1Y82A

Conserved hypothetical protein pfu-367848-001 from pyrococcus furiosus
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
147
structure length
147
Chain Sequence
PLPPDITFDSLALIKMHSQSMKKILEITLAKFTVNLSIVTVYRYLTVRAYLKKNIELELDVLKDIYNIVPLNEEIAIKAAQIEADLMRKGMMPDIEDVLTAATAIYTKSLLITDDSKRYEPMRRFGLDTMPLDKFVKEVELMVEKEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein
publication title Conserved hypothetical protein Pfu-367848-001 from Pyrococcus furiosus
rcsb
source organism Pyrococcus furiosus
molecule tags Structural genomics, unknown function
total genus 47
structure length 147
sequence length 147
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01850 PIN PIN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1010 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold 5'-nuclease 1y82A00
3Q8LA 4XGQA 2QIPA 1V8OA 3TNDA 1V8PA 3ZD8A 5ECDA 3IX7A 1V96A 5ECYA 5HMMA 1XO1A 1TFRA 1B43A 3ORYA 3ZDDA 1A77A 1Y82A 4XGRA 5FV7A 1MC8A 1UL1X 4CHGA 2H1CA 3ZDBA 2H1OA 3H8WA 3ZD9A 3QE9Y 3H8JA 2IHNA 3ZDCA 1W8IA 5L6MB 2HWWA 1BGXT 2FE1A 1EXNA 1YE5A 5H4GA 1TAQA 2MDTA 4MJ7A 2HWYA 3Q8KA 5SV2A 2IZOA 1RXVA 3ZVKA 1UT8A 3DBOB 1TAUA 5ECWA 1UT5A 2DOKA 5K8JB 3H7IA 3H87A 3QEBZ 5HP4A 5L6LB 5ED0A 1A76A 5H4HA 3QEAZ 1RXWA 2HWXA 2BSQA 4WA8A 3I8OA 1O4WA 5HNKA 3H8SA 5HMLA 3ZDAA 2WP8J 2LCQA 3ZDEA 3Q8MA
chains in the Genus database with same CATH superfamily
4NNOA 3U4DA 5CB0A 3LW7A 3TQTA 4QM7A 2AF3C 1MENA 3RR2A 4ZT4A 3C85A 3OX2A 2ZZKA 2FPPB 4HPJB 1C4KA 4RZUA 4ZEOA 5THXA 2XNJA 4B8YA 3DZFA 4DLPA 3WLJA 1NM5A 2J59A 2ZYVX 4GBED 3TG2A 1W5FA 3LG2A 3HM2A 1OJLA 2C2OA 2M1XA 1ZNWA 1GRVA 4R9RA 2RHBA 3GFGA 3A1UA 821PA 2G0NA 3U3DA 4OI1A 1KAOA 4UTXA 2NSYA 2WLTA 4A23A 4MV5A 2IELA 1KAHA 2DPGA 4B7XA 4F3KA 3GPCA 4KNVA 3K9BA 5IT5A 1BS2A 1ZJYA 1CRLA 5EERA 1DV1A 4P4GA 1Z2OX 3RIHA 1GKIA 2BAGA 3C5WP 3AY0A 4PBRA 1Z68A 4PYNA 1TW2A 1NXOA 1C3OB 3M6AA 1NMSA 2DETA 2QVCA 1RR6A 3UJAA 4B6GA 4HQ0A 4MEJA 4I4CA 1INLA 4B6EA 3B5IA 4J4BA 4NK5A 1TYBE 3DTYA 4JOCA 2JL1A 1CQIA 4P7JA 1FYDA 4P6VF 4RX1A 2Q5FA 1COWA 5EFZA 4RANA 5A4DA 3LXMA 3HYTA 4JELA 4LYHA 4NU0A 1V8BA 1ZJ5A 4MLZA 2G09A 1E66A 4B9EA 1YDGA 2VF7A 1CW2B 4IDEA 1X1SA 3INNA 2HMVA 2ONJA 1PL0A 2X15A 1P1BA 5DN9A 4OLHA 1M6HA 4WD3A 2OZLA 1E3IA 4QARA 5IW8A 4UHFA 4HZUB 1Y1QA 3EEQA 3ICVA 3CRMA 2AZTA 3NWJA 4AWXA 1WHSB 3OCJA 4AU1A 4TL7A 3ZLTA 4BNVA 2HWUA 1MB2A 3A3YA 3V5NA 1CJMA 4FLEA 1KO5A 5JCPA 1HDYA 1T3TA 3GG2A 1V1JA 5SYAA 5PGMA 2OCBA 2BFDB 2UZ3A 3HY6A 4I9FA 1DI0A 2BEUA 4WKCA 3K0SA 3UPTA 3QK7A 4J7XA 4MJ7A 2NG1A 4OGLA 3W2EA 5FADA 4C0XA 2B0JA 1E18A 2C8LA 1J56A 1V47A 1NKTA 1YI0A 4WN9B 2WHPA 4DVJA 5CIWA 1XYVA 3QHAA 2A2ZA 4J6FA 2E5LB 4DB4A 3E22A 4BO3A 5GY7A 3C16C 2UXBB 1QJ4A 2HBRA 3D9QX 1X70A 3WX0A 3UW1A 1U3DA 3KKOA 3BVPA 2A59A 2PSEA 2AVNA 4HB0A 5I8PA 1G20A 1YVDA 2FJUA 2H5LA 1D2RA 2EF0A 3C98A 5KDLA 5BSUA 3UICA 3EUWA 2WWTA 4DREA 4ZK2A 4E2YA 2J9RA 4MA4A 1CUJA 1PWEA 2BZ0A 2QMOA 1SVOA 4CDNA 1VJGA 2DBRA 2LR0A 3NTLA 4G8BA 1O6FA 1T8UA 3DVAA 1T34A 4TWZA 1ZXXA 4C0SA 3EZGA 3CONA 5ALHA 5FBZA 1FUEA 2F8TA 2G82A 4RACA 1NRXA 1AY0A 3QGMA 1J0EA 3C41J 2FQ1A 1E63A 2R7KA 3O31A 4CF5A 1G6OA 1LTQA 1PV1A 1EAMA 2V7QD 2NZ8A 1FB5A 1AGYA 2OZPA 2Q4BA 1C3EA 4NS4A 4QXOA 4YCAA 3SQXA 2QF7A 4N12A 1U6IA 1NXSA 3II6X 4J1TC 4BS9A 3PYXA 4QUEA 1XAGA 1SOMA 4EY8A 2GN6A 3G2LA 4MW9A 4OGFA 5KNDD 2Z5VA 4LV6A 4PWZA 2AFHA 3O8NA 1N5KA 1WS6A 1LI5A 3KXPA 2ZIVB 5K3FA 4YGYA 3UUEA 4JLPA 4JI4B 3R0JA 1HDEA 5T4EA 2V7BA 4AG3A 3H13A 4RHUA 4L3OA 1E4EA 3D4IA 1I24A 2FR8C 1YBFA 2GEDA 1Z7GA 3IAEA 2O23A 4Q1DA 3V9AA 4V1CI 4J4HA 1SPXA 4C29A 5M7EA 2XXJA 1XZ8A 3OPYI 4H3SA 3TUJC 5A5EA 3VBEA 4MKGA 4DC0A 4R71A 4BN5A 3C6ZA 3VGPA 5KYYB 3OHMA 2Q2OA 3TZCA 4RKFA 5LLDA 2DECA 3L6OO 5L3SB 4GX5A 1W88B 2WF9A 3GD5A 2AF4C 2DPXA 3H2SA 4QEZA 1UEJA 3DL4A 4TN5A 4D98A 1XPUA 2O54A 1DQPA 1U3GA 3TRHA 4NNJA 5LDHA 4AS1A 2EOAA 4RJKA 5LD2C 1RYEA 1TT5B 1G5FA 2XEDA 3IEUA 3UPDA 2FU5C 2FLKA 1ONPA 2QM3A 4FP9A 3ZWAA 3HH8A 4BFVA 4EI9A 2EGGA 2YASA 3WNQA 2YYAA 4OTZA 3C5HA 2AZXA 1ILEA 4JOSA 5IXJA 4WBNA 5KTPA 4DV5B 1DKOA 2EKBA 1PGOA 1L9XA 1A88A 2G4LA 3BSSA 3CUEF 4U9IS 4V02A 1RT9A 5LXTF 1EFCA 1JV2B 2LBPA 2ZITA 4RKWA 5FFNA 3ZVMA 3MEQA 4D5EA 4TV8B 5C5CA 1LU9A 2IV3A 4P4UA 1VG8A 1IDOA 2H1SA 1STOA 1SB9A 2FG5A 2XF8A 1SVLA 3ZCQA 4OLBA 4FSDA 1KJWA 4IXNA 4N7BA 4I4LA 1VLQA 1U8EA 2JLYA 5CDHA 1EG2A 1G5QA 3HN2A 3LO5A 3T3DA 1LX7A 2ID9A 3FDZA 5KIAA 4KI7A 2EJUA 1N6OA 1U4SA 2VP9A 4A8JA 4OX9B 2HCTA 2CLOB 3ZXYA 1XYGA 1A9QA 2ZWMA 2NO1A 4GVXA 3T0GA 4B81A 4IJWA 2JEZA 4TKMA 1UBEA 3E23A 3B51X 4CI9A 1EA7A 3RT9A 3VAYA 1GD1O 1R8QA 3H5IA 4DXAA 4WESA 5I4BA 2NO0A 3MLEA 4GLLA 3K1YA 1P0MA 4UU1A 2ISQA 5JDIC 1K7SN 4C2AA 1YS9A 1SCUA 3SNKA 3MELA 2AOUA 4MKZA 3CUSA 1SBHA 4EA6A 5JAZA 5CGZA 5E7MA 5LU8A 3RRMA 4F45A 2QZ4A 3SC2A 3E7FA 2DBVO 3KYIB 2XZTA 4YECA 4DJTA 1ZBDA 5BWBA 3SPXA 1ZL0A 4A16A 3WDSA 4X6YA 1BMTA 4B3XA 2HDHA 1KE2A 3C6XA 3E4DA 3GGDA 4YCNA 4JK3A 3R0VA 5HS4A 1I7SB 1NQUA 2GXUA 2BM1A 1ODJA 3OOYA 4FDMA 4KXWA 4PFQA 3K5WA 1U7WA 1FUIA 5E4YA 3AC0A 5KCMA 4J0FA 4KWEA 3D4LA 4ZVPA 3Q88A 3TIFA 4EVRA 3L93A 1JQ3A 4QO8A 2GLXA 5BMVA 1DO0A 1IC6A 