1Y8MA

Solution structure of yeast mitochondria fission protein fis1
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
144
structure length
144
Chain Sequence
MTKVDFWPTLKDAYEPLYPQQLEILRQQVVSEGGPTATIQSRFNYAWGLIKSTDVNDERLGVKILTDIYKEAESRRRECLYYLTIGCYKLGEYSMAKRYVDTLFEHERNNKQVGALKSMVEDKIQKETLKGVVVAGGVHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fis1
publication title Novel structure of the N terminus in yeast Fis1 correlates with a specialized function in mitochondrial fission.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Unknown function
total genus 43
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2004-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14852 Fis1_TPR_N Fis1 N-terminal tetratricopeptide repeat
A PF14853 Fis1_TPR_C Fis1 C-terminal tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1y8mA01
2KC7A 4I17A 3CEQA 4HORA 4N3AA 4H7XA 3RIBA 3NF1A 2LNIA 2KCKA 3ASFA 3ZHEA 3FFLA 3R9AB 2HO1A 2R5SA 1W3BA 4J8EA 3OXFA 4N5CA 2LSUA 3Q49B 4GA1A 2FEZA 5AYWD 2QFCA 3LPZA 2AVPA 5G05J 3FP3A 2ONDA 5A7DB 2FF4A 2VQ2A 5M72A 5CCLA 2Q7FA 3RO3A 3OXGA 3PDNA 1ELWA 3JYSA 2IFUA 2VGXB 1ZU2A 4I2ZA 4N2QA 4GCNA 5G04C 4O6FA 2I6HA 3QOUA 4JHRA 5JJ7A 3QWPA 1OUVA 2YHCA 2HYZA 3HYMB 1NZNA 3ASDA 5KJLA 5DBKA 2UY1B 3ASGA 3PE3A 1HH8A 2NC9A 2E2EA 4CDRA 4RG6A 2GW1A 4JL0A 4HOQA 4CGWA 2FBNA 3CVQA 5FJYA 1WM5A 4YVOA 4I9CA 3Q47B 3AS4A 3ASHA 3ZHEB 4A1SA 4AIFA 3KD7A 4CGVA 2L6JA 2XPIA 2FI7A 2VGYA 1HXIA 1WAO1 2JLBA 3ZPJA 4N3CA 4NQ0A 3CV0A 4G26A 4XI9A 2FO7A 4AM9A 2WPVA 5EKQD 4AY5A 4UQYA 1IYGA 3K9IA 4W9RA 1KT0A 5LCWC 5KJNA 3O48A 4UQXA 4U07A 3ZFWA 3S7BA 2MHKA 5FZSA 4J8FA 1KT1A 5C1DA 4BTAA 4UI9K 4Y6CA 3E4BA 3QWVA 4UI9C 3N71A 1XNFA 3QDNA 4GZ5A 2C2LA 2UWJG 2KCLA 2PQNA 4B94A 4KBQA 3CK8A 4GCOA 1NA0A 4BTBA 2XGMA 4N3BA 2XEVA 4AY6A 3AS8A 3UUXA 4F3VA 3TG4A 3AS5A 3MV3B 5HQ8A 4WNDA 4LEUA 4HOTA 5FZQA 4RG9A 2Y4TA 