1Y81A

Conserved hypothetical protein pfu-723267-001 from pyrococcus furiosus
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
116
structure length
116
Chain Sequence
FRKIALVGASKNPAKYGNIILKDLLSKGFEVLPVNPNYDEIEGLKCYRSVRELPKDVDVIVFVVPPKVGLQVAKEAVEAGFKKLWFQPGAESEEIRRFLEKAGVEYSFGRCIMVET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conserved hypothetical protein Pfu-723267-001 from Pyrococcus furiosus
rcsb
source organism Pyrococcus furiosus
molecule tags Structural genomics, unknown function
molecule keywords conserved hypothetical protein
total genus 37
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2004-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13380 CoA_binding_2 CoA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1y81A00
4EUFA 2YUTA 3AM4A 3RUCA 3PIIA 1QMGA 4G81A 3CE6A 3IJRA 3KSDO 1I8TA 5ENVA 3WMXA 1KY4A 2PGJA 2JHFA 1ADGA 3HFSA 3V1UA 2Q49A 5HTOA 4IDGA 4PVDA 1ZMOA 3U5TA 3AI1A 3NT4A 4LMRA 3N7UA 3OJ0A 2VNSA 3H9UA 3UN1A 3IC5A 1PGNA 2D3TA 4RVHA 2CVZA 3UVEA 3CUKA 3VTZA 4D44A 2X9VA 3DZKA 3AI2A 4EYEA 5CEEA 3F1LA 1KVQA 4R69A 1DIHA 2FOIA 3HADA 3Q2KA 4JJGA 5IDYA 5IZCA 1C1DA 3O38A 4RV9A 5JAMA 1U4SA 3E82A 3L9XA 3H9QA 3O9ZA 2G0TA 1LDEA 4FC6A 3L0DA 4GKBA 1Q7BA 1AHHA 3C7AA 1VKOA 2BMAA 1CF2O 1ORRA 3M1AA 3WJ7A 2WM3A 4A10A 4BGEA 4J16A 1KEWA 3KSZO 4IS3A 4Q3EA 3NTRA 1E7SA 4XKJA 4ZHSA 3WSWA 1H6CA 2R00C 5JMPA 3LZ6A 2C59A 3DTYA 5IG2A 3UOGA 1MC5A 1JKIA 1NR1A 2D2IA 4LW8A 2OO5A 1ZK2A 4XQ9A 3JQ8A 3BTOA 1O9BA 1NXQA 3WB9A 1ZFNA 5AOVA 3VTFA 4J91A 5IZCC 2PZLA 4OAQA 1KC3A 1ULUA 2OMEA 1U3TA 2V6FA 3QWAA 1EE2A 1XKQA 5H83A 1RPNA 4H16A 2YDXA 4BNZA 3FPCA 6LDHA 1YL6A 2YJZA 3DO5A 4GGOA 4IDFA 1F8FA 4NJMB 3JQBC 1BDBA 4FFRA 1L1FA 3B20A 3WYCA 5BSGA 1P77A 3HB5X 3VKVA 4DREA 4OXYA 2IDZA 3D64A 3HDHA 1EUZA 2GR9A 1YE3A 3NDRA 2H6EA 4TSKA 1VL0A 4D0SA 2AEFA 2IZ1A 1NAIA 3ON5A 3PPIA 4J43A 2AEMA 5DN9A 4FCCA 4RDHA 1UXGA 2J3JA 1E3WA 3NX4A 1YVEI 2IZ0A 4FJ2A 4Q39A 3PEFA 1KETA 3BMQA 2Y66A 4FGWA 1PZHA 4J3FA 1J5PA 3IIEA 5HA5A 3MCVA 4ALNA 4PLZA 3QSGA 1N1EA 2WWRA 2EXXA 4GSKA 1ZUD1 2JCXA 3JYOA 5JBIA 1SB9A 1Y81A 2ZJ1A 1NTOA 4HFJA 4KUGA 4AICA 1A4UA 2VT3A 1K6XA 3GY0A 3QWHA 5A9TA 4BKQA 3Q2IA 4CUJA 2GN6A 4CLOB 2C07A 1BGVA 1Y8RB 3A9WA 3F47A 3HUDA 3GVXA 1SCUA 1RJWA 3UKOA 3EAGA 1E7MA 1J0XO 2VZ9A 3GHYA 1V0JA 1H2BA 1NPTO 1DSSG 1R0KA 2X5OA 2Q50A 1DJNA 2QX7A 3BXXA 1CETA 3DXFA 1KYQA 2Y99A 2DKNA 5DP1A 2XXBA 3FBGA 3DBHA 1Y8RA 2P9CA 3QWIA 1UXHA 2O3QA 3RAJA 3TPCA 3JQCA 3UUWA 4J1TA 1UXIA 3BTVA 3JYQA 3W8EA 3MJSA 4U7WA 1KY5A 5DULA 4CJXA 3KTDA 3LQFA 2GYYA 1XLTA 3AUTA 2NNLD 3IKVA 3MOIA 1IB6A 2RIRA 3KYCB 1I30A 1M76A 4JLWA 3JQDA 4BB5A 1R4MA 4F45A 8LDHA 4NBVA 1JQBA 4GKVA 3DR3A 1B3BA 3FNFA 1MV8A 4MKRA 2VWGA 2Q1TA 3DEYX 4BNJA 1QORA 2HCTA 3JYNA 2AXQA 1HEUA 3ZU2A 2JCVA 2X0IA 3SXPA 3QV1A 2EW8A 5A3JA 3BMCA 2Z95A 3TL3A 1ISFA 4QFCA 1YOVB 1UDBA 2HRZA 4CM3A 3GG2A 4J1SA 1KIFA 2C5AA 2V6BA 2I65A 4B4UA 1NQ5A 5BQFA 2P5UA 2YFHA 1LBEA 1CQJA 1U3VA 4P38A 3VH3A 5JXWA 4Q9NA 5IN4A 1RM4A 3GGPA 4MINA 4MVJD 4WNIA 3QA9A 3BMCB 4DIBA 1PZFA 1U8FO 1QYXA 5L7WA 4XB1A 4XX0A 3FHLA 5G0WA 3S2IA 4E32A 1GQ2A 4AL4A 4DYDA 1E3IA 3DZFA 5GY7A 3ORFA 4QX6A 4HUJA 3D1LA 3HDQA 1ONPA 5H82A 4DL9A 1M66A 3FRJA 1H9BA 4CODB 1QKIA 3PYLA 2AE2A 1LLQA 4IXWA 3OETA 4GX5A 3V8BA 3KYDB 1KOLA 3I6QA 4QECA 4J7UA 4PCVA 2CNBA 3WGOA 1ZJZA 1XU9A 1QLJA 1QSGA 1QXSA 4L4SA 5HM8A 1MP0A 2O3UA 2VT2A 3SX2A 2B35A 2GDZA 2PK3A 4W9NC 5ICMA 3INRA 5AYVA 4CMGA 2ZTUA 4PGFA 1H93A 4ZQBA 5JSFA 2A94A 2W2LA 3MJEA 1GADO 4DPMA 5CDYA 1ARZA 5G4LA 1ZZEA 2I9PA 3A28A 1HKUA 3VHRA 4PG6A 2O7SA 2HMUA 3F4BA 2NSDA 1JW9B 4UVEA 3JCZA 4IM7A 3OA0A 1KEPA 3GPIA 4W7IA 1JDJA 1D1SA 1MUUA 1XA0A 1CEQA 1A4IA 4FW8A 5FI5A 4QT0A 2I99A 3TQHA 1VL8A 5I9MA 3FPLA 2GSDA 4EEXA 1ADFA 1I3NA 1D1TA 3LSYA 4MVJI 2OP1A 1V6AA 3OSUA 4MIOA 2CD9A 5K0ZA 2GN4A 3D4PA 3E48A 5G4KB 2HK9A 2DC1A 3GG9A 1W8DA 4NBTA 4E2WA 4DWVA 1EBUA 3RFVA 3GN1A 4UUNA 4ALIA 5TS3A 3H5NA 2B37A 4W99A 3MTGA 1B15A 4NHEA 2W8ZA 1HL3A 4DVJA 2UAGA 4FQ8A 1YBMA 1ENZA 4L76A 2PR2A 4YJHB 4AJHA 2OBYA 3N74A 3PQEA 4A0SA 3WWZA 2B83A 4GLOA 4E5KA 1MGOA 2R6JA 1UAYA 4TRJA 1HE5A 1HZJA 1KVUA 4B7UA 4E2ZA 4NK5A 2AQKA 3ANNA 3DDNA 3GZ4A 2UV8A 1DC5A 4XRRA 4J1NA 5JAZA 1BMDA 2R2GA 4MIYA 3HWRA 1Z75A 4KTVE 5F5LA 4CUKA 4OJNA 4CUZA 1T2CA 4J1QA 2ZK7A 4CV3A 3INTA 2DPHA 2WMDA 3CMCO 4J90A 3VPSA 4OO3A 2OHXA 3G1TA 4MVJA 1Z7BA 1HETA 1RWBA 1C1DB 2DBVO 2Y1OA 3MJVA 1JAYA 1LC3A 3ZI0A 4CMEC 2X8LA 4YAIA 1R16A 3I9NA 1PL6A 3U9LA 4XR9A 1LSOA 2AHRA 2FY8A 3H5RA 2LDBA 4HWKA 5G2OA 1LRLA 4UUOA 1P0CA 4LN1A 1K6JA 4OOFA 4JBIA 4UEJA 2Q45A 4NBRA 3K5PA 5C7IO 4BNHA 4YJDA 5CDUA 3ZWMA 5CG1A 3TN7A 3RSHA 2ZB7A 1U2DA 1H6BA 2HLPA 1H6DA 5MDHA 4LRSB 4RF2A 1DXYA 4MO2A 5G0SA 1ADBA 5JE8A 4R5MA 3JV7A 4PLVA 3JYLA 1BWSA 3RROA 5TSDA 2JD2A 4JIGA 1E7YA 2EKLA 1A71A 5DBIA 4D46A 2EP5A 1ZBQA 4R9RA 2VWPA 4NPCA 5ITVA 1X0VA 2X9NA 3DBRB 1GR0A 3ADPA 4URFA 4F6CA 3DAFA 5BSEA 1GCUA 1Y6JA 4HKTA 4GMFA 1NWHA 1WMAA 1HDCA 2VZ0A 2BGKA 3G49A 5A05A 1ZSNA 3U4CA 2ZQYA 1YL5A 4U0JA 3PQFA 2C82A 2GERA 2D8AA 2FR1A 4XDZA 4BO8A 2HO5A 1C0KA 3P7MA 3NJ8A 3OP4A 5BNFA 4LCEA 2EF1A 4P22A 4BMSA 