;  1RZR D;  4DE9 A;  3L1P A;  3CLC A;  1JFS A;  2PXK A;  3BS3 A;  3TFL A;  3GN5 B;  4ER6 A;  2O38 A;  4Z5H A;  4IWR A;  3NXH A;  4EQZ A;  4X4F A;  2GZU A;  3GN5 A;  4FBI A;  5DTR A;  1BDI A;  4EKG A;  1U2Z A;  4YAR A;  2KEI A;  1O4X A;  5A7L A;  1CQT A;  1IC8 A;  1B0N A;  3G5G A;  2AXZ A;  4OBM A;  3TRB A;  2XCJ A;  1ZZC A;  2ICP A;  2IVG A;  3F6W A;  3IVP A;  2MEZ A;  2LNM A;  1S7E A;  1ZZ6 A;  2HFZ A;  2XIU A;  1ZVV A;  2MXD A;  2JQE A;  3U3W A;  1LCD A;  3BD1 A;  3KL4 A;  3OQO A;  2PUC A;  3OP9 A;  2KPJ A;  2LYR A;  3OKZ A;  3ZHI A;  3TEP A;  3R1F A;  1ZUG A;  4X4D A;  3ZKC A;  2XXQ A;  1AU7 A;  3O9X A;  2PXD A;  2O49 A;  1WIZ A;  1ADR A;  2IUO A;  4YG4 A;  1WH6 A;  4X4E A;  4GHJ A;  3BDN A;  2PXE A;  3QFI A;  3NZL A;  2FFH A;  2PXB A;  2IVQ A;  2IVB A;  2AUW A;  2PXU A;  3CRO L;  3VWS A;  2LLV A;  1WET A;  3G0T A;  4EK9 A;  1QP4 A;  4X4G A;  2H8R A;  2CSF A;  3CEC A;  2MQK A;  3M9L A;  1LLI A;  5DTQ A;  1ZZ9 A;  1PRA A;  4PU7 A;  2PPX A;  3GBF A;  2IU7 A;  2LYK A;  3A9Z A;  2PUD A;  2FJR A;  3HZI B;  3UWP A;  4YG1 A;  2LYS A;  3FYM A;  4Z5C A;  1QP7 A;  1QP0 A;  3QWG A;  1DW9 A;  3H5T A;  4Q2J A;  3KJX A;  1DWK A;  4ER0 A;  2AW6 A;  5JUW A;  3LQX A;  2IV1 A;  3F52 A;  2OFY A;  2OR1 L;  4PU8 A;  2WIU B;  4O8B A;  3G7D A;  2LYQ A;  3UFD A;  4EKI A;  3A9X A;  3JXD L;  4X4I A;  4ER7 A;  1UTX A;  2JVL A;  3TEL A;  2B5A A;  5K98 B;  2ICT A;  2KZ8 A;  1LQC A;  4WVL A;  1UXD A;  2BNO A;  2LCV A;  5DT2 A;  4FN3 A;  4MCT A;  1MFQ C;  3LIS A;  1L1M A;  2PXP A;  1PNR A;  3OQN A;  2XI8 A;  2VEO A;  2J7U A;  3FMY A;  1CJG A;  1JWL A;  2HCS A;  3QOW A;  1NEQ A;  4Z58 A;  2LYL A;  1Y7Y A;  2PXQ A;  2KEK A;  3MEJ A;  4I6R A;  4DE8 A;  3ZPX A;  3OQM A;  1R69 A;  2J7W A;  5DTM A;  1POU A;  1JH9 A;  1QQB A;  1R63 A;  2XXP A;  2L8N A;  3DM5 A;  2XSD C;  3ZHM A;  4JQD A;  1NER A;  5GAG i;  3SCH A;  1WH8 A;  3GUU A;  1LMB 3;  4X4B A;  1NW3 A;  1QPZ A;  1PER L;  3PXP A;  1RIO A;  2CRO A;  1HQ1 A;  3GZD C;  4PU3 C;  5DRY A;  1QQA A;  2XJ3 A;  1DUL A;  4I8T A;  1ZZ7 A;  2EWT A;  4EZI A;  4HRA A;  3KXA A;  3QOX A;  1QZX A;  5DRT A;  2HIN A;  3OWQ A;  3LFP A;  4J1X A;  4GQM A;  2XXA A;  4Z59 A;  1RZR A;  2A6C A;  3F51 A;  1SQ8 A;  3GZC A;  2PUF A;  2M4H A;  1OCT C;  4I6T A;  2JCG A;  3R09 A;  2PUB A;  3MLF A;  4MCX A;  1OSL A;  1XWR A;  2L49 A;  4ER3 A;  3B7H A;  2LYP A;  4Z5D A;  4F8D A;  1BDH A;  2BJC A;  2AXU A;  1RZS A;  4Y42 A;  2PUA A;  1YSE A;  3S8Q A;  4JCY A;  1ZPQ A;  4J1W A;  3SCF A;  2V3C C;  3RZZ A;  2GRM A;  4X4H A;  3JXB C;  3NDB B;  5GAH i;  3NRO A;  3FYA A;  3ME5 A;  3QYX A;  2HCN A;  2D5V A;  4YBA A;  2GRL A;  3VK0 A;  2KEJ A;  3GZD A;  2PXL A;  5DSX A;  2PUG A;  3SX0 A;  2PXT A;  1PRU A;  3EUS A;  4YG7 B;  2AWI A;  2PXF A;  2L1P A;  3D1N I;  4JCX A;  4PU4 C;  1Y9Q A;  2R1J L;  1QB2 A;  2BNN A;  2BNM A;  1HF0 A;  2PE5 A;  1E3O C;  4X4C A;  2PXV A;  2WUS R;  1X57 A;  2PUE A;  1RPE L;  2O4A A;  3QQ6 A;  1JFT A;  1LCC A;  4IA8 A;  3SCG A;  1EFA A;  1VPW A;  1PRV A;  4ER5 A;  1GT0 C;  2EF8 A;  3PE5 A;  1UXC A;  2LLW A;  4I6U A;  1ZAY A;  1ZZ8 A;  3SR4 A;  1ZS4 A;  2EBY A;  4OB4 A;  2YBD A;  3KZ3 A;  3OMT A;  2LYJ A; 