3CSSA 1FF9A 1LSOA 4YI5A 5AKLA 1ZONA 1TAHA 1UPTA 3A3OA 1F38A 4JJGA 4OU5A 4DMHA 2YIMA 1JEOA 2OEPA 3KTAB 3MINB 1XSEA 4O2BA 4B71A 1UPUA 1ZGAA 2OHIA 3DYBA 4LHWA 5EMNA 1CQXA 2YHIB 2VZLA 1P74A 3HBJA 4J0GA 1UFOA 2OUIA 4YWJA 2IODA 1RC8A 3H0EA 2ZKIA 4MJLA 4AUNA 1GIAA 2HU8A 3AXSA 2ZBDA 5KX5A 3FFWA 1DWPA 5A3QA 4DM3A 1JBQA 1V7ZA 4FNOA 3JQ8B 4M49A 3E9QA 1J2TA 3B13B 1ZNYA 4OPMA 2ZJ1A 3V00A 2W2KA 4F9TA 2TSYB 2XMPA 1IK6A 3CIOA 2H7YA 3U4IA 1EM8A 1N36B 1Z17A 1XXHB 1DHTA 4U2CA 4C7JA 1C3LA 1DELA 2WZDA 4FYPA 4NMLA 4DCPA 2C3YA 4TYWA 2JRCA 2R6DA 2RHTA 1YGYA 3BRCA 3IT1A 4JXZA 1JU3A 1ZKDA 3QU7A 1IEXA 8MHTA 1B2RA 1V9LA 5FP0A 4ZZ3A 1GPAA 1WKBA 3BTSA 5LL6P 5JQGA 2IP2A 3GAZA 4RQUA 4YUXA 1CXZA 4MW7A 1E5VA 4D1YA 2FR1A 1NUTA 3RC8A 4KRGA 3H1FA 1QYVA 4CWAA 3KSAC 1BXRA 3W7VA 3WLIA 2XCOA 3NAMA 4KNWA 4LHYA 3N76A 1TMYA 3VR3D 1AKYA 3WK7A 4F4CA 1TL7C 1SU6A 1CUUA 1JBEA 4XQ9A 4K0RA 2AN3A 1SZCA 2H9YA 1Z38A 1J06A 4L27A 2M6KA 2QLLA 3K09C 2ZCJA 1KA9H 3D0RA 3NBUA 4WOCA 4AJ9A 4KQJA 2RHJA 1BWRA 2PSSA 1EXMA 4JKOA 2POQX 4D5GA 4QPZA 2GT1A 4E5NA 3I6QA 1CF9A 5GZ1A 2MIIA 3CEHA 3ZDRA 1AF4A 3V2IA 1QP0A 1VL6A 1GTMA 4QDTA 1WUJS 2BCJQ 4CQMA 4YV7A 3ST7A 2I2CA 2OO7A 3O94A 4IOJA 3HVUA 4NZYA 3EXG2 4LXGA 5AM4A 1NUAA 1V45E 5E7QA 4BUCA 3O4VA 3V3KA 2ZJ4A 1EIWA 2RGBA 2AXPA 4X41A 2JPDA 2RAUA 2EJWA 1YCDA 2FG6C 3KCNA 2B9EA 3QXSA 4GBJA 4H7FA 2B5VA 3QV2A 4I2VA 4MITA 5C7OO 1WBDA 2NAPA 2FSSA 5KYNA 2BUCA 2RHMA 4O2AB 4XM1A 1J25A 1A9OA 1JDZA 1VXOA 5JMWA 5KSYA 4JUFA 3NC1C 4F5YA 3FVWA 3P2IA 4BP9A 4QL3A 3W34A 3KYCB 2XXAB 4S1WA 1PBTA 4HNUA 4WXPA 3QPUA 3G1UA 3IURA 1S9HA 4I5FA 1YTLA 2OD2A 4FW9A 3J81k 1CERA 3WB1A 4MA0A 2HSEA 3DGEC 4BBZA 4BP3A 4NL4H 3E2MA 3UPUA 4ISCA 1TYAE 4TLBA 2GYUA 3LRTA 5BN5A 4DFDA 1VGQA 4GBMA 4OAPA 4BEVA 1V39A 4IM7A 1LUAA 4R3NA 5K0GA 1J4AA 3UO8B 3QWAA 3AF1A 2HZBA 4QUGA 1Y37A 4WZAA 3L7KA 4RFVA 4EVQA 1YK1A 3WLTA 1PG5A 3C3PA 1N7HA 4LFCB 4B1FA 1NV8A 3PUJA 2GNPA 2PO7A 5G0UA 2O3RA 3CZQA 4NBTA 3W5VA 4ER6A 3DFUA 4CQLA 1W87A 5CM8B 3SF0A 2PL1A 1WM1A 4BU1A 3TW6A 2PVPA 2I7VA 2POCA 2FQYA 2ZIAA 3ESAA 4J0KA 4UZEA 3I05A 4EBFA 2Z6AA 2JBWA 4KX5A 4NZZA 5CD9A 2LDBA 1DEOA 1IPEA 3MCTA 1DL5A 3NV9A 4G1BA 4R2LA 3OT5A 4YFVA 3PFBA 6LDHA 1CR6A 4YXFA 3PEWA 3DWGA 3ONVA 1EK6A 1KR2A 2YXBA 1X87A 4L78A 3R9XA 1T9DA 3PV0A 3H6HA 4YRCA 5DE3A 5EZ5A 5H70A 4RA9A 1YMVA 3A1TA 3K8QA 3ZN2A 4EW1A 4DSZA 3GWZA 4BZXA 4ZANA 3DFKA 4CW7A 3PUIA 2IK8A 4ZYTA 3PNQA 1IDN1 1U2PA 4N5IX 3OKFA 2YIJA 5KJCA 4MEBA 3VO2A 5J2TF 4G2TA 1YJCA 4X1YA 2ZYAA 1JXOA 1NIJA 5SZJA 3PNKA 3RAGA 4E30A 3C14C 1HXHA 5DO9A 1AKEA 2REBA 3F6PA 5MDHA 2ZIXA 3FLEA 2Z56A 4OI4A 4QT4A 5KOHB 4ZICA 2NYUA 3UXMA 1HUQA 4ASUA 4ZQCB 1OJ7A 1ULBA 2YMLA 3FDIA 3SMQA 5J4HA 1M1YB 2FRDC 1ADFA 2Q3LA 5B5SA 5AKXA 2WWGA 4MDHA 2UZ1A 2PTGA 3FTCA 1BEEA 3NYQA 1M6EX 3NWEA 2OR3A 3HP4A 3U2QA 1PWHA 3I62A 1GHTA 1N2JA 1KQFA 3M8KA 4H27A 1G7SA 4PHTA 1W1WA 2GQ0A 5I01A 4GRIA 3LNTA 3SD7A 2C3PA 3LCJA 4GGMX 3CJRA 3SZRA 3AB3A 2P9BA 4NENA 3DLTA 1JGTA 2XUIA 4DJEC 3OJFA 2GRAA 1VYHA 1W0JD 2HZ7A 3IPYA 3NVAA 1EX9A 2PMFA 4Q39A 4YIKA 2GHQA 2ZI4A 13PKA 3S2EA 1U9YA 5IARA 4KOEC 3RVLA 1KXJA 1JU4A 3OQBA 2GA8A 4YJ3B 3OLWA 1YDEA 3CEPB 3IS3A 3PYLA 4AN0A 1A9XA 3H9CA 3CRW1 3BJEA 3ZHVA 1MO2A 2NGRA 4Y2RA 4BUZA 2FHPA 2GCIA 3OQIA 2GYWA 2IDJA 1OHHA 1DFGA 2MR6A 3HZOA 4CCYB 4RGVA 1KE1A 3KQTA 2O9JA 3F9RA 2B35A 4N03A 1UT8A 4V0KA 4D8UA 2EFHB 4MUJA 1GQFA 5CA0F 1XG5A 5B53A 1V9CA 1TLTA 2Y0EA 3A6DA 2BKVA 4OL9A 3CT6A 4S3MA 3IAUA 3GLFB 1GKUB 1ID8A 3WRXA 4YRPA 1UR5A 1ZINA 3TG8A 4A36A 4ZTUB 1X7DA 1IN1A 1Y34E 3AFMA 3BULA 2W9XA 4G5YA 4HWKA 4CM1A 3H5OA 4G07A 1JS1X 1NR1A 4HWOA 4JT4A 2QXYA 1W4CA 3EVBA 2ATCA 1RWXA 4Q18A 5EYPA 1PFUA 4ZAFA 1MC1A 1P7PA 4ZEWA 3W1EA 2OE2A 1QHIA 1ZA2A 5DLPA 2IPMA 1OH5A 1SR8A 1AKUA 4CU5A 1GYQA 4D9MA 2VHXA 1O8BA 1Z5ZA 1O54A 2Y93A 4LBZA 3HCWA 2I7XA 4YMHA 1MJGA 1GZSA 2A9OA 3O1LA 5EMJA 3QUCA 4F2WA 2ZUDA 5E0KB 3L7DA 3T41A 4L16A 2ATEA 1MRNA 2B61A 2BGKA 2QN8A 3MMNA 4GKVA 3WLRA 4HDCA 3BA1A 1LWNA 4L4XA 1CZOA 5JO0A 2YN4A 2BDEA 1K63A 2H4XA 2QR5A 2E4VA 5CLGA 2YV5A 2AOTA 3C3DA 3TNDA 4TYNA 1VE3A 4O0LA 5B1DA 3WIDA 5FWYA 4MQ5A 3SYLA 1FFDA 421PA 4ZCLA 3HKEB 4JUIA 1DGQA 3RM3A 4E1AA 3O47A 2HJ9A 1YOBA 2AN1A 1ZUWA 1TGYA 3GLHE 4ZQBA 3QJGA 4Q3OA 1MR3F 3ZU4A 3ZLUA 4BMZA 5CDTA 3ZTYA 1G17A 3CUYA 1CBUA 1LDBA 1W25A 1T0IA 1VL0A 2AS0A 4Y1GA 1KDTA 1ZMXA 5DRYA 3U39A 3UK6A 1EESA 5K0BA 5AKJA 7MHTA 1MV5A 2XOKA 3GEMA 4YRNA 4R8VA 3DLHA 3PXAA 4X8MA 2G5GX 4EDHA 4EPWA 1R4MB 3FWKA 4MR7B 4CYMA 3C45A 1YS2X 3C1OA 2CSUA 1MAAA 2YRXA 3RFTA 4KK3A 1G0NA 2NTYC 3AEYA 3QE3A 3D2AA 4U7GA 1LDMA 4ZDIA 1UZAA 2AVDA 4RWEA 3LOPA 2IC5A 3MF4A 4GPIB 3EQ6A 4KWTA 1JHMA 3FBGA 2UYHA 1X38A 1J0DA 5AVOA 4JC0A 4CEIB 1GYPA 3HCPA 4I9GA 1KAQA 2XXBA 4J1TA 4L8VA 3V1NA 1YCHA 3RUHA 3HBNA 3NT2A 1W85B 4BVBA 1W581 4L28A 1V6AA 1EI9A 2X2FA 3HDGA 1CTQA 3GFRA 2NXEA 1OC4A 4QVGA 3ICQB 2JLUA 4YO7A 4IMPA 3GFBA 5AUPB 1W76A 3L46A 3NONA 3M89A 1HOTA 2YVQA 3K71B 4HAXA 2HMSA 3GH1A 2OYCA 2CD9A 2C7PA 5AI9A 3IP6A 5DYWA 2AHOA 5HFJA 1KIAA 3UHAA 1U2TA 4KRFA 1WMFA 2PA3A 3DXFA 4ZODA 3SE0A 5GM1A 4MRMA 2I76A 2QRKA 2PHZA 1JR3D 5KOYA 3C8HA 2GEFA 2FWMX 2EV9A 5HG0A 4BBJA 4FB4A 