4Y6RA 3ZV6A 4NFYA 2YYYA 3TNLA 5DF1A 4RVUA 4RZHA 4PG7A 1ISJA 2CF6A 5U4QA 3DQPA 3K31A 3NYWA 4U6QA 1FF9A 3BMQB 1ZJYA 4BNMA 1A7KA 1LDBA 1NHWA 4A03A 2YDYA 2JD1A 3RUDA 2WD7B 4J7XA 2DLDA 3WFJA 2FWMX 2WTBA 3E5RA 4GGPA 1UP7A 5THKA 4IDBA 3HQ4O 4GVXA 4CMHA 4ZGWA 2VYND 4IGFA 5FI3A 4FSHA 5JCXA 3ROQA 1DRWA 5COBA 2EV9A 4GWKA 1HTBA 3ZWAA 1ZCJA 3OJFA 3LYLA 1XQ1A 2V7PA 1PJLA 3DMTC 4ALMA 2DPGA 4UVHA 1C1XB 5I7SA 1N2SA 3MZ0A 2VZ8A 2PKRA 4KTTE 3PFWO 1PJSA 4O6VA 1PR3A 1KVTA 7MDHA 3V1YA 1U28A 4BGVA 2VN8A 3UICA 3GRKA 3OFSA 1GEEA 3AUUA 1I32A 3IMFA 4ND5A 1EVJA 1WLYA 4IZIA 3H65A 4WE3A 4R3WA 3RIHA 4MP6A 5FEUA 3DOCA 1EDOA 2VRCD 2O3TA 5B4VA 4D3FA 1JTVA 1E77A 3S1LA 3I1JA 4LSMA 3GDFA 2WSBA 3MJ4A 3OEYA 4E12A 4M1QA 1B8UA 4JN6B 1YJ8A 4DLLA 1YBAA 1VRWA 3ZWBA 3DMTA 4Z3KA 1PS8A 3TZHA 3WQQA 1E6UA 2Q99A 3L6OO 3ULKA 5IXYA 1T24A 3WIEA 3NT2A 3IP1A 3P2OA 4WLUA 1LTHR 1S7CA 1X7GA 3ASUA 4J2HA 3VH2A 3ZNQA 3OM9A 3TOXA 4YB8A 2HAEA 3JQ9C 5A06A 1T2EA 4NDNE 1P31A 4IJKA 3SJUA 3MEQA 4GI2A 4ALKA 4WASA 1LQTA 1X13A 3I52A 2DU8A 4CLOA 2I76A 1I33A 2B4RO 1EQ2A 1D4FA 1VE9A 2IODA 3I6IA 2J6IA 2YY7A 3IQDB 4B3JA 1YBVA 4PRKA 4R1NA 3GGOA 1BSVA 3VZRA 4BO1A 1GV1A 4YWJA 3IP3A 2O50A 1WXDA 2PKQP 1GTMA 2EIHA 4P8RA 3QW2A 3F5QA 1HRDA 1VJ0A 1WPQA 5AXCA 1T4BA 3MOGA 4B4WA 1T26A 2VRCA 4F46A 1EK5A 2VYVA 3LK7A 3ANMA 1OAAA 4M89A 5GZ1A 3F4LA 1CRWG 2X5KO 5AVOA 2VHZA 3TL2A 3WOHA 5ES3A 3TWOA 5T5QA 4C7JA 3BMOB 3PRJA 4NJMA 4CMKA 4GX0A 3K6JA 3RKRA 4XIYA 1T2FA 1V3TA 1N9GA 4O5OA 1UZLA 5I9LA 1SZJG 3OECA 3EYWA 4DQVA 4JXKA 3WQSB 3C24A 2QRKA 3I4CA 3EDMA 2AQ8A 2ZTLA 4YYZA 3W8FA 3ZDFA 1T2AA 1DFIA 1XU7A 1GPJA 2WJPA 4BGUA 1G1AA 1CIVA 1GZ6A 1XSEA 2NTVA 3RASA 5GZ6A 4BHTA 1E3JA 1J4AA 4EI2A 1QP8A 4NNJA 3GEGA 1NPYA 2Y1GA 1C0LA 4CMCA 3D3WB 3HN2A 3HN7A 4P4LA 3ZW8A 5BSFA 2EJWA 2XF8A 3ETDA 1LUAA 4TZTA 1XYGA 4CMEA 4EGFA 5G0TA 1PGQA 1S6YA 4E5NA 3GRPA 1PL7A 2B69A 3IS3A 4RZIA 1ENPA 1O94A 4JBGA 3GVPA 1NBOA 2B0JA 4DBZA 5J23A 2EERA 1MFZA 1X14A 4BO5A 3QVOA 3VPGA 3JQGB 4XGNA 2X23A 2GLXA 5L9AA 3BZUA 4J9VA 1VLLA 3EW7A 5K6AA 2GD1O 3ABIA 4A26A 1R0SA 3GNQA 1E5LA 4OXNA 6ADHA 2PZJA 3EVTA 4MIEA 1YXMA 3AU8A 1ID1A 1SMKA 2HQ1A 3PHIA 4JROA 1OBFO 2PV7A 4WPGA 1Z45A 2Z1MA 3JSAA 2PY6A 3ZNPA 2CMDA 2VWHA 2PLAA 1EBFA 4IJUA 4LGVA 2CFCA 3H2SA 5K9ZA 1BXGB 4YT4A 2G82A 2BF7A 3AUAA 3OEWA 4N5MA 5G0VA 4O1MA 2RH4A 3IKTA 3GAFA 2V6GA 4PG5A 3ROPA 2FPGA 5I8WA 4R01A 2FSVA 2AG8A 5JY1A 4NH4A 4PZEA 4CM7A 5A1TA 1LQUA 4L8VA 2PKQO 5T64A 3GDGA 2I3GA 2X5JO 1GL3A 4NI5A 3U09A 2OFPA 3SEFA 1B14A 1DOHA 3U4DA 1LLDA 1I36A 2F1KA 1YH3A 1XR3A 3U4IA 3RUEA 4KZPA 3NJ4A 4L0QA 5EINA 1VSUA 4NJOA 4CLXA 1DFGA 3GHHA 2GGSA 2EKQA 1UZMA 5THQA 1LC0A 3GFBA 3WICA 3NGLA 2X7HA 1XQ6A 2FN7A 5EESA 2XPCA 2HK7A 2NQTA 3GOHA 5CP8A 1WDLA 5U1PA 2BFOA 1Z6ZA 1ZIDA 4A5OA 4DPLA 4FOSA 4J0EA 3R3JA 2DAPA 4RCVA 5ITWA 1BXGA 2GO1A 2CUKA 2X86A 1NWCA 3TZQA 4B8ZA 3FF4A 3OHSX 4ZVVA 1BVRA 2OL4A 3KRTA 4WCFB 2AEJA 4DUPA 2I6TA 3FR8A 2W2KA 3WS7A 1B16A 3EGOA 2DM6A 1B8VA 3H6KA 3L9WA 3Q9UA 3ZU4A 5C5IA 5ER6A 2D5AA 1ZXBA 4CMJA 2JKVA 1EVZA 1F8GA 2GN8A 1DBVO 3VVCA 3P5SA 2BFPA 2QRLA 1FDSA 5ICSA 1KEUA 4UVDA 5JY6A 5TRTA 1KVRA 2DFDA 3I9JA 5T57A 1VPDA 4F6LA 4AVYA 5F5NA 2X22A 4FFOA 4IIUA 2YQ4A 4CMIA 1OZAA 1A27A 4YQZA 3RFTA 4ILKA 4DLBA 1NVMB 3GNTA 1PJTA 3GC6A 4MP8A 3TRIA 1EE9A 2IEDA 2P91A 2X1HA 4PG4A 4FDAA 3K8ZA 4OGWA 5JO9A 3CINA 2IXAA 3RVDA 3AY6A 3JYPA 4CL3A 3PLNA 4DYVA 1LJ8A 3RUAA 4CM6A 2DTXA 3AWDA 3DBLA 3O8QB 4Y6SA 2VTDA 2ZCVA 3GF4A 1N8KA 3S55A 4E2XA 2V65A 2RH8A 2AG5A 2B4TO 3DZJA 3H3JA 3R3SA 1NFRA 4WCFA 3ZHBA 4R5HA 4ND2A 4N5LA 4RVDA 1QV6A 2Q2WA 3WGQA 4BNUA 1LRKA 4ROSA 1WNTA 2CF5A 4BVAA 5H81A 2P9EA 2EEZA 2H5LA 1H5QA 4LISA 2C7VA 3QQPA 2Z5LA 4BNKA 1V9LA 2DFVA 5C7OO 3W8DA 4PIVA 4XRGA 4YAKA 3ETEA 4ALLA 2ZB4A 5AXAA 1VI2A 1RM5A 1SBYA 1PZEA 1HDGO 1V3VA 4E0BA 2Y0CA 2OOSA 4RVGA 5IXSA 3FNGA 4MVJF 3JD1A 4BNGA 3E18A 4JQCA 4GH5A 2YQ5A 1Y9AA 4RQUA 3IOYA 3IUSA 4RJTA 2QYSA 4GX2A 1PIWA 4NFHA 5FFFA 4QQRA 3T4XA 2BD0A 1O6ZA 1KS9A 2XOXA 4OOEA 2OBNA 3KXDA 4TROA 4RGBA 4D42A 3KYBA 1VC2A 1EQUA 4E2YA 1M2WA 3PVZA 4IMPA 2FRDA 2JFGA 4ND3A 4MVJE 1P3DA 3Q11A 1EFLA 4BS9A 3MJTA 4W9NA 1GU7A 3VPHA 4RVSA 1ONOA 3CZRA 1DEHA 3Q1LA 4E30A 2FR0A 3PP8A 4XIJA 3PDJA 4XYBA 3S2EA 4QTZA 2ZJ0A 4HADA 4PLHA 2EW2A 1DLJA 2GZ1A 1UR5A 3RUHA 3S2FA 1UJMA 3WQRA 1ULSA 1UAGA 5EMHA 4YRBA 1GYPA 3ZZNA 2J8ZA 5ER9A 3GUCA 4QXMA 1XDWA 2X6TA 5HS6A 4E5PA 1LI4A 3D4OA 5DNAA 1RM3A 2ZKLA 3WLEA 3ZWCA 3C3XA 3GH3A 1T2DA 1KC1A 4EITA 4TQGA 2P4QA 3KV3O 1R15A 3UF0A 3F46A 3RI3A 3BTSA 1I0ZA 3H3FA 4A7PA 4CLHA 2VOEA 1NQAO 5TLSA 1SPXA 2YFQA 2NVWA 5F3RA 5KJEA 2GZ3A 5A9SB 4CQLB 3AI3A 5TQVA 5L40A 1NP3A 1BHSA 3VZPA 3GEMA 5AQ1A 4IBOA 1XG5A 4D79A 4EDFA 3WNVA 3ZWYA 4RL6A 4WCFC 1C1XA 1Y5MA 3T4EA 3F1KA 3VKUA 3Q0EA 4ZA2A 4WLEA 5EQFA 3SVTA 1TT5B 1OC4A 3TF5A 1E7WA 2Q2VA 1FDUA 4DMLA 1PWXA 2VYVD 1FDWA 3ZN2A 4NBWA 1LRJA 4HY3A 3RU7A 2C7GA 4M49A 4UUMA 4Z0HO 4LK3A 5B37A 2FP4A 2NU9A 1X7DA 1MA0A 1W73A 2ZQZA 2EWMA 2W2KB 4P4NA 1X15A 1R6DA 3DZHA 5F1KA 4DRYA 1YOVA 5CFZA 4EW6A 5CG2A 3VZSA 4NBUA 3GN2A 1PJ3A 4YCAA 5KJ6A 1E92A 2ZCUA 3KZVA 4H3VA 1HXHA 1IHXA 4YBZA 1P1FA 2H63A 5JAIA 2QIOA 1TA4A 