5G05C 4WUYA 3LY9A 5ARFA 4GYYA 1QZ2A 1B89A 4HOSA 2Y4UA 1A17A 4GA2A 1ZBPA 5ARGA 3Q4AB 3VTYA 3Q15A 3PE4A 5KJKA 1IHGA 4HOUA 2XGSA 3KAEA 3OXLA 3RKVA 3LCAA 2DBAA 4GA0A 1P5QA 4G25A 4G24A 5FT9A 3U3WA 2LSVA 4GPKA 4J0UA 2V5FA 3SZ7A 3RJVA 2C0LA 2YQ8A 3MKRA 1YA0A 3LY7A 3QWWA 4NRHB 5A6CA 3UPVA 4I1AA 2IF4A 4GZ3A 1ELRA 4I2WA 5HI7A 3CK7A 4UQZA 2VYIA 4BT9A 3GZ1A 4Y6WA 3URZA 3SF4A 3CVPA 3GYZA 2HR2A 4UI9J 4U0ZA 4U0UA 3EDTB 3TGOA 3WXXA 2PZIA 4EQFA 5EX3A 4N39A 4J8DA 5KJMA 3GZ2A 2BUGA 4U04A 1QQEA 5JJTA 5CCMA 2P58C 3FWVA 3S7FA 3CVLA 1NA3A 2XCCA 2XGOA 5JJ6A 4KYOB 5G04J 4JA9A 2KCVA 2KATA 3BEEA 4WNGA 2J9QA 3ULQA 3LY8A 4G2VA 2VSNA 3IEGA 5CHEE 4YVQC 4GYWA 4JA7A 3S7JA 2C0MA 3UQ3A 3LKUA 5FTPA 3CK9A 5BW8C 1PC2A 4G23A 4ABNA 3MV2B 3LYAA 3TAXA 3ZGQA 5D0OD 4BT8A 3S7DA 5D0QD 4U0SA 1Y8MA 4G1TA 4WNEA 2VSYA 3RO2A 4KXKB 3TG5A 3RU0A 4ME2A 4XIFA 5BNWA 4H7YA 4BWRA 1FCHA 3Q5MA 4YNDA 3MEKA 4APOA 3GW4A 4GYOA 3VTXA 4IN3B 5DIZA 4N2SA 2PL2A 3U4TA 3CKCA 2PQRA 3ZN3A 2WQHA 2VGXA 3ESKA 5BT1A 2XCBA 4GZ6A 3CVNA 1KLXA 3MA5A 3QKYA 4I9EA 3KS2A 5LCWJ 3CKBA 5FZRA 1E96B 4WNFA 5EX0A 2UY1A 2OOEA 1TJCA 4XI0A 1HZ4A
chains in the Genus database with same CATH superfamily
3DSUA 4I17A 4DX6D 3CEQA 4J8SA 3ZUVB 4JVSA 3ABKE 1OWNA 3P2BA 4AXHA 3SD5A 3ASFA 3ZHEA 3FFLA 2R5SA 2BF0X 3RAUA 3SO8A 2OVFA 5CEAA 3PRZA 5BV0A 2LXLA 1IHBA 3L9TA 3EHQA 2OV8A 3IHYA 2QFCA 2Y69E 1HG5A 5A7DB 1OY3D 2NYJA 4GTRA 4F6RD 3PDNA 4EPZA 2VGXB 4I1OB 4HLLA 2P9UG 5G04C 4OAUC 1UJKA 1WG0A 5FQ4A 5AQ9A 5EYPF 1OUVA 2YHCA 1AP7A 2HYZA 3ASDA 3D9PA 3NZSA 4A63B 2I9CA 3MX3A 5LOZA 1EPUA 1HX8A 2NC9A 2QYJA 2ZU6B 3RRMB 4DX2A 4AOFA 4FC8A 4ILGA 1SVXA 3DSVA 4HOQA 3LJ3A 4F1SA 1HFAA 3FUDA 4J6IA 1WM5A 3B7UX 2DYRE 3ASNE 3BG1B 4E85A 4A55A 2I2OA 1AWCB 1E7UA 2H6HA 4A1SA 3D9JA 5CBOA 2XPIA 2OEVA 3B7BA 3NBNB 3SFZA 1FT1A 3F6QA 5IY5E 4AEZC 5FQ8A 3CV0A 2FO7A 3KEAA 4UWFA 4AM9A 4JXTA 2MRIA 1S63A 5EKQD 2XRYA 1JCRA 