5CLJA 3WKDA 1M10A 4II7A 3STHA 2KW5A 2GHRA 1ZUNB 4RFSB 621PA 1TAUA 1PF7E 3NCHA 4RDHA 4XQEA 1CB7A 2DHQA 4BGVA 2D0IA 4K6CA 3J7AC 4LHXA 1W4RA 2ZR9A 4PX3A 3UWOA 2C8JA 1FDUA 4HYTA 5AVUA 4URYR 2IV2X 1QO7A 1QK5A 1FQWA 1NZDA 3GPDG 3R24A 1OTXA 5DDIP 5E6UA 1T2VA 2PMEA 4HNGA 3ZHXA 4DW8A 3CUWA 1XKXA 3N0WA 1IVYA 4AZTA 4UZSA 3OQIB 2UV8A 4X7BA 5ALUA 4ZGWA 3ANYB 3WDKA 5HDQA 1LJUA 4EVIA 4QYSA 6Q21A 5IXYA 1L1RA 4DQ0A 3MNFA 2G28A 3HP1A 4HFNA 1EHIA 2PX3A 1HY3A 4D80A 2DQSA 1SXHA 2B4TO 1X14A 1GSAA 1ZRNA 2OORA 1JIIA 1T8PA 3L0SA 1E6WA 1PEKE 4RZSA 1H0HA 3CZ9A 4LI0A 3TH5A 3Q3HA 5LQAA 3DZHA 4FEGA 1T9GS 3A1NA 3CPHA 4K9PA 3GLUA 4MB0A 2SICE 4MHOA 2C84A 1K4YA 2OBLA 4JP1A 3UTDA 3O82A 4L95C 3ETCA 1JHXA 4M7PA 3U9TA 2DQYA 3ZEIA 2O2GA 1VPDA 3PWSA 3UJ9A 3CKKA 5BNFA 5JDIA 2Q2VA 5F51A 1IN6A 1H2HA 5ILQA 1UBTS 3B6ZA 1RI4A 4N47A 1NJ1A 1SURA 4CLEA 1EUYA 4LZJA 3F7MA 3HUEA 5JV5A 5FTWA 1FRVA 3B78A 3KJXA 3ANNA 1A7JA 4TTAA 5IJWA 5FWDA 3D1JA 1UDBA 2C5LA 1VOTA 1P2UA 3IHKA 4ZVLA 1Q1ZA 2HMAA 2ZBEA 3D0KA 3UFXA 2CXRA 2XB6A 1YVEI 3D3KA 1RKVA 4JWTA 4YALA 1CUAA 3BEDA 4QX6A 5G3YA 1Y8ZA 1ABFA 4B7ZA 3DAFA 4P80A 1IQPA 4OLAA 2J9FA 1W4ZA 1A27A 5REQB 1PR5A 2G3YA 2Q8QA 3NXSA 1EFVB 3S8MA 3K4HA 1W1IA 2O2JA 4DABA 4C43A 1D09A 1UFVA 2W2NA 5FI0B 2IH5A 4FKBA 1V5GA 1ZAKA 2XZDA 3MGCA 5HZGA 1WVMA 4L72A 1ZOIA 2D5AA 4NCNA 2P2NA 3SN6A 4BNUA 4CM4A 3N5CA 2FZVA 3R2JA 4HPXB 3ZVLA 1BE0A 5HRAA 4RV4A 3SEQA 4ALIA 2ZUSA 2P0YA 2P2DA 4AKGA 1W47A 3KLMX 1ZICA 4L85A 2QVGA 4TV8F 1P0IA 3FFXA 4UUOA 5JBNA 4CG1A 1WP4A 3RS2A 1YL5A 2HV9A 4FYVA 4E5PA 3L04A 4H4CA 3I52A 3RSGA 3ZCPA 3U1BA 3ZR4B 1VDZA 4NFYA 5DTMA 1G42A 1PSWA 3FMVA 3B6MA 3NLLA 1A7KA 2HA0A 3AF6A 1FDTA 1QTQA 2ZWPA 3DDHA 5CX1A 4A2CA 1Q0TA 2VRNA 4OP3A 4JBNA 1Y89A 3SKVA 1XDWA 2F62A 2G1JA 1BXGB 2J0QA 4GLJA 1KAEA 5C8YA 3FPEA 2HMTA 4PR0A 5CNIA 1DC7A 5FL7D 4CM8B 2R86A 3VYVA 2JIDA 4A0HA 4BZQA 1C8KA 3MJSA 4YJ2B 5IDWA 5GIPE 3VUEA 4YFYA 1FNCA 1QGAA 4I4TA 4DARA 2XTZA 4S2EA 1HLGA 5EY5B 5BW4A 1JSXA 3NBYC 4DQVA 5JZOA 1GUAA 5ECWA 3AEUA 3MTGA 2CFTA 3SJZA 1OFUA 4DF3A 3EEOA 4B3MB 3G2HA 2XBMA 2BMDA 2O1WA 4IVPA 4XQGA 4DIDA 1JH8A 3I42A 2WFMA 4L7VA 2CVHA 4L9SA 3O4RA 2GCEA 2ON6A 1JJ7A 4KDFA 4FMBB 1X7HA 3H87A 1P61B 2QTRA 3JRNA 3LPNA 5FLYA 3OCXA 4EY6A 3BQ9A 4RYLA 2QP3A 2ENUA 1MZPA 3KT0A 4XUGB 3EPPA 4G63A 4I99A 2H00A 5KSZA 2DPMA 1L5ZA 1WVGA 4TS3A 4B2LA 3E2PA 1DZ3A 3GPIA 5DSZA 5AKGA 2W6NA 2E0IA 2BEWA 2W6IA 3AJDA 5CVDA 5A4JA 4WV3A 1D7OA 1T4CB 2GJ9A 2Q6OA 5BPHA 3LZDA 3L5OA 5GPBA 3QKSA 2FSFA 3G0OA 2C31A 2ZU0C 3DOFA 1RACA 4OSPA 1G41A 3JQ9C 1Z83A 2UAGA 3PTLA 5D51S 3O2SB 1N2IA 3Q9LA 4L4RA 2FLWA 3P0JA 3VPGA 4CMEA 3KOUA 3ZHTA 4R31A 1ADGA 1GARA 3LRXA 2ZXEA 1X8XA 3D43A 3WB2A 2YW2A 4RSHA 4BNLA 3CXRA 3HZRA 2YY5A 4GPEA 2QVBA 1YDMA 1Z2PX 5ECDA 3K1ZA 2HUNA 5EVCA 1SBYA 2XT6A 4INOA 4IFTA 3U7IA 4LCJA 1X42A 3QEKA 4UE2A 3UGTA 1QHGA 4QU8A 1REQA 1DBRA 3VV2A 3KFXA 4RPJA 4C89A 3O84A 2BW0A 5I3ZA 1QK3A 2BFWA 2QTCA 3GJ5A 3LUCA 1P2BA 3NHFA 4DSAA 4QOSA 7GPBA 2XV1A 3GRCA 4D8YA 2WD7A 4FI3C 4OBWA 2OENG 1Y5LA 1M76A 2QZPA 3NHPA 1R8JA 3O75A 1P77A 1OXKB 2R7NA 2ZFUA 1E1CB 4FKZA 1GVNB 5BSEA 4OHZA 5MF6A 3T7JA 5DRTA 4B4OA 2FGKA 5GONA 3ZWXA 2OT3B 3C3AA 5KU1A 1CDOA 3CGWA 1KWKA 1QH0A 4J0IA 2BM8A 2IU0A 1SVIA 4MUYA 4IDOA 1GRCA 1QBGA 1TADA 5JD3A 2A9KA 2JJMA 2QI9F 1GAEO 3AJAA 1V71A 3GDWA 5BQOA 5AVVA 1WOYA 1TO6A 2ZAOA 4B3RB 2XIQA 1IIRA 2FF5A 1UBRS 4BC0A 5C2JB 1HFWA 2ZBVA 1FA9A 3TLXA 2WILA 4GICA 4D02A 4LDAA 4YUVA 1T10A 1QPBA 3V33A 3ZQ6A 3WJ7A 1DJQA 3KPYA 1ZVVA 2CDBA 1XLTC 2PLAA 5AJZA 5ILGA 2VKQA 3AVPA 1VPVA 2HL6A 2RHHA 1V35A 3PUXA 3CVXA 1DQNA 1YU6A 4YP7A 1KQNA 1NMQA 3SEAA 4RFLA 2G07A 3K3PA 4WXYB 4DMCA 1NVXQ 1UBUS 1VSQA 2DG2A 1U0FA 3WKEA 2NXWA 3RFVA 1PR9A 2AE2A 5KC9A 2KHZA 1TEXA 5KOJA 2LWIA 1HZZC 2CKMA 2OAQ1 4RHXA 1U3VA 1C0LA 4O2AF 1WVIA 3F9IA 4TWJA 4TVOA 3IVMA 1KETA 1JQBA 1CP2A 5H3LA 5A3SA 2PUFA 5JVDA 3TZBA 2C2WA 2J30A 3MVEA 1H4QA 1KYZA 4RE5A 4DR4B 3NHYA 2NUPB 1KPGA 5C8YB 3BBPA 4X7RA 4NJEA 2Z2KA 2FRDA 4L6IA 4II3A 4CM9A 3P9CA 1BXKA 1NXVA 1QQTA 5TLSA 1TZBA 1PU2A 1SJ9A 3HMKA 5EPUA 4CE6A 5A5FA 1NUSA 4G1UC 4PHCA 3TR6A 1W96A 3A4NA 3QA9A 4HQ6A 1APBA 1DFIA 2D7CA 2FW9A 3S44A 2VYVA 2YZ7A 3F4LA 3A27A 3ZK9A 1M5RA 3AM3A 3JATA 1IMOA 2G8LA 1CUFA 1JIVA 2FUEA 3PPVA 1UC9A 2ET6A 4FYWA 4LISA 5EKDA 4YQZA 5CCBA 2WHRA 2FUKA 1CDZA 2K4MA 5KJFA 2CBGA 4GVPA 4Z4FA 3TGLA 1XP5A 2OO3A 2ZE8A 4W82A 3V7WA 3D81A 2J3QA 4BVEA 3JALA 1L5WA 1YQGA 3D2CA 4UNNA 3U3OA 1QZ3A 1SY7A 2I7DA 2PGIA 2ST1A 3OZUA 4JBIA 1CULC 1DUSA 1QYIA 1ZJ6A 3MSXA 4UPDA 3DF7A 2VKTA 3TBFA 3PHBE 3U26A 4K9OA 1EYZA 2G7MC 2I4IA 3A3NA 2DWUA 3FVRA 3N86A 2ZS9A 2R1TB 4P7FA 2PBFA 2ZRLA 5ECYA 4DDUA 5I9LA 4XWWA 3QXJA 4OA8A 1XJWA 1HE8B 4I19A 1KVUA 1AUOA 4YN3A 1UQUA 4U2KA 4J1SA 3IALA 2GK7A 4WZBA 3LECA 2WUVA 2X5XA 4IZIA 1RXIA 4D3ZA 4FXPA 2R2AA 2OGTA 2DERA 5EP1A 3QVTA 5ICGA 5TPWA 5B37A 1LW7A 1RYDA 4ZO6A 3U4GA 3EGXB 3IVXA 1Y6QA 2AYXA 2GUWA 1P0CA 2JJ1D 3FPHA 4JEIA 4GKJB 1SCDA 1Z0UA 1JPJA 2OSBA 4Q19A 4YV2A 4DT1A 3FG9A 4Q1AA 2GD0A 1TMGE 3U4QB 4ZHQA 4DLVA 4JVMA 2CXOA 5GONB 2VCHA 4Q1FA 3GA0A 4Z8YA 1YK0A 2BR4A 4WLVA 3FRHA 4KPGA 5F9HA 4G86A 1TCCA 5GGXA 3SR3A 1D1QA 4GZLA 