3LC7O 3AOEA 4D45A 4M86A 3UAGA 4XYGA 3C7CB 5DP2A 3C85A 1HE3A 1X1EA 3AW9A 1R4MB 3RUIA 3E8XA 1J6UA 5A5FA 3D3EA 1NPDA 5JCJA 3G79A 3RBXA 3WWYA 2ZATA 3CMMA 2HDHA 3KBOA 2VCYA 3ZHZA 1Z82A 3HG7A 1AN9A 3WMWA 3RQSA 3ONDA 1G0NA 1DRUA 2FMUA 2VUTA 3OQ6A 1EVYA 1PGOA 3GVIA 5KVCA 1QLHA 4K1LA 1PTJA 4RLSA 3DZBA 4KQXA 5IZ4A 1DIGA 4L74A 3ROKA 2BELA 1PZGA 4RVFA 4CV0A 2P5YA 5C3MA 4HNGA 4CLEA 1AGNA 3BMNB 1P0FA 1AXGA 4HP8A 3KVOA 4GX1A 2EGGA 4EBFA 3IAHA 1HSOA 2VYNA 2UUPA 3NTOA 4DA9A 3QWFA 4WGGA 1K6IA 4R51A 3RJ9A 3ANLA 3FR7A 2YW9A 1ONNA 3H7AA 4GMGA 4TRNA 4C4OA 4XZ3A 3LVFO 2W2LD 4LMPA 4D3SA 1Y7TA 2CY0A 2EKPA 5TIIA 4YT8A 1WP4A 1PS9A 4ZU3A 2D4AA 4WKGA 4YA6A 5TNXA 4PLYA 4IIVA 1YQGA 1ZSVA 3FWNA 4FPXA 4NMHA 3WBFA 2O7QA 4YJFB 2FR8A 1F12A 2HJRA 2O23A 3DONA 1DLIA 1TXGA 3BHIA 5B4TA 2JFHA 3GGGA 3NEPX 2BKAA 4BV8A 2PGLA 4W82A 1UUFA 3B6ZA 4PLTA 3OJLA 1Q0HA 3T7EA 3EVNA 3SLKA 3BA1A 3O03A 3GNSA 1G0OA 4DXHA 2H1SA 3AK4A 3JTMA 4KUEA 3AY7A 5A5EA 1ENYA 2AA3A 1ISGA 1E7RA 2A92A 3JQFC 2C2XA 3COSA 4OIMA 5BT9A 1LA2A 1N7HA 5L4LA 3PQDA 3WG9A 3TZCA 4O63O 2BH9A 4MVJH 4R1UA 1QG6A 5EN4A 1MLDA 3CH6A 4MDHA 3GQVA 1I5RA 2J5QA 3B70A 1E6EA 1JWBB 1DC6A 1DPGA 1NQTA 5KJFA 2CZCA 1UH5A 2QRJA 4UVIA 3ETGA 1WW8A 4ZICA 3GA0A 5G4KA 4BNVA 3VPXA 5L7YA 4RPLA 4Z0TA 5DCWA 4TRRA 1RM0A 1P1HA 2ZYAA 4IDAA 1QYDA 1PEDA 1PX0A 3PJGA 4TKMA 4ZRMA 2RHCA 4HNHA 1NFFA 4AJ1A 4QO7A 4IMRA 2O4CA 3JQ7B 5JCJD 1U2GA 1Z7EA 2HJSA 1WDMA 4U0KA 3DBVO 1U7TA 4HFMA 4PN3A 3H9JA 3ROMA 1NR7A 4BKRA 1A9ZA 5GZ3A 1H94A 2NU6A 4Y67A 2Q46A 2O2SA 3E9MA 3LLVA 4FR5A 1IYZA 1WMBA 4BNWA 1HYHA 1EEHA 2PD4A 5FF9A 3JD4A 4ALJA 2WE7A 4FFLA 2A35A 4GSLA 5TJ9A 5CPFA 1QYWA 5L45A 2D5CA 5JLAA 1YB4A 4BNNA 2B5WA 4BNFA 3D3WA 1Q7CA 4DMMA 1I3KA 4FJ0A 4LVUA 5BNIA 1JN0A 3K2BA 2HRBA 4KUHA 4FJ1A 1QRRA 4XQGA 2RCYA 5DT9A 2NU7A 1M67A 2TMGA 1DRVA 4IGEA 2X9GA 1HE4A 2JAHA 3W4IA 2PA3A 1QV7A 3D0OA 4XJSA 1DAOA 1GEGA 1IZ9A 1ZXLA 1YS4A 1U3UA 3FBTA 3G17A 5DDIP 3WGHA 4MVJM 1O89A 4WK6A 3WR5A 3L6DA 1GUZA 2Y1EA 3K92A 3DHEA 4MKZA 3F6YA 1LX6A 1BRMA 3B1FA 2YV1A 4B7XA 4XQCA 2J3KA 4Z3DA 1MX3A 4AG3A 3GZNB 3AM3A 1VM6A 3JQ6A 3H4VA 2JL1A 4RPJA 1EVIA 4YJHA 4DTIA 4JX8A 2UYYA 1BW9A 1GCOA 1MC4A 1P1IA 3AM5A 4JCOA 1ENOA 3WNQA 3WTBA 5A9RA 1A9YA 3KEQA 4L75A 4M8SA 1GPDG 3D4NA 3DAPA 2HK8A 5COAA 4ZN6A 2P68A 4GWGA 5FYDA 5IAAA 9LDTA 1KBZA 7ADHA 4FD3A 1Z73A 3V1TC 2ZYDA 1DDOA 2DUUA 4UAGA 4E6PA 9LDBA 5EJ2A 4J0FA 1YRLA 2GF2A 4TZKA 1C0PA 2WEKA 1E3EA 4XB2A 4EEZA 4YXFA 2JAPA 1CJCA 3RFXA 3EC7A 3JD3A 3MTJA 1OC2A 1GUYA 2IXBA 4A2CA 1EZ4A 3LT4A 5ILOA 1ZK0A 1LSSA 4AJLA 1XGKA 5K6AC 2RHRA 3KLPX 3NAQA 5A3VA 3UFXA 1F14A 4NR0A 2J3IA 4CMAA 3D5TA 2B4QA 4KDEA 3ST7A 3CKYA 1K5HA 3WGGA 1A5ZA 4M54A 3FWZA 2BFAA 1TEHA 4I1IA 2B5VA 3EZYA 5KVSA 1PJCA 4LRTB 3ZWPA 4JP3A 3OICA 4IDDA 2I3AA 3I9LA 1SB8A 3R0IA 4DBVO 4CM9D 3GAZA 1FXSA 3LC2O 1JA9A 2D0IA 3QE3A 5DCUA 5JDIC 4PZDA 4XGIA 1HYGA 5I8ZA 4DIOA 5IF3A 5EERA 1EFKA 1YDWA 5T67A 4TVOA 3KB6A 1PU2A 4NQZA 2W90A 4II2A 2BGMA 3OA2A 4OMUA 4YEDA 5TT1A 4BNYA 1A7AA 4YRDA 3E1KA 1L7EA 2WYUA 1DO8A 4CQMD 3DWFA 5BNTA 3LC1O 5DZSA 1NHGA 1O0SA 5T6BA 4PLGA 4PRLA 3RBVA 5HWSA 2FZEA 1VSVA 2G1UA 2UVDA 3NV9A 3OIFA 1YJQA 3RC1A 1P33A 4LSWA 3ZWXA 4PLCA 4U5QA 4EJMA 3BTUA 4RF4A 3AU9A 1GV0A 1U5AA 4GQAA 5B1YA 1MG0A 1YQDA 4W7HA 4I9HA 1ZK1A 3ICCA 5F21A 3WYBA 3JQEA 5BR7A 4B3IA 4TMFA 1ZKMA 1E0DA 5JYEA 3IL2A 3RJ5A 5U9CA 1QR6A 4BKPA 1TT5A 3BYZA 3G3EA 4MPDA 4BO4A 1DC3A 3JQ8B 2E82A 5JC1A 1LDYA 4FB5A 4CV1A 3C8MA 3W4JA 2X4GA 4GAEA 5KJCA 3VVBA 1GZ3A 2PNFA 3I9OA 1E1LA 1OI7A 3NT5A 4RORA 4BIIA 3WLFA 3GVHA 3L07A 2TMDA 3PI7A 5JS6A 1SNYA 2GASA 3AOGA 4BO3A 3A4VA 1EUDA 1I3LA 4IDEA 2HMVA 2X0NA 4HFRA 3HZZA 5I7EA 2Y1DA 5JO0A 3BMNA 1HF3A 1YO6A 5A03A 4UVGA 4IPTA 3F9IA 1H0KA 1NM5A 4BO0A 1ZO8A 3BIOA 5CHEA 4HBGA 4WLOA 1JWAB 3W6ZA 3UW3A 2Y1FA 1DHRA 4BMNA 3QVTA 3ZU3A 4AJ4A 3LF2A 1UDCA 5L3ZA 1I01A 1M75A 3H2ZA 3H9EO 3ZV3A 4EZBA 1BTOA 3D7LA 1TT7A 5DCYA 1B7GO 4Q3NA 4MP3A 2NQ8A 1KEVA 1XHLA 3L4BC 1HZZA 1NX6A 5CDSA 2DTDA 5IDWA 2ZB8A 3UH1A 1U3WA 1YDEA 1VJTA 3OIGA 3WBBA 1I24A 5KKAA 5JAQA 3EY4A 3VPFA 5KTKA 1E7QA 1P44A 3QIVA 1P1KA 3DTTA 1NVTA 3GMDA 3ZHYA 3WXBA 4YPOA 2PD6A 4BKOA 1FMCA 1XELA 2IYPA 4N7RA 3TFOA 3A14A 1MXFA 3DFZA 4XWYA 2DVMA 2GPTA 5JDCA 1ML3A 2PTGA 2RAFA 3R6DA 2DBQA 2ZYGA 4J9UE 8ADHA 3KYDA 1E5QA 1R66A 1E3SA 1BVUA 1PJ4A 3DFUA 2X58A 4ZRNA 3PZBA 5L7TA 4IQGA 1PJBA 1LNQA 1E3LA 4CQMA 1IPFA 3X2FA 4M55A 1GYQA 4OXKA 3G1UA 4E13A 1CERA 3GLQA 4I8XA 3RC9A 3R1IA 2OZPA 3GZNA 2HMTA 3KLMX 4S3MA 4O0LA 3VC7A 4UREA 1HLDA 4L9RA 5HBRA 4NU5A 3B1JA 4IS2A 4BUCA 1FK8A 2Z1NA 3ASVA 3FNEA 3JQAA 4GLLA 4CQLA 3ZHXA 4CV2A 4K6FA 4PG8A 2E4AA 4CM1A 1Z74A 5G0UA 4INAA 2YHIB 4NU6A 4OSOA 3U0BA 2AW5A 2OGUA 3DOOA 4IUYA 4FFNA 4I9NA 4RO0A 1V35A 1K3TA 4KMSA 4Y6PA 3I23A 1B3RA 3OH8A 5KCZA 5COQA 1WZEA 4D41A 1O95A 3STHA 3V2HA 3NKLA 2ZB3A 4A27A 3P19A 4I5FA 1SOVA 4DQXA 4E31A 1X7HA 3PGXA 4RPHA 5KJ1A 4KQWA 5KVQA 4FIZA 2C20A 3OF2A 3K2EA 4FFPA 3MWDB 3ENKA 3E9QA 1HDZA 2JHGA 2G5CA 3QHAA 4UULA 1U1IA 5L4NA 4OYRA 4R68A 3K9QO 2OORA 1C0IA 1DIBA 1BDMA 5B4UA 4ZQGA 2JD0A 4UEOA 4I08A 1IULA 3NGXA 1HDOA 1JVBA 2HUNA 3PK0A 3WGTA 3E03A 3FCOA 3CSDA 2AE1A 3GEDA 