2J4DA 4Q94A 3FUJA 4UQXA 5EYLA 2CHWA 4CYMD 3NOGD 4U07A 3S7BA 4UI9K 3D9LA 5E75A 2R17C 2VJ8A 2M63A 1XNFA 2Y3AA 3DEPA 3SBTB 5D66A 5EDSA 5CMYA 4ACKA 4J8YA 3KSLA 3T5XA 2MYOA 2P9NG 1NA0A 3UM1A 1V54E 2XGMA 4JHJA 2P9IG 3FEYA 4U8VD 3IXEA 2WXQA 5HQ8A 1DCEA 2ZXWE 4LEUA 3MYVA 3MCXA 1H2TC 5BXUA 3EHRA 5G05C 3RSEG 1PAQA 4WUYA 1UJJA 3CVUA 1OWOA 3CLJA 1E90A 2Y0BG 1ZBPA 4LERA 3Q4AB 3HG0D 4ZHBA 3DBSA 3Q15A 3PE4A 3SHFA 2XGSA 3C3OA 2DBAA 4GB9A 5J90A 2V5FA 3SZ7A 4EECA 5FQ7A 1DNPA 3CVXA 1N4RA 3FY4A 3EJNA 3CHRA 3RRUA 4AVXA 3EIJA 3DSWA 4GZ3A 3VLEA 1HS6A 1TNYA 2R03A 4DX1A 4Y6WA 3D9OA 3HHMA 2P9LG 4BX9A 1K1AA 2HE0A 3BUAA 2V8SE 3L82A 3BG0B 1S64A 1KZOA 4FLHA 4EQFA 5FWQA 2CHZA 4J8DA 1OWMA 3AG2E 4PDXA 4CT0A 1V55E 3CVLA 4HQDA 3QNKA 2GRRB 3L16A 2KATA 3BEEA 2F0YA 3FHEA 1MYOA 2RD0A 4GYWA 4K5AB 5EIBE 4C48B 1YCSB 3S7JA 1SA5A 3DXMG 1PY1A 1SZAA 1TR4A 3UQ3A 1N4QA 3ZGQA 3ULEG 5D0OD 1E8ZA 4GTOA 4MRUA 4WNEA 4M3OA 2VSYA 4A3VA 1OWPA 1L5JA 2A5UA 4G11A 1N9AA 2XS1A 1FVFA 2DZOA 4KXKB 3T8KA 5E76A 4BWRA 2EQXA 4FHJA 3KEZA 3MEKA 4YDEA 2DIWA 1H6PA 3U64A 4IN3B 4N2SA 2X3MA 3FH7A 4U96D 2B0OE 3CVNA 3C98A 2BKGA 5FINA 3SFYA 5ENOD 4I9EA 4HI9A 5HRYA 3UT8A 3CKBA 1N52A 3V2OA 4JHKA 5EX0A 3FUEA 2OOEA 4WWPA 5EILA 4U95D 3ZYMA 2VTBA 5B1AE 3CHPA 1SW6A 2GROB 2VSXE 4LSZE 2ETBA 3I4GA 3KSQA 3PEUB 1MX4A 5B1BE 3E33A 4PH4B 2YINA 5CERB 1BLXB 4DK5A 2X6KA 1SZ9A 1TNUA 4B93B 3OXFA 2IO2C 3I4RB 4TUMA 1QNFA 5A23A 4DX7D 4BSXA 1LF8A 3DSTA 2X6HA 1Z3XA 3FULA 5AYWD 1S0PA 1MX2A 4L23A 3TJPA 5M72A 3PZ2A 5JHAA 5CCLA 1JPLA 4ATGA 1JUQA 3PNTB 3JCKC 1E8XA 1ELWA 2DYSE 2GRPB 2GRLA 2X6JA 2IFUA 1TYQG 2QY7A 3R7RA 4ANVA 4KVMA 5AN8A 4I2ZA 4GCNA 2A4ZA 4PUCA 3FUKA 4O6FA 4PS8A 4JHRA 3TL5A 3UMVA 3TXNA 5JJ7A 5LX8A 2X38A 1D8EA 3HYMB 5KNHD 3X2QE 3OTNA 5ENTD 2J07A 2DCPA 4K5BA 5DBKA 4GU5A 2UY1B 1IQUA 5T3RA 1JCSA 3AG1E 1U3CA 3L17A 5C2YA 2X6FA 4CDRA 4RG6A 3DSSA 4GTQA 4HXIA 4JL0A 1BPOA 2JABA 2OEWA 