3GXBA 1RWOA 2Z9CA 3U5ZB 3IMFA 3MWEA 1GZ4A 1AQLA 1SBZA 2RHDA 3E1SA 3ME5A 4PQYA 3HS3A 4P5PA 1ONSA 4ETIA 1M3SA 4RVSA 1NUPA 2EZUA 4XOIA 1Q0RA 4S1VA 1R15A 4KZKA 4XTRA 3ND5A 4NWIA 1Z56C 4G9GA 1FDIA 3LDAA 2VJKA 2YWEA 1HR0B 2PDAA 4G1VA 4YJ3F 2XVYA 3NPMA 3QWIA 8ADHA 4WASA 4IIEA 2IYOA 2FPRA 4BB5A 1AO0A 1KP9A 3E9CA 5F1OA 2WSSA 1ZN2A 3W2HA 1UJBA 4EA7A 2MTBA 5K6RA 1XTJA 2GZ3A 3S2SA 3KVYA 4KO2S 2R48A 2C3MA 3I9LA 3ANSA 5LKAA 5EQTA 1EDEA 1M2EA 3NWBA 1QO0D 1LGYA 3AT1A 3HV0A 3GZJA 3L8MA 3SQLA 4DA7A 3F1LA 1ZITA 1TIPA 1XEXB 3PWZA 4G26A 3I04M 2I78A 3PUWA 3S2FA 1QG6A 1MJHA 5CCDA 4DA0A 1E77A 3IB3A 1JJFA 2R97A 3L9XA 3QEBZ 1MA0A 1MG5A 5KREA 1BHSA 2GM4A 4LG1A 1GG9A 3ZE8A 5CTJA 3R9IA 2OY0A 1KTIA 4ZOAA 1H6CA 4YNBA 3VQTA 1ACMA 1ZZEA 4KQ6A 4PX5A 4ZEMA 4BB6A 3EXHB 3ZU3A 3EDRA 4ZDKA 3QYJA 3RYIA 2QGZA 4DJAA 2WM9B 1SXJC 4QJIA 1KOGA 1E4VA 5D7BA 3QFFA 5FA5A 4YJGB 1J39A 1XTZA 3PXDA 5G4KA 4CPDA 4EMBA 3UT6A 3IXQA 4PXAA 2I6XA 3IQWA 1CY6A 1VB3A 1Y5NA 1M0SA 1P5JA 3AINA 3OJXA 4AJHA 3BWBA 2YJZA 4E2WA 5JADA 1OT3A 2ODNA 3IPCA 4DQUA 1HYEA 1VMIA 3DBIA 4MQFB 1BJTA 3KX2A 4NYIQ 4PGAA 5LKRA 1U1FA 3TTWA 4YUZA 1MH9A 5AHXA 1YIDA 4TL6A 3FHOA 1GEEA 1SU4A 1EM6A 5J2UA 1XAIA 2XQFA 2VHEA 1Y3BE 4DR3B 3DLCA 3BORA 5EAIA 3IEMA 1I8TA 2HPZA 2JDID 1NT2A 2VJBA 1B43A 1ECJA 2R62A 4KQIA 4YLGA 1U7DA 3WYAA 4OLJA 4MVJE 4O4JA 2L19A 3LBAA 4MR8B 1OH6A 3GNLA 2HY7A 4E21A 4DS3A 4KE6A 4P36A 4PCAA 3JALB 1JHPA 1EPUA 5DX0A 1SC4A 3U3MA 2OXCA 3AVVA 3LLCA 1TTQB 4JWKA 2QD4A 1G64A 2DH6A 5D6OA 2CEKA 2FFHA 5CFQA 1DC8A 3IH5A 4RHTA 3HWRA 2VCYA 4XH9B 1ILWA 2A5LA 4R01A 4RDCA 5FHRA 4DVGA 4KVFA 2GFQA 1MV8A 3ZTTA 4CKWB 2ZQZA 3SX0A 5BMOA 3K6SA 1Q12A 1Q6YA 4QQNA 1UQTA 3C1AA 4US0R 2JH3A 2PEZA 2Q3FA 4J8PA 1YJXA 2GSWA 2N1BA 1AN0A 4QEKA 1BS9A 3GFOA 4GVLA 4X61A 5FCDA 5TY0A 1DCMA 5E4FA 3U0VA 10MHA 3KQMA 1FTSA 2V7WA 3BH6A 1EHYA 1HX7A 1CY0A 5B2FA 1EXVA 4CFSA 4B8ZA 3O9VA 4AY3A 3AGPA 2V59A 5TIIA 3I1JA 1ZSNA 1LRJA 1QDEA 2WM3A 3TEFA 4D9BA 3ZDQA 2J4FA 1OZGA 2HA6A 2QAIA 3P27A 4L4SA 5G0TA 7REQB 2X76A 5HA5A 2ZJOA 1T1IA 4MINA 3IDQA 2OHOA 2BL4A 3HTXA 2PANA 5KMGA 3PZBA 2Y1FA 4HGZA 1C1DB 1ZM7A 4DLZA 1NYQA 4GR5A 5U4XA 5K8UA 2KX7A 4LY9A 2JRLA 1YB2A 3FUXA 4F5WA 2YXEA 2XTAA 1T4MA 3WL6A 1U90A 4WNCA 2JGIA 2I3DA 4M36A 3V2GA 2L82A 1JJVA 1KKMA 1QF9A 2YH2A 4JYMA 4OKNA 4Q15A 3BH0A 4W9NA 1QV7A 4NPCA 1LQUA 1YS4A 4M4SA 4WTOA 1GKLA 4ND4A 3SZOA 4DMKA 1UXIA 2E4ZA 1YBVA 2HUPA 3N2EA 3PQ6A 4MKRA 2AFIB 4X7MA 4B32A 4D26A 2VK4A 2BCGY 1LDYA 3F5FA 1OUMA 3PENA 2JCSA 4EATA 3CUVA 1SH7A 1OYWA 5CK5A 1LV8A 3NDIA 2E3JA 2Q3DA 4TVBA 2WM8A 4AJNA 1JIJA 4BX3A 4WKBA 4FFNA 4PV7A 3I9FA 5AM5A 3ND8A 1AGPA 4I50B 2GDZA 3HWX1 2P2LA 3UAZA 3LL7A 2WR8A 2QZZA 3ZDFA 4M88A 5C1IA 5IK2D 1R0KA 4TKUA 1QIHA 1QG4A 1Q11A 1TCBA 3I6YA 4X85A 3MWJA 5HTKA 5L3RA 4XCXA 2OZEA 1QH1B 1KY5A 3N7AA 4RD4A 3H2ZA 4KN6A 4A5SA 3TAHA 1TA0A 2QTWB 3LLVA 2GO7A 1NN0A 2X1LA 3MJEA 4LXXA 5G2OA 2O7QA 4FD2A 2AQIA 1EVZA 3W3AA 4Q66C 2XZOA 1DRVA 1NBHA 3OEWA 5ICFA 2XECA 5AUOB 5GVSA 2K7FA 5T8KC 2PVSA 2ZM5A 3AO0B 1K92A 1N77A 2VJNA 3LC1O 4ZMRA 3ZIAA 4KLNA 2ZJ3A 1C8VB 3DXXA 1RZRA 2C03A 3OY7A 4WH0A 3BMNB 1T2DA 1P0QA 4KQGA 1DWOA 3AUFA 3KR9A 1WNFA 4QOEA 4M9XA 1N33B 1TT7A 3K0AA 3IUEA 1TEZA 2HH9A 1UUFA 1XVTA 4ZRMA 1RLUA 3K92A 4HN4B 5FQNA 4C0KA 5KSOA 4G97A 3WIUA 4PRZA 3RYIB 1EGHA 1EJBA 3OUUA 2D5CA 4JLBA 4M37A 4LEIA 2FPLA 1GPKA 2A33A 1NNLA 5FNVA 5B1HA 4JYZA 4QA9A 5H3CA 2HF7A 1Z62A 2J67A 1V7PC 2W6ZA 1USIA 1SO8A 1UXOA 3AUSA 5AIBA 2EYQA 3AP3A 3WKBA 1N0VC 3FNRA 1VYVA 3W8NA 5KVQA 4K6OA 3PNLA 1FQKA 5B30A 1XPOA 2FZGA 2B1JA 4N4AA 4P8RA 3WLHA 2W2QA 1X39A 1S2IA 1MKYA 4I8XA 1TZCA 2J3KA 4L5BA 4UHHA 4EYKA 2QVXX 1RBYA 1VE7A 2FVYA 1ZY2A 2W93A 3BF8A 3EEIA 1RI2A 4HDSB 4BQOA 6NULA 2VVTA 4M9UA 3SSMA 4IFIA 3TPZA 1M8KA 4CCAA 3GR6A 3UHOA 4I1OA 4U9HS 4D4HA 4K6KA 1QLJA 2PIDA 5KQPA 3E1GA 1Q1AA 1VKZA 4MXDA 4EHBA 2I34A 2UUPA 4Q4HA 2VSQA 2EU8A 4DUZB 3WDMA 3N2ZB 3X1KA 1KJNA 2XDQB 4QUIA 2QTLA 4R54A 4TTIA 5CNMA 5IKOA 3K0CA 3WWYA 5A2QA 3IQFA 2XE6A 4Q01A 1O0CA 1ELOA 2DCMA 3G0GA 1W5SA 1H8EA 4GNKA 4YEDA 3VVCA 4C3VA 4RMGA 4MVJM 4QLAA 4BO0A 4BQQA 1M33A 2FN7A 3IA2A 4DR5B 1IOWA 2AR7A 4LXIA 1XCLA 3HDHA 2Z6QA 3F2IA 1S9DA 1K3UB 5HR5A 3SWWA 5IM4F 3C3WA 3D4BA 3ROKA 3SG0A 2C83A 2GBPA 4LQLA 1P62B 2F64A 4JEMA 4XZ3A 3CNLA 4CQJA 2AUTA 5A1TA 1IHPA 1PS8A 3URKA 1JVNA 1L7NA 1GA4A 4I0WB 4G5HA 3W9SA 2D2IA 3NHZA 2V3CC 4QDKA 4UM9B 3O90A 4UMDA 1U0LA 2C1ZA 3AW8A 2HTFA 3E05A 2HQSA 3PIRA 4C01A 3COWA 5JARA 1AGRA 3ZH9B 4YJ2F 4HUQA 3ORFA 4UD6A 1GAJA 4Q7JB 2EQAA 5BO5A 2CVPA 3UMGA 1XJQA 3PEYA 2VPXA 1V8FA 1UMDA 3ROZA 5EMLA 2I3AA 3DW1X 5AR1A 3W5UA 2YDYA 2CLLB 2X9NA 3E27A 3EG5A 2KQUA 4GZ6A 4RJ2A 4RF3A 2ZYGA 4QOGA 4KGDA 3E3LA 2Q1TA 3FWPA 3IUSA 4CV2A 3DDUA 3GK3A 3TWOA 1J8MF 1JJAA 3Q9UA 1JILA 1ZH2A 5T4BA 5I45A 5M29A 3W79A 4QD3A 1WBJB 4XR9A 4N8SA 4UJ3A 4ICIA 4RPKA 2JHFA 3NIDB 3L0PA 4PF1A 1IQRA 2UUOA 2VUSA 3CZ4A 4LJ6A 4OQPA 1QQAA 3N2KB 1I3CA 4KLZA 1DIBA 3HJHA 2IDMA 3ZGNA 2DHEA 1P80A 1KJZA 4RLQA 3UG6A 1JIKA 1P9RA 1GGMA 1UPBA 2ZWVA 2BBWA 1Y5RA 2ZE7A 1WZCA 2QSUA 3CV3A 5JYEA 1EU1A 1OXVA 2X5JO 3IUMA 2VDVE 3FNEA 5KHLB 5F4ZA 1JAIA 5C8ZA 2OC4A 4GYJA 4TKUB 1O97C 