3C1AA 3W4KA 4N18A 4XCVA 1ZVMA 1TB4A 4B4OA 5L95A 3C1TA 4I9UA 4R9SA 4KOAA 1G6KA 1E1MA 3ZWWA 1ZMTA 3I3OA 3DZIA 2Y67A 5T8KA 1IOLA 2Y1CA 5I7VA 3NDJA 4BNTA 3I9MA 1CYDA 1EUCA 3H9GA 4RF5A 3U62A 4FGSA 5AXDA 1JKJA 1AXEA 2VHVA 1ZEMA 3HDJA 3MWEB 4AJOA 4XYEA 1NQOA 1Y8QB 4CM4A 3I5MA 1EDZA 4JBHA 1WWKA 2Q2QA 2GZ2A 1LU9A 5IN5A 4OL9A 1UXJA 5TT0A 4YT2A 1W4ZA 2NADA 3JQFA 4XR4A 3VDQA 3F3SA 2E49A 2P2SA 3KOUA 3NTQA 4IINA 2Q4BA 3ZNOA 5HS4A 3AFNA 2QW8A 4OKIA 3LU1A 3WFIA 4XJTA 4BO2A 4R4JA 4BQRA 2IZZA 3I4FA 4W6ZA 1JLLA 4ZQHA 1HT0A 4RF3A 3K96A 2UDPA 4IJWA 4Z9XA 1IY8A 4XYLA 1SEVA 1DHTA 4Y8VA 2O48X 4HFNA 1Y5RA 4ZQEA 1P45A 2A9FA 1DJQA 4KDFA 4BNIA 4DPKA 4PLWA 1Q7GA 3Q3CA 3KYCA 2EHDA 4TWRA 2AQHA 3RKUA 3EMKA 1N7GA 2FHSA 1Y9EA 2VNAA 5F1PA 1RKXA 2D1YA 1ZK3A 3QVSA 1WAMA 4GBJA 1R4NA 4XGKA 3NRCA 4ND1A 2Y0DA 4E33A 4W4TA 3ICPA 5KIAA 2F00A 1WVGA 2A4KA 3PTZA 3B1KA 1T25A 4PLPA 3DBHB 4QFDA 1GFSA 1MB4A 1LDGA 2X0JA 3QJ5A 2BI7A 4IY1A 1R12A 1ZSYA 3GK3A 3HHPA 1NYTA 4WECA 3AY3A 3GVCA 4BOYA 2FSSA 4WEOA 2PZMA 3AOEC 1M6WA 1JVSA 2BFMA 2QQ5A 2J5RA 1LEHA 4FOOA 3M2PA 5AXBA 4QEDA 4WOKA 3TOZA 1TVEA 1XWFA 1LLUA 4AJEA 1IE3A 4K9DA 5EPOA 4FN4A 2BHLA 1WDKA 4DQUA 2HU2A 3UHAA 4HX5A 3DMYA 2NV6A 4G5HA 4ITUA 4YDRA 1U9JA 4OKNA 3BHJA 1D8AA 5A02A 1N9GB 1E3WB 2Q3EA 2BI8A 4YAEA 3HFGA 3MJCA 3U4HA 3GUYA 5LDGA 4PLFA 4YJGB 4CLRB 4MOWA 4CR6A 4I5EA 1B0AA 4M87A 4R1SA 3WGYA 1YONA 4I5DA 4KP7A 4CR8A 1BW9B 3BAZA 4YAJA 4AJPA 2NVUB 4ONEA 3PHGA 4YJGA 4CLRA 4BNXA 3GT0A 3CPSA 3M2TA 1HE2A 3RD5A 4O59O 1ADCA 1MFPA 3EK2A 5IFLA 4WCDA 3ADOA 2WYWA 3GDOA 3ZCXA 2PWZA 2DBZA 5TC4A 4R1TA 4BGIA 3TZKA 2HMWA 1LSUA 2NWQA 1AE1A 4WUVA 2ET6A 4AJIA 2Y93A 1K0UA 3KEOA 4R41A 4DLAA 4H15A 2G76A 4XQEA 1PJQA 3U49A 4CM8A 4F3YA 4OHUA 4TKLA 4Z9FA 3ZV4A 1IZ0A 2OP0A 5I7FA 3PDUA 1VJ1A 1PSDA 2PH5A 1U4OA 2PGDA 1LLCA 5TJHA 1UP4A 2QZZA 5DOVA 4IQ8A 3CZMA 4FC7A 1HDXA 1QYVA 3E9NA 1N92A 2NM0A 2DBRA 3KUXA 4BKUA 2GRAA 1SAYA 3SLGA 1PGPA 4CMIB 1N5DA 1MG5A 3SJ7A 3I83A 4C7KA 3ZNNA 2POQX 3PYXA 3DBLB 3O8QA 2W98A 2ZTVA 1XEAA 5A4DA 1JAXA 1KVSA 1JU9A 2YV2A 3ZWOA 1V8BA 2VQ3A 1NAHA 2LDXA 5C37A 3DZGA 1Q0QA 2XAAA 4IXTA 3OIDA 1KERA 4QUKA 1SO8A 2VRBA 4BO6A 2V6MA 1OOEA 1HYEA 3FSRA 4WLNA 1X0XA 2CVQA 2GUGA 2BLLA 2HSDA 2VHYA 3PHJA 3DHNA 3JQ7A 3JD2A 2EP7A 1P9LA 3VDRA 4OQZA 3QLJA 3BMOA 1GZ4A 2GCGA 3ZU5A 4JNKA 3W1VA 3RCBA 4EUEA 1N1GA 4EJ6A 4LCJA 3ENNA 4CMBA 3ITKA 3M1LA 3PYMA 4GVLA 2H9IA 1ZH8A 5KKCA 4KWHA 5IJZA 3QVWA 2WYVA 3IUPA 2QYTA 4JK3A 4XYMA 5KNLA 2AMFA 4AJ2A 5TGDA 1UP6A 2NACA 1GQYA 3K73O 5KOIA 5EL0A 4J4HA 1K2WA 4PVCA 4YRAA 3PWSA 4TVBA 2SCUA 2R00A 3EHEA 1T1SA 3G0OA 5LCXA 4CM9A 3KM0A 3TSCA 2X0RA 1T1RA 5IDQA 1DIRA 4WOJA 4E5MA 4Y9DA 3U3XA 3X2EA 2FZWA 3GMSA 5B12A 4OH1A 1UXKA 5FWNA 4DC1A 1SC6A 3DHYA 1E6WA 2D59A 4D43A 4B3HA 4E4YA 3PIDA 2CDCA 2WE8A 4XDYA 3PHLA 1P1JA 1VL6A 1W6UA 3T7CA 3S8MA 1PQWA 3PLRA 3HDYA 2ZIZA 4B8WA 3DBRA 5ILGA 5CAEA 4II3A 3FN4A 4IQ0A 2O3SA 3I9KA 3C1OA 5DOZA 1OMOA 3JQ9A 2XXJA 4JJIA 1R37A 4Q3DA 4WNCA 2EGHA 2JFFA 2OXIA 3M6IA 1T4DA 3PFFA 4NFSA 3E5MA 2C5EA 2FPPA 2NUAA 4YJFA 3WYEA 4YAGA 4RPKA 1SEPA 4K6CA 5ADHA 1HDYA 3TJRA 1NNUA 1CDOA 2O3RA 3PZRA 2CDAA 4YACA 4BNLA 3LF1A 4I5GA 4ESOA 2W4QA 5CPBA 4J2OA 3Q6IA 5JPIA 3LDHA 4N5NA 3RUFA 5JDIA 5A9SA 1ZW1A 3OJOA 3AUSA 2Q1SA 5JNLA 2DUWA 3HNPA 5LC1A 3TZ6A 3V2UA 3DOJA 1E1NA 4ZQFA 3VAZA 4CL8A 3GFGA 4Z6KA 1U7HA 3O4RA 4EUHA 5LDHA 1F0YA 1R0LA 1GAEO 1FJHA 1RYEA 1B8PA 2E48A 3JQGA 1AUPA 3OBBA 3SC6A 2Q1UA 2J3HA 3JD0A 4NG5A 4K26A 4G2NA 4BO9A 3IDSA 3NDIA 4YQYA 4A73A 1FDVA 1GYRA 3RBZA 4XEHA 1YGYA 4Z9YA 1X1TA 2Y05A 4Y98A 3HSKA 3TDKA 3F5SA 1NVGA 1LDNA 4E3ZA 3GPDG 2VTEA 1H2HA 4UUPA 2Q4EA 4BO7A 1GD1O 2C54A 4S1VA 2PZKA 2Q1WA 3FD8A 4JP2A 4AJKA 3HE3A 5L4SA 3FTPA 3RWBA 2O3JA 5F1OA 5JDCC 4YR9A 5CDGA 5L53A 1PR9A 2VUSA 4RPGA 2C29D 1DIAA 3KO8A 1I2CA 4L73A 1YB5A 1CQIA 3H8VA 3ZGYA 5C7LO 4NK4A 2PD3A 2VHXA 2B36A 1ISHA 3ZWVA 4L4XA 3L4SO 1GDHA 1YWGO 5CEJA 4E21A 2ILTA 1JKFA 3SC4A 4KWIA 4ND4A 3HJAA 1PQPA 1NFQA 1XCBA 4HV4A 4Q3AA 3C7DB 3UCXA 1IPEA 2I66A 1P1RA 3LLSA 2CDBA 1HDRA 3GR6A 2C0CA 3VOSA 4ZD6A 4ZJUA 2O2YA 2VUUA 4R3NA 3KETA 4IJVA 4RLHA 4OSPA 2VWQA 1V3UA 4Q3BA 4CLDA 2IRWA 1PWZA 4BL5A 1D3AA 1ZNQO 2E37A 1HSZA 3HB4X 3O26A 3QY9A 3VH1A 3KSUA 4FFMA 2BGLA 4WLVA 2NTJA 3QWBA 3PJFA 4LVCA 4R54A 1I10A 1Y1PA 3FNHA 4AFNA 3ZH2A 2WD8A 2NVBA 5JFOA 4J7CA 2IYOA 1XIVA 3OJEA 4IZHA 2Y0EA 3EZLA 3PWKA 2P4HX 4PZCA 2VOJA 4D3DA 1C14A 1LXCA 1GUFA 3ONFA 4OQYA 4L4RA 2BRUA 3L77A 5CDTA 1F17A 1Q1NA 5KVVA 3AJRA 1H9AA 2EJVA 3CEAA 4OM8A 4TRMA 3LT0A 3WX0A 3WIDA 1O8CA 2HMSA 1I3MA 3A06A 1BG6A 1PL8A 3CXRA 4RDIA 3WJAA 1GQQA 2G17A 1W0CA 1LSJA 2C2YA 3P2YA 4DC0A 3OQ1A 2QHXA 1O5IA 3K30A 4H7PA 3OQBA 4J4TA 1D7OA 1C3VA 2YHUA 2IE0A 4CM8B 1SOWA 3RC2A 1PQUA 4QO8A 1WZIA 3W6UA 4QSMA 2OUIA 1DFHA 4P4GA 3V2GA 4BQPA 4U8GA 2PFGA 2PH3A 1GY8A 3CTMA 1RYDA 3AFMA 2DTEA 3PGJA 3E6AA 3D5QA 4BV9A 1DB3A 3WGZA 3ZWNA 3IJPA 2QZ9A 5L51A 1K89A 5EIOA 3RU9A 4WLFA 3ZV5A 5IDXA 5HRUA 2P9GA 2JJYA 1B2LA 3OMLA 1PS0A 2NU8A 3ZW9A 1TLTA 5T8KC 3VZQA 2QG4A 3V5NA 3CIFA 2YZ7A 4YT5A 1AHIA 4MKXA 4XD2A 1Q0LA 2VHWA 2JCYA 5BSHA 2AQIA 1CWUA 4IDCA 3PJEA 2RBEA 1OFGA 1ZK4A 3PXXA 2UUOA 