#chains in the Genus database with same CATH homology
 4NDW A;  2HSG A;  2L49 A;  3B7H A;  2LYP A;  3LIS A;  4Z5D A;  4F8D A;  1BDH A;  1L1M A;  2BJC A;  2AXU A;  1X2L A;  3JXC L;  1RZS A;  4Y42 A;  3OQN A;  2IVQ A;  1PNR A;  2PUA A;  1YSE A;  2IVB A;  2AUW A;  2R63 A;  2XI8 A;  3S8Q A;  4JCY A;  1ZPQ A;  4J1W A;  3DNV B;  3FMY A;  3SCF A;  4IVZ A;  1CJG A;  1JWL A;  3CRO L;  1AU7 A;  3RZZ A;  2GRM A;  4X4H A;  2AXV A;  1ZZB A;  3JXB C;  3QF3 A;  2PIJ A;  1NEQ A;  4Z58 A;  1RZR D;  1WET A;  1QP4 A;  2LYL A;  4X4G A;  3L1P A;  1Y7Y A;  2H8R A;  3CLC A;  2CSF A;  1JFS A;  3FYA A;  3CEC A;  2MQK A;  3QYX A;  1LLI A;  2D5V A;  4YBA A;  1ZZ9 A;  3BS3 A;  1PRA A;  2GRL A;  4PU7 A;  3GN5 B;  2PPX A;  2KEK A;  3VK0 A;  2KEJ A;  3GBF A;  2IU7 A;  2LYK A;  4I6R A;  2PUG A;  2PUD A;  3OQM A;  2FJR A;  1R69 A;  3HZI B;  4YG1 A;  1POU A;  1JH9 A;  2O38 A;  1R63 A;  1QQB A;  4Z5H A;  2L8N A;  4IWR A;  2LYS A;  3FYM A;  4X4F A;  4Z5C A;  1PRU A;  2GZU A;  2XSD C;  3GN5 A;  4FBI A;  3EUS A;  1BDI A;  1QP7 A;  4YG7 B;  2AWI A;  3ZHM A;  1QP0 A;  4YAR A;  3QWG A;  1DW9 A;  3H5T A;  4JQD A;  2KEI A;  1O4X A;  3D1N I;  1NER A;  3KJX A;  5A7L A;  1DWK A;  4PU4 C;  1Y9Q A;  4JCX A;  3SCH A;  1CQT A;  1IC8 A;  1WH8 A;  1LMB 3;  2R1J L;  1B0N A;  2AW6 A;  4X4B A;  2BNN A;  2IV1 A;  1XWR A;  2AXZ A;  3F52 A;  3G5G A;  1QPZ A;  2BNM A;  1PER L;  3PXP A;  3TRB A;  1RIO A;  2XCJ A;  1ZZC A;  2CRO A;  1HF0 A;  2ICP A;  2IVG A;  2OFY A;  2PE5 A;  2OR1 L;  1E3O C;  3F6W A;  3IVP A;  4PU8 A;  2MEZ A;  2WIU B;  4O8B A;  4PU3 C;  3G7D A;  1S7E A;  1ZZ6 A;  1QQA A;  4X4C A;  2XIU A;  1ZVV A;  2LYQ A;  2WUS R;  1X57 A;  3UFD A;  2PUE A;  2XJ3 A;  1RPE L;  2O4A A;  3JXD L;  4X4I A;  4I8T A;  1ZZ7 A;  2EWT A;  1UTX A;  2JVL A;  3KXA A;  3U3W A;  1LCD A;  3BD1 A;  3QQ6 A;  1JFT A;  1LCC A;  4IA8 A;  3OQO A;  2PUC A;  3OP9 A;  2HIN A;  2KPJ A;  3SCG A;  2LYR A;  3LFP A;  1EFA A;  2B5A A;  4J1X A;  4GQM A;  3ZHI A;  5K98 B;  1VPW A;  1PRV A;  3R1F A;  1ZUG A;  4X4D A;  3ZKC A;  4Z59 A;  1GT0 C;  1RZR A;  2A6C A;  2ICT A;  2KZ8 A;  1LQC A;  2EF8 A;  1UXD A;  1SQ8 A;  2BNO A;  2LCV A;  3F51 A;  3O9X A;  1UXC A;  4I6U A;  2PUF A;  2O49 A;  1WIZ A;  1OCT C;  1ZAY A;  1ZZ8 A;  4FN3 A;  1ADR A;  1ZS4 A;  2EBY A;  4I6T A;  4MCT A;  2IUO A;  2JCG A;  4OB4 A;  1WH6 A;  4YG4 A;  4X4E A;  3MLF A;  4GHJ A;  2PUB A;  3KZ3 A;  4MCX A;  3OMT A;  1OSL A;  2LYJ A;  3BDN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...