1KVSA 3WLAA 1OX4B 4JHXA 2AMLA 3N2IA 5FA8A 1GUBA 4J2HA 4OB6A 5JRZA 4IJ6A 1VTKA 2HEGA 3M1LA 2Q7OE 3TL3A 3ZC3A 1HC7A 5ICCA 1HZZA 4M8IA 3EXAA 5EE0A 3NBKA 2ZAMA 1ZYUA 3V4SA 4ALKA 1TA4A 1XZCA 3R75A 3OJ0A 5CA0B 4AD8A 3UC5A 2VUTA 1X2EA 5SZKB 2ZB3A 3OP1A 3ETNA 3B1FA 5FBQB 1FRQA 5DXJA 1MHPA 4IDAA 4IZ6A 1XZDA 1X15A 3NIBA 4XGRA 3RK4A 5D00A 1Y48E 3FPCA 3LQKA 5JANA 1IN4A 2AG8A 3R3ZA 4ROTA 3BE4A 4M7RA 4DBLE 1B2LA 1K7EB 2Q0QA 2V6IA 4HQLA 4CETA 2JCBA 4BVHA 2R96A 3P2KA 5JNVA 2O3JA 1D1TA 1TEVA 2G1PA 3PA6A 1WMAA 4REQB 2NUAB 1FIUA 1J1UA 1SD5A 4AKHA 2JLCA 3G2MA 1U81A 3L1UA 1FW8A 1S8NA 1YCFA 1R9JA 1G5PA 4QBTA 3UENA 4G84A 1Z0IA 4E5MA 3SXUA 3C2QA 4NEGA 1SKUA 1B16A 1CQJB 5FWXB 1JQAA 1N6KA 3EWAA 4IS2A 1BW9B 1QX3A 1Z2AA 4LE0A 3WIBA 3KO8A 4PC3A 3VPFA 5DM70 1GTRA 2PVCA 4LGCA 2BIFA 4H4DA 2Q21A 4BJ5A 3GYBA 1MABB 1Y7LA 1GGNA 2PPLA 4GI1A 5MFPA 3N58A 4MB6A 2W7TA 4WNIA 5B1YA 3LE8A 2ZUEA 1N2CA 1YULA 1L4UA 3KT8A 1AXGA 2ZJBA 2F43A 3KQSA 5E6RB 1G8JA 1ZH0A 4J1NA 2Q29A 3EA4A 4KMMA 3ZWPA 3QIAA 4A6XA 4CVNA 4Z3KA 3GN1A 1O95D 1TUBB 1PR4A 1YBAA 2D5IA 2HSGA 1MMFB 1TMKA 2V5AA 3PFNA 4K87A 3WSTA 5DMXA 4DV3B 1SWVA 1J90A 2BGIA 4Z2AA 3WGQA 2Z5GA 2LIPA 4PG7A 1SQ0A 4F46A 1MCZA 4RWZA 1JB9A 4PC7A 4JI1B 3FMOB 2A4MA 1KOLA 5MN6A 1Y6RA 1KK1A 2FH5B 4II2A 3R3XA 3TNJA 4HXEB 1L8XA 2RK3A 3WZMA 2X13A 3A04A 4XAQA 1UDRA 5JWRA 2I87A 4IDBA 3RRXA 1IWOA 3BCUA 4X8HA 3ZWMA 1YS6A 3PKJA 4AO8A 5AW0A 3ILXA 2RI1A 4TTSA 4Y9DA 2EERA 4OJYA 3MIIA 4CLXA 4LF7B 1K0FA 4QIHA 1JHRA 3HB9A 1GNRA 2HA7A 1W30A 4HGPA 4AYWA 4UEKA 1FP1D 1RABA 3QPWA 3A9VA 1F17A 1KSHA 2JVKA 5A4IS 1LJ8A 4KO1S 2UZ0A 4CKZA 1JEQA 4JBLA 5DB4A 5SICE 5JXIA 4YONB 2BI7A 1OH8A 1TGVA 2W6MA 3HHPA 4H7DA 3AIOA 2BZGA 2J33A 1SZPA 3IUNA 4KSYA 1SU7A 4QG7A 2X0IA 5D3MB 3OD1A 4B4WA 4EJFA 1MIOB 4B3SB 4LWOA 2A1UA 2JFOA 2OFPA 1ZN7A 3QFRA 5EWMA 3R7AA 4LGYA 1H2XA 4Q93A 3JD4A 2FZ5A 3NO4A 4PFKA 2RH4A 2YR0A 1HNNA 4XW2A 1PJTA 1B4DA 1J70A 5EJFA 2WNIA 4F4UA 4CMIB 2OBNA 3EG9B 2XJ9A 5AVJA 4OHFA 1OYYA 2YWCA 4PO8A 4DJFC 1D2EA 5J58A 1RTKA 4G8JA 2IV7A 4A27A 1XDDA 2OAEA 2J4DA 3ZGVA 3HYNA 4P82A 2G1UA 2XMDA 1G8AA 1HDOA 3NASA 1U7PA 3AJ9A 1AG9A 1EVKA 1Z4PX 3MFQA 5DNAA 5HMMA 1BYUA 4M0UA 1E8MA 4DB2A 1UBGA 3Q7RA 1TF5A 3NV7A 5EIXA 4JFAA 4FE3A 3NVKI 2Y71A 3KIPA 3V4PB 4C4YA 3DKPA 1DJNA 2JK1A 2RHLA 3OLVA 1Z6TA 1I0IA 3PUVA 2N0SA 3QJ5A 2W42A 2CMKA 2PGXA 3ITKA 3VKFA 5BQFA 2XA1A 1YD7A 3MWKA 4GO1A 1DNPA 4Q7KA 1D0SA 3E53A 3QBVA 1F60A 2JFPA 2GCOA 3G79A 4AZ0B 1DEKA 3EXG1 4Q3AA 3WL7A 3F3SA 1E0KA 3I32A 5TQJA 8AT1A 1QMGA 3K5HA 3A1CA 1YR2A 3M3DA 1CIPA 1SXJA 3K16A 5LZ8A 2MCFA 5ALNA 2JAHA 3MG9A 3TM4A 3RKRA 1GQYA 1L4HA 2ESRA 2ZE5A 3G7NA 3OIDA 1WHTB 4X20B 2WQZA 3BH7A 1Z9BA 1WXQA 2J3LA 1G8KA 4R1LA 2YNMC 1VE1A 4ZYYA 4NCBA 1HE4A 3SJAA 1C80A 2QTTA 2Y1WA 3BILA 2V7VA 2OYSA 2AXEA 4JJ4A 5I8ZA 4B6RA 5JNLA 1V3VA 1LDEA 3A37A 3D6NB 4LS3A 5TXGA 2BEVA 2F2TA 2LE0A 3D6MA 5GZ6A 4BAGA 4ZVSA 2XSZD 4HB4A 3FVQA 2NU9A 2NZ2A 2O3UA 2WP0A 3O4GA 3OE1A 5K20A 2IYVA 5KTSA 2D7DA 4B2YA 1M34E 4B6FA 1GR0A 3OT1B 5H83A 4V0MA 1OB5A 1CR0A 5G1PA 3HGQA 5C7YA 4FIDA 4BU0A 3REQA 3TRIA 3JX9A 3ZV6A 5E2AA 1G291 1Z26A 1Y1RA 3EZYA 5KYUA 2WE8A 5TGTA 3TLGB 2QEQA 4NMWA 4C0QC 3OLQA 4ZV7A 3TCNA 3AG5A 4MRAA 3TR0A 2PMDA 3I6BA 1FJXA 4RYDA 2V74B 3D3WA 4LYDA 5KAMA 2G0TA 4PX9A 3G0IA 1B26A 1YQDA 3G8CA 3GZ4A 2WLSA 3A6ZA 4J9UE 4B85A 2VJQA 1JBKA 4CLHA 1L4NA 4FSXA 4DLWA 3UWSA 1R0WA 3M6WA 4G5SA 1ZH4A 2GZRA 4BKUA 3G9XA 1WE2A 4TZKA 4YPFA 4Z3DA 2QN3A 1YA6A 3G9TA 1GADO 2HHJA 1ZSYA 4QTXA 1XMVA 4I9UA 1N78A 4IINA 1U31A 4GPBA 3D6FA 5TMPA 3QTLA 2OFXA 5BQPA 4LOIA 4YJDA 3DKVA 1GL9B 5ITZB 3L7AA 1G2IA 3VTZA 4EY5A 2WICA 3DVQX 4U2FA 2H63A 4PG6A 2IUYA 4RNDB 3ROFA 5IVDA 2V9PA 1FLAA 2ZCVA 2YXDA 4O29A 5FBVB 1S3SA 4Q1BA 1M2JA 4PZZA 4AZVA 3T4UA 4AUMA 3QKWA 4LFBB 2EKZA 3PVZA 4U1RA 3T7SA 2YMQA 5EIBC 4A8PA 5CFMA 1EDZA 3WS7A 2WSLA 4GP7A 3KS9A 4CDGA 3IP1A 4DDKA 1HDRA 4ILKA 4MQ4A 1YZHA 1QLWA 2JA2A 2O3TA 1ZESA 4LAFA 4YRGA 5HE9A 2GBFA 1B7GO 3IIKA 2CJWA 1HMPA 2EWVA 3CNOA 4QNNA 3ZCRA 3C3XA 2Z6UA 3UMSA 2CZGA 1IPHA 3F98A 1USGA 1U28C 3WMWA 4DNPA 1HLDA 3VJLA 4UATA 1GTZA 2GARA 2QX9A 3RAFC 3GLSA 3MRXA 2YOHA 3DMGA 3W3AH 5FUXA 1XRNA 1K5GA 2HA3A 5HF6A 4WFQA 1OFGA 3DZCA 4WK2B 2WQ7A 3BWVA 3GZTB 2RI0A 3OT4A 4B2IA 3TL2A 5JFTA 1C41A 4MQEB 4NJMA 3NIGB 5E9AA 5HCNA 2QRJA 4L9AA 3HR8A 1M8GA 4BAZA 1A2QA 3EF0A 1JIQA 3KP1A 3ANXA 4YI3A 3A6GA 4BCDA 4XYGA 3GQBA 2DY0A 3FTDA 3WYDA 4GYYA 3GJTA 3UM9A 3AI2A 1OBOA 1Q91A 1USVA 4Y2PA 3UB2A 3NDBB 2TS1A 4F4HA 1T5TA 1WKVA 4AJ1A 5T8KA 1LFDB 1ESZA 1N6LA 3GGJA 3KYJB 3WNZA 5AHKA 4X7PA 3M9XA 1IRXA 1KSFX 1RE0A 4IEEA 4OLFA 4NEQA 3PNVA 4LTMA 2O8DA 1NI4B 3K9WA 5D8DA 2V7UA 2AC4A 1KQ3A 2BYTA 1Q14A 4XSVA 4NXNB 4ZJYA 2GZDA 1G21E 1X77A 2BP7B 2J5KA 4KE7A 2O5RA 4B3CA 3V4FA 4CV1A 1GZ3A 5CA1A 1JAXA 2EG5A 1YS1X 3K9GA 4GECA 3WYEA 3WNDA 1E2DA 1UXGA 1XUOA 4AMZA 1NC1A 2FPIB 4QUDA 4EF6A 1O9HA 3ZY5A 4IDFA 2Z3WA 4KU4A 4YRRA 3EDMA 1I4WA 1RYNA 2GM9A 2WRZA 1GM5A 3W8DA 4EHJA 3I76A 3QHQA 4GMDA 3HJGA 1H0KA 4XCVA 1GQOA 3DZKA 3ILHA 4HWPA 3O8DA 2R6JA 2A3NA 5AM3A 4RK4A 5LQNA 3PJFA 5CVJA 4WACA 2RK4A 2PCJA 3PR2B 4ZYXA 3RYFA 3KYBA 5JNSA 2OB1A 5HDBB 2H5IA 4GPTA 