1BXKA 4NIMA 2O4UX 3FTNA 4WEQA 5TX7A 3PHHA 3WGIA 5JYDA 4YTEA 1H6AA 3L6EA 5KWEA 4BB6A 1YKFA 1ZEJA 2J5KA 5CEFA 4MVJP 1J49A 2ZTMA 5JC8A 4E5YA 3UCEA 5JMWA 1P74A 1IL0A 1ISIA 3PWZA 3ITDA 1UDAA 4D0RA 3DB2A 3H5AA 3EUWA 4JJFA 1U8XX 1YL7A 5GMOA 1A72A 4WJZA 2CSUA 3UGKA 4CR7A 2E6UX 3RC7A 3TFQA 1PGJA 4JGBA 4Q3CA 1F06A 1R4NB 3DAGA 1YB1A 4J49A 4B4VA 4YVFA 4J4BA 1MXHA 2Y68A 1EK6A 4CM5A 2I67A 4X54A 3UXYA 4RQTA 1ISMA 3N58A 4DGSA 4U6SA 1IUKA 4R16A 4CPDA 3Q9NA 1HLPA 4EJ0A 2NLOA 2I5PO 1UZNA 1I2BA 4K28A 1DC4A 4GL4A 5EQDA 2FPIA 4Z0PA 4MVJG 5TF4A 3DL2A 3PJDA 4HXYA 3WSVA 5ENDA 2IEBA 1M6HA 3KHUA 4FS3A 5JW6A 5DBGA 1TI7A 2GNAA 4MJLA 3FI9A 4XA8A 1PJ2A 1HWYA 2DT5A 3QP9A 3VH4A 2CVOA 1NASA 1IHYA 4FBGA 2YHIA 3WTCA 4J6FA 3BHMA 4UEKA 4AJNA 1Y8QA 2WDZA 3LT2A 4CM4B 4B7CA 1QYCA 3SBOA 4D7AA 1B26A 5DBFA 3S2GA 4DIFA 2HKIA 1VKNA 3LT1A 4PFJA 3A1NA 4NZ9A 1L7DA 3DC2A 2DQ4A 4ID9A 4N54A 1FDTA 1E1KA 4BMVA 4AJJA 4GPD1 3WDSA 2WD7A 4CQMB 3JQBA 2YV3A 1U5CA 3INGA 1Q2XA 4B79A 3JQAB 1EMDA 3ONEA 3JQAD 2NTNA 2GN9A 5I9NA 5MGBA 1YQXA 3QRWA 3L4BA 1I2ZA 3QVXA 1BXZA 1DAPA 2EG9A 3UCFA 2NVUA 1LDMA 3NUGA 5A04A 4G65A
chains in the Genus database with same CATH superfamily
4L3OA 3GJ8A 1G1MA 1THZA 2BI4A 3RUCA 1QMGA 2RC6A 5HKBA 1FNMA 3CE6A 1X1QA 3IJRA 2P4SA 5HJ7A 5MFZA 3SI7A 3WMXA 2FUKA 1C4KA 1M0SA 2G1JA 2JHFA 1V39A 2Q49A 4PO9A 3MB8A 5J9FA 3EPJA 4GVPA 3L8EA 2EGUA 3I5AA 4RK4A 3B1WA 3P8ZA 3C2QA 4QTYA 1S3SA 4HG2A 4LMRA 3NYRA 2GPWA 3V4ZA 2E1RA 5JQGB 1TEXA 2RGDA 3IC5A 3E1SA 3OE1A 4MEJA 3CVWA 2ZI7A 3RO7A 1JHUA 5B1EA 5DLQC 3CUKA 1S0UA 1M1NA 2X9VA 3C3JA 3NBXX 5CEEA 1WG8A 4WWHA 3IP9A 1IWPB 1SUIA 1RNLA 2FOIA 3HADA 4HDQB 1G3QA 4JJGA 4QBHA 4KYUA 3O38A 3DFFA 3DTNA 1Y1KE 5G41A 4E09A 1OTXA 1HQYE 1OYYA 1U4SA 4JNCA 1MH9A 3O9ZA 1LDEA 2GPNA 5LJLA 2I91A 3IRUA 5KKCA 4QQKA 2BSXA 3SEAA 1UQUA 3AONB 5JSQA 2FEKA 2XRFA 5KYUB 4CG3A 4J16A 1VHQA 1VOTA 3CWCA 3PT5A 1XDUA 3I5XA 4XKJA 2EBUA 1Z17A 4EPTA 2XUGA 2MINB 3NOOA 5IG2A 5K0NA 1NR1A 1JU3A 1U7OA 2AOUB 2D2IA 4LW8A 4UUAA 2OO5A 3ADBA 2DR2A 4FLEA 1F1BA 4D02A 3KC2A 3JQ8A 1WCIB 1ZMRA 2OBFA 3WB9A 1ZFNA 4NU8X 4PW0A 2AMJA 2PM8A 1U98A 4X1OA 3AHJA 1W5EA 2PZLA 3UK6A 1KC3A 2ZE7A 1ULUA 3BWVA 4D99A 2NZUG 4QATA 4RULA 3N0VA 2YIMA 4RMNA 3DVAA 4OGFA 4NOJA 3INYA 5CRIA 1VFNA 6LDHA 1MNQA 3UUFA 2YJZA 4GGOA 1Z6YA 4AZSA 2PJRA 2RONA 3RGWS 3OFKA 4C3OB 2WPNA 4YMVA 1SXJD 4HYQA 2FUNB 3UATA 2H2DA 5HM6A 4OXYA 2QEQA 5BO5A 3B8EA 3DNMA 3K1TA 4CHTA 3U5ZB 1WUKS 1LS6A 4L28A 2GR9A 1YE3A 3HUTA 1RR6A 3OMWA 4RDCA 1SUEA 1VL0A 2AEFA 5DNEA 3QUQA 3PDWA 1NAIA 4FDVA 2IUTA 3TPZA 4B5LA 2Z4TA 2AEMA 1ADYA 2AB0A 3MWYW 3NIWA 2V8BA 1UT8A 3NBFA 1UXGA 5T4EA 2J3JA 4LNHA 3ZZTA 2XXAB 1U8ZA 4KK3A 2R1TA 1TJNA 3OWXA 1PWEA 3R5SA 4ZO7A 4P3XA 5FJJA 3TRKA 4FJ2A 2LKDA 3PEFA 2IP2A 2Y66A 4PRZA 1PZHA 5I47A 1MAWA 1V6SA 3PGLA 1ZUIA 4UQOA 5IKEA 3IA2A 4RA9A 1JEQA 2BGTA 2CXXA 3KUUA 3K8YA 1MORA 1Q44A 2WWRA 1NF8A 4R2LA 1XDSA 4GSKA 4O4HB 2JCXA 4RM2A 1S2NA 4HH3C 1QYIA 4F1KA 3H2JA 5BYAA 2C03A 1GXSB 5JBIA 3THXA 4KUGA 2CMFA 4L7VA 3GY0A 1OGJA 3Q2IA 3K0AA 2R5WA 1XB2A 3LUHA 3A9WA 3N2GA 1NJGA 5JAPA 2BGNA 1MO4A 4MW9A 4Q6WA 5LD2B 2YMQA 1RJWA 2MTBA 2XZOA 1FYFA 2AVNA 4Q24A 1E7MA 3GHYA 2PXCA 1V0JA 1H2BA 4PLWA 1R0KA 3OOEA 1PV4A 1N6RA 4UDNA 4B0PA 5TLSA 4NENB 1DWPA 4EGCB 3FBGA 3KZOA 4BLWA 2E3JA 2VDVE 1WQ1R 2BDEA 5EGNA 1UXHA 3I37X 2O3QA 5KYVA 2Z8ZA 3T35A 3JQCA 3UUWA 4J1TA 1FIUA 3MJSA 4B34A 4TTTS 4RJKA 3ZE1B 4F21A 4XX0B 2YJ6A 3H2GA 4LDPA 3KTDA 4O29A 1P9OA 2HJVA 3LVQE 2FQWA 3IKVA 1M76A 1TZJA 3T5DA 3EFHA 3JQDA 3OCVA 1JUDA 3ILHA 4JXJA 3ELBA 5BPFA 2EC5A 8LDHA 4GKVA 1U2PA 1XHEA 3DR3A 4O02B 3IERA 4B74A 1HX7A 3QX3A 2A5DA 4MKRA 5K0CA 3DEYX 3PU6A 1ACJA 2Z8XA 3IIIA 4FX2A 2HCTA 4KR3A 3JYNA 1H3EA 4YS6A 1D07A 3F96A 1FL9A 1R8QA 4WXYB 1JLLB 1G8MA 1AM4D 1FOEB 1HEUA 1UKEA 3ENVA 3TSAA 3ZU2A 3BDAA 5J2UB 2EW8A 3JAKA 3P2EA 2ZKIA 1ZC3A 3BMCA 1JDBB 1B1AA 2Z95A 3NWEA 3OY2A 1R4AA 3C3CA 1B93A 4QFCA 4UBNA 1UDBA 2B4AA 2HRZA 1FSFA 3L1UA 4CM3A 3I2JA 2YOHA 2C5AA 2V6BA 2E7ZA 1SC4A 3WBJA 5ALQA 1DKLA 3RREA 4D3ZA 5BQFA 1Y98A 1J70A 3HYCA 3R5KA 1ODIA 1JQEA 3ZE2B 4P38A 3FVQA 1IN4A 1E2DA 1W87A 2A0UA 2E5WA 2H2IA 2VVTA 3IMEA 3NHBA 1RM4A 3GGPA 4MINA 4OHFA 1G3RA 4WY5A 5B3JC 3NPAA 5DHRA 3P9SA 3L0BA 3S99A 3ELWA 5BV0A 1N9ZA 5FQNA 1U8FO 3Q9LA 4F3CA 1QYXA 4AIRA 3H84A 1USWA 1RPJA 4PYNA 4XX0A 2D13A 3S2IA 3WRWA 3SEZA 4JITA 3CLSC 3N7AA 4E32A 2QMQA 2RK3A 2F64A 1E3IA 1T5LA 3TG2A 3GJ0A 5GY7A 1TVCA 1GTJ1 3PD7A 4Y9RA 3TAUA 1P0MA 3RHSA 1CZOA 3RARA 5AD1A 3HYTA 5MGNA 1A5TA 3FRJA 2WKPA 1D4ZA 4HEQA 3IFSA 3PYLA 3PUYA 5DGXA 4CODB 2BHSA 1FSGA 5C8DA 3KYDB 3K09C 3BFJA 4MV6A 4URZR 5CIWA 3W77A 2UUCB 3GJZA 4B2PA 4EY6A 4J7UA 1N3LA 1CJTC 2J9XB 1XU9A 1OLSB 5CFMA 3HJUA 3V42A 4UTOA 1OLXA 1QLJA 1RDFA 1QSGA 2P11A 3QVMA 2H7XA 5C1PA 4B7AA 2Z9CA 2B35A 2RGCA 3SX2A 5AYVA 3OQNA 4MQUA 4PGFA 4GDMA 1H93A 3OM0A 2Z9DA 4ZQBA 2A94A 2W2LA 5TMEA 3P9NA 2XYHA 4RA9B 4DPMA 1ARZA 2ATXA 1NP7A 1XO1A 2WWTA 3RYFA 2O7SA 1G63A 3FCSB 3G9QA 1OPRA 2XUJA 3RR2A 1UZAA 4P4SA 3T1VA 3UXHA 3WK9A 3KQLA 5CDFE 1NN3A 2KBEA 4M1EA 1PR6A 4K8RB 4F4DA 3T1TA 1FP4A 1D1SA 1L1EA 4DB4A 2GK6A 1CQWA 1ZI9A 3KFLA 4OIFA 5ALOA 5KSYA 