3B7SA 1NFIE 2EINE 3Q78A 4UUCA 4GMLA 3PZ1A 4YDWA 4I9CA 3FU3A 5KNGA 3AS4A 2XEHA 4HLEA 4KVOA 2MOWA 3ASHA 4I6JA 4AIFA 2H6GA 2WQ7A 2L6JA 4LNBA 2VGYA 3HXFA 3NB2A 1HXIA 1WAO1 3ZPJA 4NQ0A 1UN9A 5FIOA 4XI9A 1N54A 2WPVA 1OCZE 4V3IA 3JQ0A 1IYGA 4XKBA 4DI4A 4W9RA 1KT0A 4GTPA 4BETA 4DUIA 4TRQA 5LCWC 3ONKA 2GRMA 3W9GA 5D2MC 3TWVA 4UWKA 4DJAA 2MHKA 5FZSA 1D8DA 4J8FA 3HXEA 4HI8A 3Q75A 2ILRA 4BERA 3E30A 4CDNA 3FH8A 3QDNA 5EN5D 4GZ5A 2UWJG 3PNLB 2KCLA 4QFVA 1SQMA 4B94A 3DSXA 4KBQA 3CK8A 4GCOA 2IONA 3TWSA 1SA4A 3FTVA 3ZEFA 4HRMB 5JHBA 2V5QC 2IO3C 2XEVA 4AY6A 2WXGA 3FUFA 2RFMA 3HIZA 1O1SA 2QZAA 1KPSB 1K3ZD 3MV3B 4WNDA 2ETAA 4KMOA 4HRNA 1WY6A 4JB8P 4CZ2D 1N94A 5AENA 1EF1C 1OCRE 1B89A 2WXIA 2R2LA 5HKPA 2WXHA 1NI1A 5KJKA 4U63A 3FUNA 4DLQA 3ZKJA 3AU4A 1K1BA 4ATZD 3ISMC 4GA0A 3T5VA 4G24A 3APCA 5FT9A 3U3WA 2HM8A 3FTSA 1BI8B 3V79K 3D9MA 1INZA 1IKND 5A6CA 1LD7A 3FUHA 2RFAA 4B89A 1RW2A 2LO6A 2R59A 4NACA 4EZKA 3CHQA 2R02A 5HI7A 1U3DA 3CK7A 2P9SG 4OYSA 1VDYA 2VYIA 1UW4B 3BU8A 3C5RA 1OT8A 3PH0C 3ZYQA 3PZ4A 3CHSA 5FQ6A 3TWQA 2XZTG 3WXXA 2PZIA 4L2LA 4Z68A 4HVBA 4NURA 2L9BA 1DCQA 1MHQA 3L13A 4A3TA 1N0QA 4K03A 3FWVA 3SQVA 1TJFA 4UWHA 3HXBA 2XGOA 3NOCD 1E7VA 3LJNA 3FU6A 1NP7A 2CG2A 2RG8A 3JUIA 2P9KG 3ULQA 3ABME 4CCAA 3LY8A 4YVQC 3SBSA 4E6HA 2ETCA 5BV1A 1OXJA 3LKUA 2NSZA 2BTDA 2XQ0A 4O60A 2EIME 3RK6A 3MV2B 1JWGA 2DWZA 1O1TA 4BT8A 1WDYA 2L0IA 3EHNA 3VLDA 3AU5A 2LUHA 4BESA 2IU1A 3C72A 2EIJE 4C0MA 2DZNA 3TG5A 4ME2A 4XIFA 1FCHA 1LD8A 1O5MA 4APOA 3GW4A 2VTBB 4FJYA 3BQOA 4WAFA 4GYOA 3QK0A 4FULA 4L7TA 3QC1A 2F37A 3ASOE 3T8MA 2WQHA 3QARA 2VGXA 2PM7A 3ESKA 2WMOA 5BT1A 2XCBA 2IY0C 4MBGA 3CSTA 3JQ1A 1Y6IA 3ZYLA 2KXPC 1N11A 1E96B 1N4PA 5ANRA 1TJCA 4XI0A 3FEXA 3ZNGA 3FU0A 5KCMA 5BPPA 1TNOA 2V0PA 3E32A 4HORA 3EU9A 4XEIG 5ENNA 4Q96A 3RIBA 2R05A 3APFA 2LNIA 2KCKA 3R9AB 2HO1A 1W3BA 4J8EA 3I3NA 3Q7FA 1TNBA 4UWLA 4OAVB 1MJ0A 4APFA 