4TVSA 5HE8A 1P7CA 4Y0NA 3HPRA 4LN1A 3ZWNA 1CKEA 3P32A 4JJ8A 2MMCA 2O1EA 3P9KA 3DD5A 5H5JA 3QEMB 1CJUC 1ISRA 4QUJA 5BT9A 2EZ9A 4I50F 5JBIA 1YC2A 1I2AA 3MS7A 4KHZA 2FPWA 4MUXA 5HZMA 2ACWA 1UAGA 3ELUA 1CNMA 3N28A 2JJYA 4RD6A 5BW5A 5JXWA 5K45A 2GBLC 1UDAA 1O4WA 2ALJA 4IX1A 1XZNA 1CE8A 1ZM4A 4JZKA 1H3EA 1VJ1A 1S02A 1HQCA 2X0RA 3VNBA 1YF3A 2PV7A 2Z43A 3DFFA 1QHEA 2VG8A 3TFWA 4KXMA 3SDSA 3VZDA 3BD7A 3JQAB 5KYXB 4AK9A 3DO5A 3KWJA 1NRWA 4FS3A 4ARZB 3T35A 4K9LA 3NEYA 1Y3FE 2UXDB 5L53A 3L8ZA 1R0ZA 3ZD8A 3OJCA 1U8UA 4KQ1A 5AHOA 4BN0A 4NCAA 3HL4A 3D6HA 3TD9A 1NW3A 5CT8A 1KFKB 4WW0A 3VYSB 3EH2A 5C81A 3CF0A 1J8VA 1SQ5A 3RSZA 2P9ZA 4NG5A 3O38A 2X7HA 1R18A 5CX4A 2HIHA 2ZYHA 4XDYA 3O26A 4AULA 4EYOA 3ZXUB 4BC1A 2GR9A 3EVFA 3GPBA 4INPA 5E8RA 4AM8A 2FW1A 4ANFA 4CIXA 1M9NA 2C9CA 3JQGB 5DHFA 3NBQA 1MW8X 3G1WA 4FHEA 1TNDA 2JVJA 5F33A 1XMPA 1H2RS 2WSBA 2JZCA 5BUZA 1XDGA 3EEFA 3CG0A 2FRXA 5HKOA 2QRQA 1KI8A 4EMTA 2XVAA 4LRUA 1Q22A 3Q41A 4RNCA 4Y9RA 3KETA 3OMWA 1C0KA 1A98A 2WFZA 3FCYA 4N8EA 4UDXX 3EVNA 4IJKA 4Z0PA 4ZYVA 2C7QA 4MKIA 4ID3A 4N9WA 1GSIA 3K8YA 4RPLA 3NGXA 4QTYA 4NP6A 1A8PA 1NOJA 3H8JA 3QNUA 4N54A 3VZSA 1LVUA 4FN5A 2HXYA 1NIPA 4KBYA 4EITA 2IUSA 1MW9X 3C5EA 1DBSA 3LT5A 2J48A 4YBRA 4CL3A 3BTOA 3SJBA 4GXNA 1UBSB 2QUJA 1PK8A 4MIEA 1QMPA 1Q7BA 4DYDA 4IDDA 4PSCA 3SK0A 1WW2A 3E6AA 2BFNA 4NMMA 1U8FO 5F1PA 3RSSA 3AR5A 4NJMB 3R8FA 1YZVA 2ZI5A 3RLFA 3TW8B 3GEHA 4YCDA 3RYHA 4QASA 1JDNA 2OWEA 2XB2A 1ODKA 2HQBA 1IN8A 3DMRA 3K2EA 3S8EA 4ZXPA 1U0JA 3DCJA 4BNFA 5HJ5A 2VRBA 1EA5A 1XK6A 1L8LA 3LBHA 3WK9A 1MA3A 1GSOA 3BRQA 3EDCA 4B3TB 3OOJA 5IANA 4OH7A 3A7DA 1WNTA 4FEEA 3G2JA 1VDMA 2DWQA 1P17A 3NRJA 3RRNA 1Y6ZA 2VF8A 3B36A 4RL6A 5DGDA 3ZUPA 3RIMA 1FQOA 3P26A 1RJEA 3PRYA 5IFLA 5JSZA 2TRSB 5J43A 3LZ6A 5IAAA 4RA6A 1DOAA 4NG4A 3T5GA 1P9NA 3D6TB 1IATA 2VNHA 1KARA 2OHXA 2O7RA 2OV3A 1UK9A 3GJ6A 2JIBA 3HYCA 3LCMA 4KLRA 4WVLA 2PNJA 2MSDB 2BFEB 2HIGA 3OIGA 3K73O 3IBCA 4GBGA 4K3VA 4XM2A 3QX7A 1Q15A 4Q3KA 2HO4A 3G2QA 5H59A 1GG5A 2B99A 2O6LA 3AIMA 2QSYA 2FSUA 1G8GA 2XYHA 3BGSA 3T3EA 3A3KA 1RAGA 3GUHA 5BVHA 4I1PA 4MQMA 2ACEA 3IRVA 3B6JA 2YYSA 2HLHA 5E9QA 3S70A 4BGDA 2OCDA 2PGLA 1Z35A 3EGIA 3KG2A 5HF8A 2P9JA 1ECFA 3GGGA 3A4YA 2YYYA 1CIJA 1GGJA 4FFOA 3WGNA 3BWMA 3LPLA 3ICCA 3W4KA 4B48A 2YJ5A 1J2YA 2IEAA 3DV0B 4JC8A 3J80A 3F0TA 3IPLA 4KQFA 3TRDA 4ZOQI 3PR3A 3SYMA 1NOIA 1S8AA 1C1XB 1J0AA 1GN9A 2EDCA 4PC1A 3IKJA 4F4JA 3E5HA 3EZ6A 4FFPA 1QXSA 3VPDA 4ID9A 2CUZA 3F49S 4RJTA 2YC2C 4RH1A 5FTJA 2CCJA 1UBFA 1MNQA 3FZGA 4EGAA 3QWBA 4K5QA 4JJEA 5G40A 1UJNA 1JSZA 2YOGA 4UBIA 3H2JA 2Z98A 5HVNA 4BKPA 2Y0DA 2QV0A 1P9LA 2A0UA 1M74A 1P1FA 4FX2A 4Q9NA 3HUTA 2JAWA 3NU1A 1PTJC 1G6HA 3INTA 4OHKA 3DHEA 4QDJA 3W4JA 4AO6A 3HHEA 5HIIA 3M2TA 2WNSA 3LJKA 4HDKA 4HEA1 5LJIA 3OQOA 3IMGA 4TKVA 2PSDA 3V4ZA 1JZQA 3R9XB 2NXNA 1KZ6A 2IPNA 1SUFA 2O1SA 5SY9A 4EJSB 3G0HA 2XNDD 5JE8A 1VG1A 1N8KA 5CVUA 4NF2A 1B76A 4IOMA 4RIGA 4J16A 1LCIA 2YHAA 1UZMA 3NXKA 5HFNA 2DTXA 5GV8A 1S1MA 4EO9A 5AW3A 5DHPA 3HCEA 2VQ3A 4LHSA 4R8LA 3ZK8A 4Q4AB 5E95A 2O8EA 4MUMA 3NWPA 1K0UA 3E8MA 4HMPA 1Q0PA 3A0UA 2GPWA 4KC0A 5F1KA 4JLWA 2RDMA 3RWOA 1LV7A 3PJGA 4WKPA 3WJAA 4OFXA 2FZLA 4QLOA 2Z57A 2IU4A 3B5EA 4U6NA 5CH8A 1R0BA 1TK9A 3CB4A 5DFAA 1K8RA 2CNOA 3GRPA 3LQQA 1PUXA 5CBPA 3OCYA 2P4SA 4ZAZA 5TVKA 3GGOA 1GT91 1A72A 3EGWA 3ZDXB 3DQQA 3EEYA 3UJPA 3ZE0B 4TS9A 3DFIA 5B7QA 4FDTA 1Q0UA 2XTMA 1R5OA 1IK4A 5LC1A 1EP2B 2QYSA 2ZRCA 3FXAA 4IJVA 5AI4A 3ZPXA 4JJKA 1L4KA 4LZPA 3CZMA 3DDSA 1LTKA 1WCIB 2O0HA 2BELA 5EMKA 5A3JA 4G4SP 1U1IA 4XUDA 3LXUX 3MYRA 2I80A 4GZ5A 4P32A 3KZVA 2OHGA 4U6QA 4PGMA 2B7BA 1ZK0A 1P2FA 1KRHA 1JQLB 4KFTA 3ZE2B 2G36A 3GB9A 2XVMA 5KAPA 1GG8A 3NM4A 1XD2B 3FPAA 3TOXA 1FE8A 2XJ4A 3IAS1 1L5KA 4BOYA 2VTDA 2FUG1 5TQ0A 1WDKA 1GSHA 1TU4A 3R6GA 1MO3A 2MSEB 4Q3LA 4TT3A 4W7HA 4PCVA 4V0RA 4D9HA 4INJA 1JG6A 1ZDMA 2BF4A 2JNWA 2Y2VA 4UNIA 1BZYA 1E3JA 4BDTA 4DYHA 2HHAA 2VBIA 3ERCA 1U80A 2YNMA 3L05A 3Q0IA 2W22A 2WUWE 4XDGA 1E7RA 2WUFA 4Y18A 5EKXA 5I9MA 4CNBA 5IP5A 1ZJWA 4ZI7F 1F2UA 4LJLA 1M1NA 1ZJ4A 3D8BA 4GU5A 4KOAA 2DPYA 1ITZA 3QE4A 4YP9A 3RRBA 5BSTA 1CUHA 1DG1G 3ENKA 2R6HA 3GMDA 4D44A 4JT2A 3D4OA 3ABIA 3NATA 1UOPA 1XU4A 2DQ4A 2IHUA 2O2YA 3JY6A 4PCLA 5EWLB 1E2GA 1NKVA 1ZCAA 2IX9A 4UPVA 3RUIA 4BATA 1FFGA 5IRCD 3OQNA 4O5AA 4WPGA 1G20E 1MU0A 2ZTSA 5CLIA 3WAGA 3NHRA 3DT8A 3QLVC 4NBSA 1V16A 1TFRA 3FNFA 1FLVA 1YUMA 1SCAA 3MT0A 4IIGA 4G5QA 2RGEA 2J9XB 2MYNA 2CDRA 2VPYA 4R8SA 2DYKA 3M5WA 2JIPA 4TWRA 1I3LA 4L4UA 5CVCA 1Y82A 3REGA 2VEDA 1PQWA 2C5FA 4HC4A 1IZ7A 1J22A 3QLJA 2B8NA 5JR3A 2PUAA 4U2BA 4ARIA 2P8JA 2GAIA 2UVPB 3ZZ1A 4R1TA 3K6KA 1Y33E 2OQ2A 1PR3A 3RUCA 1N5JA 3LT4A 4GXTA 4ND8A 1Y4SA 3QHPA 3LPAA 4MGYR 4XQCA 4FC7A 4RVDA 2PKWA 4DSOA 1LPMA 1MRSA 1PR6A 2KYRA 1E7SA 3O9ZA 4IO1A 3GJ7A 4IY1A 3TLAA 3L84A 3NUGA 1U9ZA 3DCIA 4WBXC 3AHGA 1G5HA 3IHWA 3U7JA 3U37A 2LDXA 1F2DA 1PGQA 1DEXA 2WZCA 3AOEC 4HK4A 3T06B 1O5OA 3BSWA 1TKAA 5DLQC 2OGSA 1AS0A 3FGOA 3RWMB 3V4OA 5C4IA 3PHJA 1CX9B 1F20A 1JW9B 1JKXA 1EGQA 2H7XA 3EULA 1PL8A 3L40A 3NVDA 4AYXA 3VSCA 4RC9A 1VA5A 2P9FA 4RIFA 4XGNA 4N5HX 2YOFA 3BQNB 3QELB 4BFXA 