2OCAA 2QTVB 3QTBA 1R3DA 3N8GA 3HWSA 3GJRA 4KWTA 5ETJA 4EEXA 1D4OA 4RUKA 2NW6A 2GCOB 1KO5A 2WJGA 3OOSA 2BFFB 1W96A 2R44A 2XHZA 4G0MA 4MVJI 4CTMA 4EF6A 1CY1A 2W2TA 3OSUA 2CD9A 4RGYA 3D4PA 5K0ZA 2IL1A 5LZ7A 3KB2A 5AP9A 5SZIA 1JZQA 3IMGA 5KWIA 4RHFA 2WUEA 4NBTA 4UTRA 4AYTA 1EBUA 2AG6A 3O95A 2N46A 4UUNA 3D2LA 3H5NA 2BC9A 3DQQA 3BICA 4W99A 3HABA 5E95A 1F0NA 4ENUA 1YBMA 2BEVB 2XTJA 2PR2A 4AJHA 3EFBA 2OBYA 1KKMA 5KX5B 1MGOA 2R6JA 4KHPB 1UAYA 3LUFA 4TRJA 1HZJA 2C2OA 4JGIA 2Y1WA 4MMZB 3LBNA 2XTZA 4RHXA 3QK7A 2MSEB 4AG5A 1N9KA 1MPTA 1RTKA 1U7PA 2X4LA 3ANNA 4K40A 4LC1A 4KXFB 2UV8A 1C3JA 1KIMA 5P21A 3F7MA 1G4AE 4U02A 1UFOA 2BEUA 2DBYA 2VJCA 4MIYA 3AEKB 5F12A 1I14A 5KNCA 2XR1A 4KTVE 4I9GA 1QCCA 2AIRA 1DG1G 2ZUEA 1E2BA 2H4WA 4TTAA 5KC9A 1Y6FA 3GLGE 2H1CA 2H51A 2WMDA 3CMCO 4U2GA 3GRAA 2WM2A 2GH1A 1RXUA 3FVVA 1XL0A 1RWBA 4HQ6A 5FAXA 2Y1OA 1FVOA 3JRNA 1JAYA 3R3YA 3UT5B 3B5EA 4F56A 4N76A 2X8LA 3EQ9A 3Q2OA 4K9KA 3BZBA 1PD1A 5TGTA 3H9BA 4YAIA 1ODFA 3I9NA 3ZGZA 1C80A 1S9DA 3C97A 1LSOA 1YRYE 3EN0A 1A5AB 1ST3A 3MWLA 1LRLA 2VTKA 2X41A 3I04A 4FT4A 4FWBA 2IX9A 2ZWMA 4G4SO 5FX2A 4OOFA 4HMQA 2LVBA 4NBRA 4GZ5A 4BNHA 4RPIA 3EAFA 2PGAA 4X61A 3CRZA 3C3EA 3RSHA 3I8XA 4C0HA 5B5SA 3J7AC 2IS6A 2HLPA 4IRXA 1JEEA 1H6DA 3B3FA 5MDHA 1FLVA 3UZUA 2OAGA 3OLZA 3BE5A 4MHSA 1IAVA 3ZEAA 3WLIA 1FUUA 5CX1B 4AXXA 3I92A 1BWSA 3JYLA 1VKRA 3LP6A 4D96A 2JD2A 3KP1A 3ZK7A 1E7YA 1SKYE 2EKLA 3N8IA 4F71A 1ZNYA 2EP5A 5EJ6A 5IS2A 2HH9A 5JFTA 3UA3A 4EJ2A 2VATA 1X0VA 1MJFA 4QEKA 1E63A 2X9NA 3KR0A 4URFA 3UMVA 5JWOA 3L7JA 3MSXA 1G6HA 4P5EA 4Y30A 2ZT7A 4GMFA 1SIUA 1IM8A 5F76A 5EWJB 5F73A 3K0KA 1WMAA 4R2JA 2BGKA 2H0QA 3GYGA 2ZQYA 3V8MA 3PQFA 4MAMA 2Q2NA 2XE7A 1QIIA 2PSHA 2D8AA 2FR1A 1LTQA 2X2FA 3HWWA 3KQOA 4XDZA 3TUJC 3KFXA 3TVYA 3P7MA 3AXTA 3DMDA 1ZU5A 2F2TA 2PH7A 1NBME 2BDUA 4GKAA 4BC0A 3E27A 1ECBA 1RWKA 4GYJA 5LYJB 1OU0A 4B0OA 4JC4A 3DMFA 3L04A 3PXDA 3TNLA 3ABSB 1MEOA 2OLEA 5FP0A 4ZVPA 4QPCA 2R1UA 4U9HS 2XQGA 3CUSA 4UHFA 2XUZA 1ZJYA 2Q4TA 4RSRA 1G5HA 3QG5A 2O57A 2XGGA 4A03A 5CYOA 3RUDA 1Y4DE 1KTIA 4WOPA 3E9ZA 2ZSUA 4BVGA 1V2GA 1P9WA 3HYNA 1UJCA 3QBEA 1CUZA 1PLJA 3E5RA 4MUGA 3L92A 4IDBA 3T38A 5HDQA 1UIRA 1EP3B 3E3AA 1KU6A 4LEIA 1RWVA 4B6OA 3OZEA 1NNEA 2VYND 4IGFA 1J56A 4NQRA 4HNAA 4AO6A 5JCXA 5JANA 4LF4B 3Q1KA 2EV9A 3C6MA 3HFJA 3RLIA 5JVDA 5H70A 2G5PA 4OA5A 5DW3A 3VGJA 1IHPA 3DMTC 2ZXUA 2OECA 4PQRA 1N2SA 1ZMBA 2ISCA 3BRWA 3FDZA 3MZ0A 3OD5A 5AKJA 4JI7B 3AUJB 1U0NA 2ZPTX 3I01M 3RS2A 1JMKC 1HURA 1PR3A 4KFCA 1KVTA 2ERCA 1G2IA 2EDCA 1YZNA 2B78A 2FP4B 3AO0B 5G1PA 4FGJA 4J0QA 3V1YA 5C1OA 5JVDF 2VN8A 4MKFA 5K1ZA 2NUTA 5CITA 3GRKA 3OFSA 3AUUA 4ND5A 4Z53A 4WE3A 2J31A 3H65A 3OCZA 3RIHA 1XP8A 4ZANA 5FEUA 4TV9B 1KI8A 2W6JD 5LQKA 5B4VA 4RKRA 2WNSA 4W5HA 3B38A 2DCMA 2AJBA 1JF8A 3IUMA 5AJTA 4HDMA 2VNKA 1B8UA 1YZKA 1XZNA 4EUSA 5KTYA 4D98A 2GCNA 4RTKA 2O2HA 3G5MA 3EF0A 2OHJA 5IXYA 3ULKA 4MUNA 5E3HA 2GD0A 4R05A 1GAQA 3DD5A 4FCWA 3V4LA 3VTAA 2YS6A 4UHCA 4IAOA 1P3JA 4WLUA 1JSZA 1X7GA 1RJ9A 1XDDA 1BQEA 3ASUA 1CQZA 4BIMA 3QPCA 3OM9A 3GLRA 3PT9A 4G86A 4IEIA 5FDFA 3JQ9C 2C5SA 4NDNE 2YZ2A 1BYUA 1P31A 3SJUA 5ERGB 5B58C 2B8WA 3V9PA 3P32A 1W36B 4LIPD 2ECPA 4Q4HA 4P84A 1M7HA 1Y1TA 1YR3A 5YASA 2OAEA 3L8ZA 1SA0B 5DJ5A 4DR7B 1JIVA 2XE8A 4QVGA 1KK2A 1P2VA 1VE9A 2ZBEA 4JYPA 4N8SA 5TF0A 3ZWQA 2J6IA 4G0OA 4D4MA 4CKCA 4QGAA 1YBVA 2ZM6B 4IF4A 2QU7A 3K5WA 4PQFA 4RESA 1QH8A 1RHRA 1Y4UA 4YWJA 1Z0KA 3IP3A 2ZVDA 4Z7QB 3GRFA 4CT5A 1HOXA 2W48A 3F5QA 2P3OA 3KPYA 1XZHA 3VU3A 4QLBA 5A2GA 1WPQA 1PO7A 2I6XA 5PGMA 3CT6A 4MYDA 1IUNA 1RI3A 4F46A 1XOIA 2F8SA 4LTMA 1EK5A 2E4XA 3BS4A 3L1HA 4W9RA 5G3ZA 4ARZA 1CRWG 5HYVA 4L5BA 3DP7A 3SJZA 3WOHA 4AB1A 5FI0B 5IN4A 5T5QA 2QUAA 3EXG1 2GXAA 3O92A 1I3CA 2QVXX 5GP1A 3PRJA 3ZVKA 4NJMA 3RRNA 1R9NA 2CJFA 3RKRA 1XPUA 2P9HA 3K32A 2VSQA 1K97A 3A9CA 1SXPA 5SYNA 5F1YA 1WU8A 4OI4A 2FNAA 1UZLA 4OQQA 1SZJG 3BJRA 3OECA 2WTAA 3R0VA 3WKCA 4DQVA 5I9LA 2HWKA 4HDCA 3FYUB 4LMBA 3I4CA 2I7CA 2RGEA 5FPPA 3EDMA 1ETHA 4TVKA 4CCSA 4YXWD 2ZTLA 4YLEA 2ZRFA 5A3QA 3CVXA 4JOQA 4YYZA 1IVYA 3JU3A 1JR6A 3W8FA 1J0CA 1IN5A 1QC5A 1RE0A 3LUGA 4X90A 3HCBA 1DFIA 4PYKA 3NDPA 1KDZA 3TR6A 4ENQA 3UMMA 2WJPA 3MQ2A 3DVLA 1CIVA 1ZD9A 3QOFA 2ZJ8A 2NTVA 3LBYA 4Y2PA 4BHTA 1JU4A 3RANA 1K66A 3OT1B 1V9SA 4P93A 3PUWA 3BRWD 1R4ZA 1QU2A 1NPYA 3A6FA 2BN4A 5C7YA 3D3WB 3L84A 4N49A 4P4LA 3DM9B 4BLVA 5BSFA 3WL7A 1LUAA 1Q92A 3DUWA 4MV3A 3KB1A 5K3CA 4RZIA 3B7PA 1ENPA 2A30A 3GVPA 2YIVX 1A69A 2VJQA 2ZJ3A 4NV1A 4DBZA 4KWEA 2EERA 1X14A 4P7GA 5IBPA 1TQHA 3L0SA 4LTDA 4J9VA 4E1BA 4GXNA 4UTNA 1MABB 2I62A 4C03A 4EMUA 3PKZA 3K8OE 3LCJA 4GC9A 3GNQA 2NUAB 2I34A 5J3JA 6ADHA 1G2PA 3NAZA 2I1QA 1C9MA 3AGPA 4QXOA 5DYWA 3EVTA 3I73A 1YXMA 4X71A 4CKYA 1GITA 5EIBC 2X3YA 1YDMA 2Z1MA 4ZT7A 1JZTA 4RENA 4F3NA 1Q0ZA 2BM1A 1XFDA 2CMDA 1NJ5A 2OHIA 2VCEA 2WIAA 4HDSA 1DCMA 4WN3A 3W5HA 4AKTA 2C4UA 4LGVA 2CFCA 3H2SA 4EG3A 4R0VA 3MTBA 1RHUA 1JIXA 3V7FA 4ATNA 3M34A 3UK1A 3HY6A 4UEWA 5BV2P 4Y7CA 3W2IA 2OG1A 1PCXA 5CM2Z 2FSVA 3BCSA 1JAZA 3MGCA 4RSMA 1U6JA 4UPEA 4L85A 2X9LA 2C42A 5CGZA 3CVYA 1ZOPA 2I4NA 1LQUA 4L8VA 4QQNA 1ZG3A 3GDGA 