2LSUA 3Q49B 3HVEB 3P1UA 5AQAA 2DVWA 2AVPA 3FP3A 2ONDA 5KWDA 2FF4A 2VQ2A 4JW1A 1QYMA 2Q7FA 3RO3A 3OXGA 3LVRE 1LTXA 4KT6B 2PNNA 3UTMA 3ZIMA 3PREA 4N2QA 5HS0A 1TN6A 4M7CA 3QOUA 2WXPA 3QWPA 4LUNU 4OVVA 3FH5A 3MGBA 1UG3A 1NZNA 4I6EA 4FHKA 2J8SD 3PE3A 4N5QA 2KBXA 3HRAA 4CEMA 4MLPA 3G2UA 4L2YA 2GW1A 3D9IA 2RKKA 4FA6A 4CGWA 2FBNA 3CVQA 3PEVB 5FJYA 4EZLA 2IQCA 3TWWA 3J5QB 3PZ3A 5AJDA 4HS2A 3ZHEB 3DRAA 3KD7A 2WXNA 2IJGX 4ANWA 3IV0A 4CT4A 3SY2A 2JLBA 4N3CA 1ZB1A 2IOLA 4G26A 2XS8A 1Z3YA 4JD2G 4IRUA 3CQCB 4UQYA 4AY5A 3R7QA 1N95A 4I43A 4U8YD 2F8YA 2WM9A 3CIAA 3Q79A 5KJNA 3DEOA 1X5BA 3GZSA 5T4YA 3U66A 4I6GA 3L6AA 5EIDA 1KT1A 3TWRA 2FO1E 1YMPA 4BTAA 1D9SA 4ANXA 4LNGA 3E4BA 5CRUA 4FADA 3QWVA 4UI9C 3DXKG 3ML9A 1N0RA 2YHEA 1JCQA 4LG6A 3Q73A 3SNXA 4TV3A 2ZIRA 3IKOB 3MKQA 4BTBA 3ONLA 4NIKA 3LEWA 4N3BA 5AAOA 3Q9NC 4F3VA 3TG4A 4YDYA 4HOTA 3G2VA 5FZQA 4RG9A 3UM2A 2P2CP 3CVVA 4MKTA 2J08A 2I1KA 4HFGA 1QZ2A 3O4ZA 3UI2A 4HOSA 2H6IA 1HE8A 1A17A 4GA2A 4Q69A 5ARGA 4FU3A 4B8CB 3VTYA 1K8KG 4B8AA 4DLOA 4P29A 2GGFA 3OXLA 3RKVA 3UXGA 2BEDA 2F8XK 3PZDA 4GPKA 4J0UA 1H2VC 5AQ7A 3MKRA 1YA0A 3ABLE 3V31A 3UPVA 3TXMA 3ZU7B 2IF4A 5J08A 2LAHA 1ELRA 2KZTA 2VGEA 2XPYA 3HXCA 1IQRA 2GRNB 3L22A 3B95A 3D9NA 4BT9A 2XENA 2XZDG 1GW6A 4CDMA 3EUVA 4EBAA 3SF4A 5AIJA 3CVPA 4JZYA 5ENPD 3GYZA 4RLYA 3UM0A 4U0ZA 4GPMA 2CFUA 5CRVA 2WXOA 1EDUA 4HB5A 1OCCE 3QAQA 2GRQB 5ANLA 3SI5A 5EX3A 3V30A 2Y1LE 2OVBA 4N39A 3MZLB 3HDXA 2V4HC 2EILE 3D9KA 3PS6A 3RRNB 5CEDB 4AP2A 1HF8A 1QQEA 2QYUA 3S7FA 3LVQE 2BKKB 1NA3A 3FU5A 5G04J 4JA9A 2KCVA 3AJIA 1ELKA 4WNGA 2J9QA 4RSYA 4G2VA 2VSNA 3IEGA 4URKA 4DI3A 4JA7A 4X8QA 2AXUA 3EIQC 3IBEA 1MX6A 5FTPA 5G55A 4K0RA 1PC2A 4G23A 1S70B 3ZVVA 3APDA 3LDZA 3WG7E 3S7DA 4XX5A 4U0SA 2LAIA 1IXVA 2WQ6A 5G2NA 4EBAG 4IULA 2AJAA 3ML8A 1H6KA 3RU0A 3Q5MA 3NQPA 1MQSA 4YNDA 3FDHA 3UINC 3UT7A 1JWFA 3D9HA 3B7TA 3CSFA 1E8YA 1QBQA 3B13A 2XPZA 