3IP8A 3KB1A 1OBCA 4MWCA 3D31A 1LX6A 1U8TA 1XRLA 4EQ6B 2WQ6A 3TKLA 2JHCA 2E4WA 1RLTA 4BNDA 3D6JA 1Z75A 1NW8A 2Y4OA 1IUKA 3E5NA 1D2MA 3H9JA 3OJLA 4KDEA 4BRWA 1HNXB 2O8EB 3NALA 1ESDA 3IBTA 4ALJA 5EQFA 2VXYA 5FUMA 1BNCA 4C0AC 3QPDA 4PG8A 1XEFA 4UDOA 3EIQA 4BNYA 4URVR 4JC5A 4N82A 1S2GA 5KNCH 5L9AA 4Y7DA 2D7JA 3MM4A 4LJYA 3O8QA 3FNGA 3D1VA 4HVLA 2GEJA 3C4JA 3L1KA 1NRIA 4W9RA 4X24A 1E32A 1LRLA 4RZ2A 1L7DA 3KKZA 2TYSB 3SHOA 3UMFA 4D8XA 5EL0A 4DA8A 3LF1A 2PT9A 1DMRA 4YHHB 2PRKA 3H1AA 4YAUA 2GM5A 3W5BA 4LRYA 2R4UA 1JI0A 2I66A 1COZA 1Y8QA 1CJTC 2DPHA 2TECE 4PGFA 2Q5OA 3WICA 4F5DA 3U1VA 4CR6A 4HLCA 4TGLA 3CX6A 1W9MA 4JLMA 1GCUA 1VMAA 3IEPA 4KUEA 4PLTA 4PRLA 2XUZA 2ZSDA 3PJDA 5D85A 2JCGA 1O0SA 3A1VA 4D0NA 4ETWA 3AETA 2ARKA 4C3OB 1O87A 4EY7A 3S99A 1QRRA 3TOCA 5I7UA 1E4YA 4QXQA 4JP2A 1YZKA 4RXMA 1UIRA 3HYRA 4JCCA 5SYMA 1QAOA 1LPAB 3AB8A 1FRZA 3QE0A 2C4VA 4HDQB 1NLFA 2VXOA 3BHJA 5ALDA 1TM3E 1NSYA 1VJDA 1G5RA 4RZIA 5CPBA 1M1ZA 4KXQA 4Q9DA 3U7FB 1EK1A 2AR9A 2W6PA 3AVQA 4D3XA 4YROA 2R65A 4DA9A 3PCRB 4BP8A 5JECA 3V7FA 5C46F 3L49A 4ZA2A 4YCJA 3RREA 1G7TA 4LXQA 1IY8A 3CE6A 4V0SA 5I5GA 1L5GB 1ZN9A 1XLUA 2DT5A 2W4IA 3GAMA 1E9BA 3ANMA 1KAGA 3S81A 2HF8A 3TL6A 1Y8RB 2WG1A 5AKHA 1NMZA 4UPEA 2QG4A 1DAKA 1UP7A 3X2SA 3KDAA 1LSJA 4OYLA 1SXIA 1PQ4A 3A11A 1QPGA 1KDVA 4KIGA 3RK0A 1GAWA 2GTPA 2ZUBA 4BWGA 1I6MA 2F90A 3QOWA 3I92A 2Z8XA 4KW7A 4ZVUA 4B80A 1S4MA 3ZDDA 2VOJA 1K5HA 4YUAA 2ODTX 1QF7A 2AT1A 2GKOA 1IBCA 1Z5NA 4A0GA 2WW8A 1P91A 1S2OA 2AD5A 4P33A 3OO0A 4Q02A 5C8XA 4NDZA 1OVGA 4Q82A 2NOAA 5IJAA 3SE7A 1UPAA 2QENA 2WT4A 4EJMA 1NWCA 3BFVA 1V3TA 4MMXB 2O5VA 1N1MA 1PP4A 2FTKE 1US8B 1YQ9A 2H1CA 4RLSA 3WISA 5I4IA 3BTVA 2AJCA 3BAZA 5AKKA 1X1AA 1W0KA 1Z0SA 3PFGA 4DLBA 2B3TA 1GP2A 4WDQA 3SDZA 3B1ZA 4RHFA 1ECLA 1SPBS 2IZZA 4WERA 5T4FA 2A92A 2Y6VA 2P3OA 5JS7A 5CHEA 4EENA 3KHTA 2IYLD 2PLWA 3AEQB 6YASA 5EOVA 2P1ZA 1GDHA 4KZPA 2P3LA 1TK3A 1GFWA 1W93A 2QUKA 5FQOA 1BEZA 4C30A 1W4LA 4RO0A 3WQHA 2FMXA 4IOLA 4O63O 3LUAA 4E5DA 3KL4A 5DWQA 4KPEC 3GLHA 5BWOA 4CIVA 1A5AB 2CSXA 3WR5A 1M1YE 3HCFA 5JU6A 1Z8NA 4ZJUA 1O1YA 2BTQA 4XDHA 2ZU6A 2FB9A 3EISA 2C8VA 3GGSA 1MT3A 2V5UA 3OURA 4F11A 2ZDHA 5LLTA 5DNEA 5JATA 3T3OA 2KLBA 4W1QA 3BDVA 2D1TA 1ZWKA 4XDZA 5JYCA 1U2EA 1VL5A 3ZCUA 4ZO7A 3LS2A 2F7SA 5AK3A 3OE4A 3UJ7A 1JR6A 2GH1A 1E9FA 1UCFA 3OZSA 5J4YA 2P2YA 3E9MA 1T2UA 3NX4A 1QTNA 3OH8A 4MUNA 4R1PA 4YA6A 3NEPX 4Y7CA 5K4AA 2VNIA 4OJQA 4Z5XA 1OXTA 4UHDA 2HPAA 5JD5A 3D6AA 4UCXA 4TROA 4M6WB 1XKTA 2UVDA 1KZ4A 2C2ZA 3NHJA 2J31A 3EXIA 2Z1DA 3KOMA 2QTVB 1QGOA 4AJPA 3QXCA 5T57A 1EHCA 1XEAA 3PSHA 4UM9D 3W4IA 3E9DA 5B7NA 2NU7A 2BTEA 4RUKA 5P8WA 3WYCA 2OP1A 1EUDA 3O1IC 4GI7A 1P18A 1OV4A 2XNKA 2QN6A 4UW9A 3P9IA 3TTXA 3L1JA 1PQUA 2XODA 4IYRA 2A5JA 2M32A 3RG8A 3ZJ5A 4BJ1A 4YQFA 3F9CA 5KQLA 1KHHA 1KY4A 1MX5A 4XIFA 1MO4A 2YVAA 4JODA 4WOBA 3C7DB 2QPOA 3D5EA 2F17A 3JS5A 5DM4A 5ALIA 2WF6A 5E2BA 4MX8A 5BV0A 3VYTB 3QVGA 1CUSA 1GTJ1 2VUIB 5F1YA 2HF2A 3BWCA 4F7WA 3WHPA 3H8SA 3D3EA 1LQTA 4RMIA 2E2WA 2I4LA 2QG6A 3MJ4A 3VKUA 2OG1A 2O59A 2NVUA 3BMQA 2AKEA 2FLVA 3SKYA 3EFOA 2IY7A 3FSGA 3JQEA 1HORA 3HKBA 1EZ1A 1FNNA 4U5QA 1TIKA 3S3TA 1QRDA 2V0CA 4ZI3A 4MYHA 2XI4A 3MS4A 1ZEMA 4KAJA 4YB8A 3AP1A 3IR7A 3VSAA 4B0OA 1P5HA 5GINE 5DWVA 3ITNA 5F64A 5EXEA 3PQ8A 2RH5A 3L0IB 3L7MA 4MR9B 3OQHA 2CXTA 1PYGA 4N0MA 3VZQA 4OUDB 1X1RA 4HAZA 1V96A 4IHQA 5GJBA 1JVSA 2ZSEA 2P0EA 2Q2QA 3EIEA 2YFYA 3CJQA 4FDUA 1FP2A 3VVMA 4TUYA 3NRBA 3FE2A 4HDOB 2GVDC 3G2OA 3IEIA 4O1HA 1A9PA 3WOVA 1NNUA 3FOAA 5H8WA 1Z15A 4IDNA 1IXRC 1FYEA 3W2IA 4C07A 1QU2A 3GEGA 3MT7A 1RC1A 3SSAA 2C2KA 1Z2EA 3EC1A 1WDLA 3HB7A 2JGAA 4Z0NA 1NATA 1XQ1A 4G67A 5JT1A 2Q3CA 1EWRA 3M2PA 2PYDA 3KD2A 1I3OA 3OQ6A 4HD8A 2G80A 2OM6A 2QRVB 2E4AA 3JARA 4WOJA 4D82A 3COYA 3BK7A 3QG5A 4BNNA 5IKEA 1IVNA 3RUEA 1B0PA 4R2KA 1FFAA 3VR5A 3K70B 5AW6A 3HVHA 1DCTA 2PL5A 1I51A 3ENZA 1LW6E 5KDDA 1PD0A 1JHAA 1KYQA 3CA8A 4NOMA 2AEFA 3UAYA 1PG0A 4H59A 4LI3X 2IF0A 3E15A 5K05A 1PGNA 4C21A 3KXKA 4FQ7A 4Y6PA 3PD7A 3AUXA 2YJGA 1L7PA 1F8XA 5AK0A 5A0TA 2Z09A 4JAVC 1PJCA 2ZLBA 3DT9A 5GP1A 1YT5A 4EQZA 4RAQA 1G5TA 3AHJA 4BCCA 3NEJA 4MQBA 1RBMA 2FEAA 1T0HB 5EZSA 2QRHA 3UMCA 5LP6C 3GOHA 4Z6KA 3KJZA 4ZFNA 4C0JA 1Y7HA 4H17A 5FBRB 1VFPA 3VDNB 2BFMA 4TMTA 2V7GA 2OP0A 4E22A 1FL9A 5KS2A 2VT7A 4HDMB 3GBVA 1PTJA 4QXMA 3NS7A 1I7NA 4L8FA 5G0SA 1PFYA 1IB6A 4I4IA 3E0QA 4BX0A 4Q1VA 4B0PA 4LXYA 3EQZA 4GSKA 5FOWA 5L4NA 2IP4A 1J97A 5FUWA 3JZDA 2B2XA 4RHYA 5EGNA 1MNAA 2P90A 3IULA 2A1TR 2PSHA 2C97A 3VHXA 3R8CA 2C58A 1KY2A 5ERXA 1X80A 1MGOA 3FBTA 2EJVA 2GD1O 2P7HA 1QR2A 4JLUA 4TSFD 1SELA 2P5TB 3FPFA 1Q3KA 2I7CA 2NACA 4UEOA 2R6CA 4XD7A 3RARA 1I30A 2GD6A 1VG9B 2H6EA 2C4WA 3HA2A 1NOKA 3U44A 1VE9A 2NU7B 2QT9A 1C7QA 1T5SA 5JQGF 1BSVA 1KFCB 1YZGA 2J3EA 2W6JA 3W7AA 4EPTA 3OLCX 2FFJA 5HIAA 4BASA 4ZCTA 2X23A 5G1NA 3DBRA 3ONWA 2B1QA 3KZNA 3DCNA 1U4NA 3KSUA 3JTMA 3GJXC 2Q9UA 3R0XA 3VJMA 3ZVRA 1WZEA 2I6FA 4W5QA 3V8PA 4E2ZA 3HGMA 1WRBA 3DMFA 3EB9A 4W63A 3OU6A 4M99A 4E32A 3UV6A 4OXNA 1GU7A 2O2DA 5ADVA 4EP1A 3BMCB 1IRIA 2GB4A 4R40A 4EZIA 2DRIA 3EK2A 5FOUA 2CHEA 4IWXA 4I36A 5K0TA 2R66A 3C3CA 