3IHWA 4NI5A 4UCWA 3U09A 4IJQA 4WSOA 3E35A 1XCLA 4FDTA 2DMRA 3RFCA 3DOEA 2X15A 1B14A 4W9MC 3U4DA 4B6RA 3KTAB 1LLDA 1R9MA 2R11A 5AICA 1YGPA 4HF7A 2O0HA 1YH3A 2XKJE 4URVR 1XR3A 1RKVA 4GE3A 1VJRA 4KZPA 4V3BA 1VSUA 3ISTA 4NCBA 3U7IA 4C6TB 2YICA 2KM1A 3QJYA 3AZPA 1XMQB 5LNK6 4JMPA 5E4FA 3WIBA 2GZAA 5I9IA 1WW2A 3NGLA 2X7HA 1Z36A 4H60A 1M1ZA 2WQZA 4JUFA 2QUIA 1XQ6A 4KX3A 2WBLC 3C14C 2JG3A 5EKXA 1RLUA 4ZQIA 4A0HA 5D5HA 2G72A 1T4CA 2BYTA 2A9JA 4KVAA 3MLEA 3OQIA 3R3JA 4RCVA 2ZYSA 5B1HA 3LPDA 4GHWA 5AHRA 2ZYHA 1NUSA 3HRHA 4B8ZA 1GG2A 1BVHA 3OHSX 4WCFB 2OL4A 1KORA 4R0NA 2PUTA 2W2KA 4B9AA 3HKCB 4TOIA 4DCGA 5K0EA 3H19A 1TCBA 2YR0A 1AX9A 1B16A 3MTDA 5IAJA 5IEBA 3R44A 4W8HA 3T52A 3WKBA 3CJRA 4IVQA 5ER6A 1Z4QA 3ORHA 3L7KA 4EG5A 1EFPA 1ZXBA 5F52A 2HF8A 1EVZA 1F8GA 2P9FA 4XSVA 3N59A 4CMJA 2MSNA 4MYSA 2UUAB 2VJOA 2AC2A 2O54A 4RU1A 3PSHA 3KL2A 4ABYA 2GHRA 1FDSA 2V7TA 5ICSA 4FMBB 4L2IA 5TRTA 3R3VA 1K9SA 1HNNA 3I9JA 4FHFA 4UASA 2PQMA 4JB0A 3I2FA 3MMSA 4QHTA 3DFMA 4C1NA 1RXSA 4BMCA 2DFNA 4OJYA 2ZJ6A 3EOAI 5JNWA 2FPRA 2ID9A 1G16A 2JBWA 1OXTA 1GDDA 2ZTHA 3DXXA 3GIDA 3IPRA 4ILKA 4YQZA 1ZVKA 2RCNA 4UHBA 3TGLA 2J87A 3TZLA 1XWIA 2QW0X 3X1WA 4C2AA 2ZUSA 1FMFA 1EE9A 1N2BA 4R0MA 1SVMA 1PFGA 1NVUQ 1F4PA 3VI4B 4M1TA 4OGWA 4LZAA 4G8CA 5JO9A 3PUKA 4K5QA 5IYZA 1OKKD 2WINI 1G38A 3RUAA 4P7BA 5EUMA 4X95A 4PZ0A 3P71T 2I6SA 3KTFA 2BGGA 1PFVA 1E1QA 4PINA 2ZCVA 2WF7A 1YI1A 4GI1A 3S55A 1QB7A 1Z22A 2V65A 1W8IA 2GWRA 4IFEA 3R3SA 2B4TO 1EFVB 3SS8A 3C16C 1BE1A 1NDHA 4WCFA 4M6WA 3ZHBA 1U94A 4BWVA 3DQZA 4L4YA 4R5HA 5IM4F 2PUEA 1T3LA 1V5EA 4OUKX 5AUOB 4XPZA 5A7HA 4BX0A 1H2ZA 1YMQA 2J7KA 4HN4B 1G20E 2GHQA 2C7BA 3OZFA 1ZUNA 5E9QA 1JI3A 1UFRA 4BNUA 2W00A 4TYQA 4QXQA 3LFHA 2CF5A 4JJZA 1XTVA 2P9EA 4WAUA 5IEJA 1EWQA 4NYMQ 4AP5A 3MT7A 4D4IA 4LISA 5JJBA 1JT9A 4JZYA 1V9LA 5K0GA 2JARA 2VK2A 3CPHA 3TINA 3HA5A 4C6TA 5ANRB 4JOCA 4Z9BA 4YAKA 3ZQKA 3ETEA 4XRGA 2V3CC 1UPTA 2ZYRA 3AUXA 2AUNA 2HA3A 1VPEA 4XFJA 2ZWOA 2H2WA 1HDGO 3HB0A 2CNNA 1I7PA 2WP0A 3IBCA 2ISQA 2OOSA 3QQ5A 4RVGA 3R7AA 1L5WA 5IXSA 1K7XB 1M3SA 2VJDA 1MOPA 3H5IA 4WKOA 1HYQA 1JBQA 4QXAA 5CFRA 1FVHA 2W6OA 5LFAA 2V97A 4WZBE 4GH5A 4O2BA 4JU9A 1K98A 4ZIRB 4QREA 2QYSA 1AK2A 2P0EA 4NFHA 2ZI4A 5FFFA 3UTDA 1NIPA 4FDMA 4CQJA 2FFRA 1SZPA 2GN0A 1O6ZA 3ZHVA 1BDHA 4OX9B 1SN7A 4RGBA 1RIFA 4F5EA 3KYBA 1VC2A 1XX6A 1GPMA 1V5IA 1FFAA 4LOKA 3ZGLA 3A4LA 2C7RA 2JRLA 3S5JA 1RAHA 1ZCBA 3ZI7A 4PHTA 2GAJA 1R10A 4RXMA 5I7WA 4W9NA 1GU7A 2YXNA 3S70A 3CZRA 1DEHA 4E30A 3OJXA 1P7PA 2P69A 2W6IA 4QOJA 2ZU0C 2XUPA 2GD2A 3K9BA 3L40A 4XYBA 3QMVA 1VPTA 2A1TR 1X1AA 2ZJ0A 4B43A 2EW2A 3W34A 1E3QA 4C6RA 6YASA 2GZ1A 2MYNA 1UR5A 5L3VA 3RUHA 2H1RA 2DFPA 1UAGA 1GYPA 1DKMA 1XMSA 5CM8B 3ZZNA 4G85A 4IZ6A 1MABA 3DAOA 4I50B 2LD4A 2FPUA 4QXMA 5HS6A 4CCAA 3W5DA 3U44B 4OATA 3M4JA 1LI4A 2XMZA 5K03A 3D4OA 5DNAA 1C9EA 1KZGB 3WLEA 4JL8A 5ICGA 4OA8A 1OWLA 3FCUB 3AP2A 4ZREA 3VJMA 4EITA 4TTIA 1P1CA 3FNQA 3TTYA 4NEGA 2P4QA 1JILA 3KV3O 4EQ6A 5KNBA 3RJTA 3CLSD 3B6IA 3BORA 1E2PA 1PRYA 3A3OA 3RI3A 3L8YA 4E7OA 3BTSA 3TM5A 2PX0A 4KK4A 2ANBA 3B1YA 2VOEA 1NQAO 2P9YA 4Q4AA 5FL7A 3RYTC 1SPXA 1PDWA 2OCKA 3LDUA 3PXEA 4O5AA 2AXEA 1TLLA 2QP3A 5JEEA 2AVDA 1JALA 1JHQA 4QLOA 1U3FA 3O83A 5D01A 4YRZA 2Y2UA 4KHZA 1PT6A 3OQHA 1JR3D 2V3VA 3K05A 4QWWA 1NP3A 4IQ4A 4YCJA 3VZPA 4M36A 3T9BA 4I4TB 3FHCB 4UHEA 4X62B 1E9AA 3HO1A 1XG5A 4D79A 4EDFA 4EI9A 3IULA 3CH5A 3WNVA 1E2IA 1I4TD 2DEUA 4MA5A 3QMPA 5TEVA 3IILA 1L5SA 3Q0EA 4ZA2A 4EHFA 3AMVA 4OM7A 4Y1GA 3SVTA 1TT5B 4QOFA 4P3KA 1U2DC 2HT6A 2CLHB 1U0OC 3PEYA 3ESCA 1Y4SA 1LRJA 1Z7WA 1IEVA 3AQ4A 1CQXA 3PKJA 4P4UA 3EGCA 3HHEA 1EDEA 3OIVA 2J9FA 2QX6A 2NU9A 3N2ZB 1MA0A 2ZI6A 4P4NA 4EECA 3FMGA 3I01A 5EEHA 4ARSA 2QSUA 3DZHA 4BVLA 1DUSA 3LDAA 4BPBA 2XT6A 4EW6A 3NWJA 5CG2A 2V0NA 4JFAA 1XD2B 4NBUA 3STVA 4BBJA 1RQ7A 2R7NA 4DN6A 2FMTA 4Z86A 3KZVA 4IIYA 4W1QA 4NONA 2DE0X 2ZSIA 2IXEA 3DLPX 3PS9A 3QNMA 4DIEA 1TA4A 3RWOA 3LC7O 3AOEA 1QF6A 4LZJA 3MTAA 2JEZA 2PJZA 5KTNA 1WPGA 2BKLA 4QPNA 4TXNA 5KNBH 2I78A 4QT4A 1X1EA 1R4MB 2MT9A 2XODA 4IXMA 2O5EA 4QQ8A 1I51A 3USES 3G2JA 4O4JB 4LBZA 3WWYA 1RI4A 2DFLA 4XD7A 2OQRA 4EB8A 4ASUD 1BRTA 3ICWA 2JAOA 4J29A 2ZUTA 5BVGB 2J7PD 3WMWA 3MT9A 5ALGA 1RBMA 5AMXA 1Q6ZA 1J23A 1NF3A 4HH4A 3EUEA 2VG8A 3OQ6A 1EVYA 1PGOA 4MKHA 2VEDA 2YJNA 3DTVD 3L4EA 5T4HA 1DWUA 1QLHA 4U9IS 1PTJA 3B1VA 4Y2YA 1RLTA 4XOIA 4KQXA 2OD7A 1B8NA 5ECWA 1TLFA 2BELA 4EP1A 2J0EA 2PMBA 4CV0A 3S8EA 1IEWA 5C3MA 1PK9A 2XDQA 3BMNB 4MWCA 3ETJA 1Z88A 3TLYA 1RJ9B 2OAQ1 4HJRA 1EB8A 1VL1A 2Q27A 4GX1A 1DDIA 2VYNA 2XMGA 2FVXA 4QIHA 4EBFA 2VTBB 1KRXA 4FFBB 2CCGA 3K72B 1TA9A 2QT9A 4R51A 2DH5A 2YC2C 1LLFA 3M5DA 3RRBA 3DA8A 3QFTA 2YW9A 3RIGA 1QPZA 4GMGA 2OCYC 1XN1A 4TV9F 3RVNA 3X1KA 1Z0AA 4FE7A 4D3SA 2EKPA 1T8WA 1XRLA 2GLTA 1JG1A 3GEPA 4XLZA 4R1LA 4ZU3A 3GRCA 2XJ9A 5D7BA 3WYAA 2UYCA 1U04A 2P35A 3MMNA 1JFLA 4BY9E 4PYJA 5FBWB 2ZIVB 5FPSA 2CK3D 1N2CE 5MF6A 4DDWA 3D5EA 1SHJA 5TGZA 4TV9A 1DZ3A 3GQBA 1NYQA 2A3NA 2FR8A 3BULA 3DONA 4DJJA 1A8IA 2E9SA 2UXDB 5EMMA 4BKMA 2BGIA 4X8HA 1Z4IA 4NC9A 4QZVA 3IE0A 1M2OA 4GLJA 3B6ZA 3OAAD 3KHTA 1HPLA 3ED1A 4ND7A 3JY6A 