3F7NA 3OCWA 3BGOS 3AFIA 3RBVA 4AKTA 2NVUB 2AJTA 1OY1A 1MIHA 1PYOA 1RXYA 2FCAA 2QMHA 2VZEA 4J91A 4OHOA 4Y1RA 3T95A 4ETNA 2B2NA 2ZS7A 5AW1A 1L7AA 3BXGA 5HEKA 5KNBA 5ED4A 221PA 4L57A 3B1VA 1ST2A 2R8PA 4BE4A 2WJPA 2JFUA 4OYYA 4I55B 4BE7B 5ADUS 5I9IA 4TMZA 4AN1A 4FSHA 4RE6A 5IFKA 1XMJA 3FI0A 3H6GA 4J76A 2GUGA 5BUCA 1JTEA 1WZ2A 1XIVA 3IDZA 3ER8A 5K0NA 1EQ2A 3FUVA 4MVJG 4MP3A 4R1SA 5IU6A 5JSYA 5IAJA 2Q50A 3QSGA 3GFFA 3DEJA 4D4LA 1K88A 1L2TA 1L5YA 1YFKA 1CZNA 3H65A 2J7KA 4O0MA 5ILOA 4NLLA 2WFLA 1A4XA 3GH3A 1N2SA 2QN7A 3OZ7A 3PBKA 3PVSA 4NOKA 2V03A 4B5LA 3WK6A 2DPLA 3N2GA 3G23A 1X9GA 3SZMA 2XGGA 3RWBA 3VO1A 3IMKA 2W11A 3QXXA 4Q6BA 4LKRA 2NU6B 1W4AA 1PGPA 1YR7A 3SLGA 4D3DA 1V48A 4OVKA 3CX4A 4AMGA 1GY8A 4BV8A 4FJ0A 4UMEA 4FFMA 9GPBA 1CRZA 2A94A 3NUQA 4G1EB 1GDDA 4B35A 4BO2A 4LZWA 3CN7A 4C03A 3ICEA 1MDBA 1OA1A 1BH6A 3JASA 2XPCA 1WUYA 2EKQA 1CQZA 1YCGA 1P7WA 3GO4A 2OV6A 3Q7EA 3QW4B 4HDRB 2R8BA 4HVTA 4YREA 1ZNZA 2MDTA 3WZ2A 3EWNA 4S0XA 4B2PA 2OBFA 3IE1A 1RM4A 1Y1LA 2J46A 3UAXA 2B9VA 3EVGA 4MQLA 4CTKA 3ZXIA 1LK0A 4IMRA 3Q8KA 4OGGA 4TM8A 3RHZA 1KK2A 4EHKA 2BH2A 1A4UA 1FUYB 1QKIA 3LXRA 1HPLA 1DKUA 2Q4DA 1HTBA 1NVTA 2WIDA 4UXJA 5AKIA 3TSYA 3OSUA 5C32A 2R00C 1U5AA 3IHLA 4WEOA 4L4YA 2H1RA 4UE6A 4LRWA 2CYCA 4G9BA 1P29A 1NF9A 4AMBA 4Z7QB 3K5PA 5AO9A 5JAMA 2WIGA 4D8TA 1G3UA 2R1VB 5DLDA 1T5LA 4NBLA 2WYOA 3DEIA 1MDFA 4FYIA 4FGLA 3ONEA 1UMKA 2BV3A 4FWIB 4CG0A 1U98A 1OIXA 1KYTA 2IXFA 3BM5A 4BMDA 5KKNB 4IMIB 1KZ9A 5IPFA 2X0KA 4L5AA 5IJ0A 1VPLA 2G6TA 3ETEA 3ECCA 1CCWA 4OU4A 1XLWA 4G4IA 3RRYA 3TIVA 2WV9A 4CTMA 2O2SA 4IIJB 2MYUA 2CB9A 4LZAA 4RK1A 2FK7A 2Q3MA 2XUJA 3LSTA 1PX0A 1N6RA 1TRKA 2ORYA 1RD4A 1V5WA 1Z73A 4MSUA 4OQDA 2OV2A 3T7DA 5DNVA 3CX3A 3MCUA 4RVUA 5DOVA 3VNQA 4D0SA 3D7RA 3OP4A 3PHGA 2W2PA 4Z7OB 3KC2A 3Q0TA 3QNMA 3R6LA 3MGKA 4XVCA 5JAUA 5FIUA 1UKYA 1GILA 3FWHA 3ISJA 4HAWA 4P5DA 4AJLA 3ZWQA 1XEWY 2P2ZA 2Y4NA 4L0QA 4IR7A 4EKGA 5HJ7A 3FWNA 4DQLA 3KVRA 3K1AB 4FYJA 4MLDA 3FYUC 2ODBA 1PBNA 3UJBA 3IE2A 1R6VA 5EHZA 1SC3A 5EXTA 4QJ3A 5KYKA 2C7BA 1V1MA 5D1HA 5CG2A 4GYWA 4DBLC 3GLGB 4XKJA 1PS0A 1XJCA 3I37X 5HFAA 3VDQA 1RWWA 4DIOA 3N5KA 3B89A 3ENVA 3JQBC 4HQNA 5FFMA 4DIKA 4E1BA 1YIAA 2X5KO 3AHDA 2QJFA 4NMXB 2AX4A 1UM8A 4PINA 5IJ9B 1I3KA 4N0PA 2PXAA 3K32A 1P9OA 2SHKA 3CHYA 1Q1QA 4B43A 4FMDB 4DXDA 4GWLA 2A9FA 5DGCA 4BRSA 1T3GA 2V7QA 1D2GA 1MJNA 2Q5IA 3FUUA 4CFYA 3O8OA 1FYWA 4W7IA 1EQUA 2I33A 2XEXA 1D2HA 3O93A 4LY6A 5KNDA 3JR3A 1E6KA 3KYDA 1UF9A 1JEYA 2FDCA 3RS0A 2X41A 4JVSB 2HJHA 5SY6A 1E79D 1GCOA 3R7FA 1AC5A 1FU4A 4X71A 5EWJA 4RETA 1Y5MA 1BTOA 3TZQA 5HYVA 3GEIA 4WFJA 1YI8A 5DH9A 1N1GA 1E94E 2O06A 3IRUA 3DS8A 1IJEA 1AMOA 2ZB2A 2C1EA 4HSEA 2GVNA 5GM2A 4E15A 1ZMRA 1CDDA 3KKEA 2GJSA 4PZUA 2Q7DA 3FAZA 3QXGA 2CB0A 4A91A 1KJYA 2WV7A 5CLFA 2KWIA 3AUKA 4RVGA 4EYQA 3I09A 4MS1A 3W90A 3E8SA 4YIHA 4UBJA 1XWFA 3FCCA 4LYYA 3LCCA 1OZAA 4K6HA 5K6AA 1CHNA 1E1LA 3DM5A 3HLKA 3P0FA 1NGSA 4FS8A 3FDFA 3UKDA 1A9YA 1XN1A 2GVZC 2YV3A 1WBBA 1Y6JA 2A88A 3MGBA 5KTTA 1U3CA 2P9GA 4HLDA 4AG6A 1C7JA 3OKCA 3QVMA 3EXFA 1V4VA 1JHVA 1J1ZA 2BKLA 2IX3A 3LHDA 3W8RA 1X8JA 3MZ0A 2APJA 5FPTA 1OAOC 1KH3A 3FZQA 3IUPA 5KSWB 2WYUA 4K6GA 4L2IB 3GUZA 5LPNA 3KKKA 1GQSA 4MCIA 4M2LA 1JDPA 2WJZB 4KR0A 1AK1A 4I9HA 2GERA 1NBEA 2J5QA 3MWDA 3R7SA 1JECA 4IV8A 1PJBA 3B8HA 2B21A 1AH2A 1A5ZA 3ZH2A 3T5PA 2ES4A 3GJQA 1AKTA 4A6DA 2QMQA 3ZGXA 2KB0A 1E5XA 2X1VA 2WNHA 1FLDA 1NJSA 1MOPA 2XOEA 3GBPA 2E4XA 1NW4A 1V0JA 2XD4A 5GOTA 1PEDA 4PFJA 1A9TA 2V1UA 2KBFA 4C1NA 4C78A 1GO2A 2ZRAA 3CTMA 3OZWA 4GX1A 4K86A 5CNKA 4P35A 4LWZA 1C4XA 2IHBA 2WT8A 5EIOA 1BVUA 5HBRA 3THWB 2IZ6A 3IKLA 2OCPA 3RG2A 4NR0A 2JGEA 1L4GA 1TC1A 4IH4A 5AQEA 2J3IA 2IYPA 2ASEA 5CJ2A 3BKXA 1JLKA 4LSMA 4F1WA 2YBEA 1QC5B 1SKBA 2Q99A 2JI6A 5AKEA 1EP3B 1HEYA 3I9JA 4O33A 3JQAD 4ZOLA 3OX3A 5DASA 3WQBA 2VP2A 1DC4A 3EDOA 1VL1A 3L0DA 3AFNA 3I5YA 2ZANA 1FP4B 1QQ6A 4HJXA 4RSMA 4YP0A 4DC9A 4RY2A 2PXCA 1N6HA 4B7CA 1F4LA 2X2PA 4HXYA 1GAXA 3FSRA 3NJ8A 1T6YA 4GOND 3IJEB 3HLTA 3LHKA 4ITRC 3IB6A 1J20A 4Q7LA 3AL3A 3EH1A 3KLNA 1RU3A 5KKCA 4GPAA 4UNPA 3ZXSA 4YCSA 1FFBA 2CLCX 2C9DA 3FTNA 3QYAA 1ZD1A 1VKNA 4X65B 1AS3A 4X3OA 4BGUA 3O9MA 4OMDA 2Q5HA 5JAQA 4L76A 4PXSA 2QUAA 2IYAA 1S96A 3FYDA 2ZCUA 3HYSA 4X90A 5H9VA 3DLIA 4QJBA 1TC2A 3MERA 1AUQA 4XD2A 4KYUA 1DT3A 1JR2A 2V5VA 4Y2QA 3WGYA 5KPDA 1T6BY 5K1ZA 1RHKA 3RTEA 1OLXB 4F2PA 9LDTA 1SA0B 2FP4A 1LFAA 4LFAB 5HQ3B 2RKBA 1NQVA 4FGJA 3ENQA 4B8WA 2RHWA 2V3VA 3RSHA 4P4NA 5HZKA 1VPWA 4FW8A 4X1KB 1T1RA 4K9RA 5HCUA 3TW0A 3Q7TA 5KTOA 1OCEA 4BLRA 3LQ4A 4JBGA 1EFDN 5AM2A 2GYVA 1X7XA 2ZPTX 1SG6A 3PNBA 2A1IA 2HF9A 2Z58A 1CY2A 4NABA 1IM5A 5AI0A 2GTHA 2W2XA 3OKPA 2QV7A 2AMFA 2X3FA 3K05A 1IHOA 1P1JA 1UBNA 2YL2A 2ZRHA 4M55A 5D3KA 3CCBA 1A2OA 4OAOA 3KKQA 5LQMA 5K2OA 2NTNA 2V7XA 1EH5A 4HWSA 1KEWA 1XMOB 3C6YA 3A32A 4IHJA 1NP3A 3VR5H 2PJDA 3ZHYA 3D5QA 4HNRA 4YJKA 2Y1LA 1XBTA 1HDCA 1I3NA 3OZIA 2Y67A 2YMPA 1ZVQA 4HVAA 5DHUA 5KNCD 2NO5A 5F3DA 1UT5A 3AU9A 1JAYA 4F3YA 3WL3A 1HDXA 3F6SA 2W6OA 2G9NA 2BFBA 3DWEX 3GCWA 3QW2A 1UDXA 5GZ3A 2F1HA 3H84A 3I28A 4DYVA 1E1KA 1E9CA 4X5OA 5KUTA 2QYOA 3ORSA 3UA3A 2ZUVA