3BA1A 3R8XA 1QG0A 2C0QA 3G8DA 3O03A 4Z4GA 1GGNA 4DXHA 1DTWA 3PB3A 1E2GA 3AK4A 1DJMA 2PSEA 2VKQA 4W1PA 4BZQA 5A5EA 3MWEA 2YVUA 3N2YA 1KGSA 1E7RA 4DLPA 1YZLA 1TL7C 3HCEA 5BT9A 1N7HA 1N5LA 4J75A 3SC2B 3E7DA 2M6KA 1BU8A 3NIFB 3HRIA 2JFWA 3JX9A 3CH6A 1L5VA 4MDHA 3GQVA 4YI3A 5I4IA 4KE8A 3B70A 5EJFA 3NHUA 2X4IA 1Z12A 1S89A 1WZNA 3WDMA 2ADOA 1VIAA 4DHWA 5JH7F 1CUXA 3S29A 1DPGA 1NQTA 5AKGA 1EUQA 4I1RA 3E15A 4EBBA 5KJFA 3K9FC 4Z7OB 5LMNB 3OX1A 4DEYA 2CDRA 2CEKA 3G2KA 4R8LA 2JGDB 4B3RB 3R7NA 3WIVA 4FYPA 4ZV9A 3W9SA 2IKQA 1RFLA 2M1ZA 4EFMA 5FOSA 5C5CA 5DCWA 4KQ1A 2EAUA 5KQGA 1ITZA 2QZJA 4EELA 4BX8A 3VYSB 1LCIA 2ZYAA 3DHVA 5B55A 1AF7A 4B3SB 1TCCA 3KT0A 3PJGA 1PR5A 4NZOA 5EZ5A 1BGWA 3T7AA 1NFFA 2BTQA 3NHRA 4OLBA 4IMRA 1M5TA 4U7TB 3JQ7B 1TK2A 4C87A 1A8UA 3CCFA 2QSZA 1E6MA 3QLTA 4DR4B 3IBTA 1Z7EA 1Q15A 4GWLA 1JEOA 1Q7EA 4WADA 1WDMA 3DBVO 3M6FA 3VAAA 2IS1A 1JSCA 2XA1A 2J33A 4OB8A 3N75A 1NUUA 4MWTA 1X6VA 4G0WA 2ZT6A 1OFVA 4HB0A 4RNDB 4CQNA 3KJGA 1YB6A 2EIXA 2Z2KA 1UBMS 1KPGA 4FXOA 4O8ZA 5DYYA 2O2SA 2YVLA 1RYFA 4DJEC 4YREA 4EHBA 4FR5A 5B58T 4ZYVA 2EX1A 4MQ4A 4Q47A 4RMHA 1R6TA 2VQSA 4NCHA 1RYZA 2J9ZB 4N12A 5FF9A 5IUKC 1FFXA 4ZAVA 4A2WA 4BNWA 3KPWA 4LRQA 4GSLA 2WB2A 2GA9A 2FOXA 5JRJA 3FMFA 5TJ9A 3TNJA 3C3AA 4CDGA 5CPFA 3P0IA 1BMQA 1JG3A 5BMVB 3IMKA 1WP9A 3UWPA 3DH0A 3WMFA 4A82A 1QVZA 2B5WA 4BNFA 3LBAA 5FBKA 5HE9A 1Q7CA 3V1KA 4BNNA 1QWOA 2IQ5A 1GM5A 2YMPA 1N2CB 1V1MB 1I3KA 2F3RA 3DEJA 1BCRA 3TBFA 1G8YA 1XQWA 1SHZA 3FE2A 3K2BA 4XW2A 3WHIA 4PHHA 2IVZA 4R81A 2I2XB 1ZD8A 4BVEA 3R7DA 1PDVA 1L4UA 3SSMA 4TWBA 2CXHA 2TMGA 1DRVA 1SWVA 2WK1A 2WSLA 4MLCA 3ROTA 3W4IA 2PA3A 1QV7A 3W5UA 4U8HA 1DAOA 1U1DA 2VPXA 3C5WP 3GMTA 4AWBA 3COJA 2GTIA 2M1XA 1U3UA 3RW9A 1LPBB 3BAFA 2A9QA 2WWXA 5DDIP 2ZBPA 4WK6A 4FYJA 4JL6A 4L95C 1J2TA 2P40A 3HXKA 3GOQA 3WLTA 4NARA 5BXYA 3VX3A 1G19A 3B1FA 4C4AA 2YV1A 1SBNE 2BMEA 2C3YA 1VE7A 4Q1BA 5I5EA 3T06B 1NUHA 4Q6BA 1E60A 3KVVA 4RPJA 1G8HA 2I55A 1INLA 4DTIA 4JX8A 1AKWA 5CVUA 4GIBA 3MCZA 4JCOA 1DO0A 1ENOA 1JPUA 4Y6OA 2OO7A 4AU1A 1L5NA 3UH0A 5A9RA 1GZ7A 3DKVA 3KEQA 3EMDA 4D3XA 4EVSA 4K9PA 2YL2A 4M8SA 4WXRA 5DX0A 4IO1A 4YV1A 4ZK2A 2P68A 1FQWA 4YDSA 1EWTA 3SMQA 4M0PA 5AJYA 5AJZA 5BNZA 2FEOA 1QP4A 1WCV1 4LRUA 1ZZGA 4D0NA 1D9XA 1KBZA 1Z73A 4LF5B 4RANA 2FETA 2DUUA 3CA8A 3GWZA 3HEMA 4UAGA 2VP0A 4C0SA 3SBEA 2EJTA 1C0PA 2W5UA 1SWWA 3KQKA 1NNI1 4A16A 2R3SA 2O8EB 2JAPA 3UK7A 4UE6A 5FNVF 3RFXA 1EUCB 3EC7A 5TMBA 3MTJA 1A77A 1GUYA 1VG1A 2OC9A 3PFNA 3Q7IA 3VHLB 4CDRA 4YUZA 4US2R 5ILOA 5ALVA 1W5SA 4J7AA 1XGKA 4PAOA 5FO1A 4AJLA 3LVRE 3KLPX 3NAQA 1XD8A 4PS0A 4Z99A 4JWTA 3KOOA 3QYJA 4P4SB 4F60A 5HRCA 1IXKA 5U4XA 4S1TA 4FKMA 3W6PA 4KYIB 2B4QA 3HEAA 3BWXA 4HS4A 3CF0A 5BWOA 3CKYA 2FJ0A 3WGGA 1A5ZA 3PC4A 4KQJA 1J0DA 3JVIA 5EI5A 1TEHA 3T41A 1RKUA 2QTWB 4KNWA 3IIJA 3A0RB 1JG6A 2P65A 2WRZA 5ICEA 4RC9A 2JCBA 5EMLA 3HNRA 2FFQA 5KYYA 4JP3A 4IDDA 3SHFA 2WHPB 2H2FA 1RPTA 2DPMA 1OLSA 4DBVO 3ITEA 5E7IA 2GYUA 3LC2O 2QTFA 1JA9A 1N25A 5JDIC 4UNPA 4PZDA 5IC5A 4BXOB 2QTAA 3T0GA 2GRJA 2ORED 4HAZA 2X7JA 2YQZA 2X13A 1V4VA 1T6XA 4BVBA 1QVVA 3GLIA 1XA3A 4J3NA 2XI4A 4II2A 3ZQ6A 4GM0A 2UZ1A 4OMUA 1QVWA 2H1OA 3NC4A 1TE2A 4NYJR 4YRDA 2XGSA 3NORA 5KS2A 2FFJA 5ARDA 2WYUA 2ZU6A 4CQMD 4CN8A 3FZGA 2C5BA 2HQRA 4LOAA 5FWXA 5AW2A 1O0SA 4X3CA 4PLGA 3KE8A 4PRLA 1GZUA 4DABA 3FI0A 3RBVA 1AK9A 4KR9A 1MB3A 3RC1A 3IAFA 1P33A 1XCOA 2V7UA 3QG1A 2QU8A 2QX9A 2IGBA 3H5WA 3BTUA 1KI1A 4ZOCA 3AU9A 5D3QA 2VNIA 4MYRA 4C4TA 4JOBA 2ZREA 2R5FA 1A2QA 5BUCA 2PZBA 3RSCA 2BH2A 3JZFA 2JVJA 3ICCA 3WYBA 1WD7A 2R8RA 3M6VA 1L5HA 1W5BA 4NESA 1E1QD 5JYEA 1BD3A 3G5TA 4YP5A 4PICA 3T3DA 3ZDXB 3BYZA 3G3EA 4OMDA 1V48A 1V16A 3F2IA 4TX1A 3EMVA 2PYZA 1M2FA 3DE5X 1SVSA 5BV8A 4GAEA 4V2IA 4I3FA 2C9ZA 1JT2A 2BZSA 3DUFA 3FMOB 1QVRA 1E1LA 3VZCA 4EYQA 4F8EA 3WLFA 3GVHA 1L5KA 2TMKA 2TMDA 4GICA 4L8LA 4M8LA 3HKEB 2ZLBA 4M9XA 4BO3A 1EUDA 2WJHA 2P9BA 4IDEA 4CG2A 2FGKA 3B9RA 3HS3A 5IT9A 4P92A 1GNPA 1SCAA 1TQ8A 5J5AA 3ZLJA 1GSHA 2XDQB 3BMNA 1HF3A 5J1TB 1XZAA 3D7KA 1P2FA 1XPOA 4O2RA 1BO6A 4C06A 2IYSA 3F9IA 4NMXB 1H0KA 5BQPA 1T5HX 3W2HA 4HBGA 2OMKA 3QHPA 5JCPA 4H18A 3QXCA 5KPJA 2JA2A 3G9XA 4BMNA 4DUYB 2ZRMA 2IOQA 5JWRA 1E8DA 3ZU3A 2MDTA 1D2RA 1I01A 5K6TA 2RE8A 4OP3A 1GPNA 1Q14A 3RIYA 3TQFA 4BCDA 1TYEB 3U9SA 2GDJA 3Q87B 1SVLA 4Q3NA 4DR2B 1GAWA 4MP3A 4C30A 1NX6A 5CDSA 1J1ZA 2BFWA 1PT9A 2O2EA 1RBZA 1T6YA 3PQ6A 3WBBA 1JRLA 5KKAA 1QGUB 3EY4A 2AK3A 4MYHA 1KZ6A 4PY2A 1TEVA 4DCTA 1P1KA 3GMDA 2IIBA 1SCJA 4J0HA 4MICA 3DXZA 4JU8A 2R1ZA 4YPOA 2CWWA 4MV0A 1YVRA 2ZSJA 3PSAA 2OV8A 1G5TA 3A14A 4NRDA 4V0MA 3DFZA 3HZRA 3F8SA 5JDCA 1ML3A 2RAFA 2BSAA 3ICVA 1ZJWA 1UQRA 2BM8A 1IXZA 3N39C 4PAGA 2OCPA 1XEXA 1MVOA 3A1SA 2GVZC 8ADHA 3V8EA 2NG1A 1EH5A 3NO4A 1SHTX 1E3SA 5TVGA 4H6XA 3I61A 3DFUA 2D7DA 2X58A 1AO0A 2CXTA 3K0CA 3MIZA 1IPFA 4MS1A 2C8KA 4AK9A 3OO1A 1XRNA 1I1QB 4TL7A 4I8XA 4U7FA 3O2JA 3RC9A 1QTNA 5KUTA 2ZDQA 2OZPA 3GZNA 2HMTA 4GYWA 4PCUA 2BGWA 1Y82A 2G9ZA 4BEWA 3PV0A 4S3MA 5UKDA 5IP5A 3VC7A 4I4TA 1K3FA 5FJIA 4L8FA 2QMYA 5HBRA 3OE5A 4UNNA 4IS2A 1FK8A 4F1WA 1YJAA 3DV0B 3ASVA 3EXAA 3F8TA 4PG8A 3ZHXA