3TWXA 3U4TA 3C3QA 3ZN3A 1O1RA 4GZ6A 4GMRA 3PUJA 3ZXPA 3U9WA 1KLXA 1UOHA 2L6BA 4ZFHA 5CECB 1EYHA 4DRXE 4WNFA 4WWNA 2WMNA 2UY1A 4GMJA 2A5EA 1HZ4A 3NAWA 2KC7A 2KM4A 4K5CA 1NL4A 4A1GA 3CQGB 4N3AA 2AW6A 4H7XA 1Q2ZA 3NF1A 4O1PA 3ULYA 5BUZA 2ZISA 2WB2A 4GTMA 2JEKA 3ZW3A 4KZCA 2E0IA 2WXMA 4N5CA 4DPRA 1A5EA 4F7AA 3L54A 4GA1A 2FEZA 4IYPA 5H7PA 5CBNA 3JUEA 3LPZA 5G05J 3T9KA 4RVBA 3EU5A 2IOSA 2XEEA 4JEUA 1XGWA 2OCCE 4L1BA 3UIPC 3Q7AA 4ANUA 3E37A 3JYSA 4G8KA 4R7LA 4U7EB 1ZU2A 3Q9UC 2I6HA 3FUMA 4ILHB 3CR3A 4FLBA 5KJLA 3EHMA 4F1PA 3ASGA 1HH8A 4YDOA 2E2EA 4LRZA 4EZJA 4XKCA 3L08A 1MZCA 3LS8A 3DPYA 4JPSA 3JXIA 3DWLG 4LNUD 4LCTA 4TXPA 4YVOA 3Q47B 1UN8A 3B7RL 4GTTA 2X6IA 1HO8A 5JMND 3UT4A 4CGVA 3CHMA 2WXRA 4TXRA 2J4BA 3SFXA 4EHMA 2FI7A 4DX5D 3AAAC 2P9PG 5JA4D 4RQIA 3NZUA 3D3MA 4UWGA 3G2SA 3AG3E 1BI7B 3MKQB 3C3RA 3S2AA 5CMWA 4KZ0A 3K9IA 4PS3A 4C0EA 3O48A 4JEHA 3PVLA 3ZFWA 2PM6A 5C1DA 1X81A 2FULA 1BU9A 4BFRA 4Y6CA 2QC9A 3UIOC 4G8LA 3N71A 4J7WA 4XE0A 2WVIA 4BY6A 4F53A 2XRZA 2C2LA 3AG4E 2PQNA 5T8IA 4AJWA 5AARA 2EIKE 4TUUA 5BXOA 3CGHA 5AJLA 3ESLA 5ENRD 2J09A 4AV7A 2AXZA 3QB2A 5B3SE 3AS8A 3UUXA 3AS5A 1TNZA 3TWUA 1YYHA 2Y4TA 3V2XA 3LY9A 5LP0A 1FT2A 3OAWA 3I5PA 5ARFA 4GYYA 2CHXA 4WWOA 4BSZB 3ZXSA 2XHEA 4BX8A 3FTYA 2Y4UA 2YNQA 2NXPA 2KZTB 4B0ZA 2VSOE 3J5PA 2AWIA 4GZDA 1IHGA 3SGHA 3JXJA 4HOUA 3KAEA 1Z5SC 3LCAA 4GZCA 4JC8A 1H19A 3IHVA 3FUIA 1P5QA 2LXMA 3UX4A 4G25A 1H2UA 3ZRHA 3LXUX 2LSVA 2ZGDA 3RJVA 2C0LA 4TXQA 3UM3A 2YQ8A 3QWWA 3LY7A 2WXLA 2I1JA 4NRHB 4MS6A 1H0AA 1H6OA 1HG2A 4I1AA 2WXKA 3PUKA 2ZGGA 1Z6TA 4I2WA 1N4SA 4QQIA 3G2WA 1OCOE 1KZPA 4UQZA 4BEPA 3GZ1A 1U2VG 3FTZA 3URZA 2H6FA 4C9BB 2HR2A 5LFAA 3DPDA 4UI9J 3E34A 2WXJA 4U0UA 4XZ4A 3EDTB 3TGOA 4FP7A 1RZ4A 4OVUA 5AQBA 3QJZA 3FTUA 4PS7A 1HU3A 2CG3A 2AXVA 1OWLA 1BD8A 5KJMA 2V4LA 3GZ2A 2BUGA 3FTWA 4U04A 3CHOA 1FVHA 5JJTA 3ZYKA 5CCMA 2P58C 3ENEA 4HBDA 2XCCA 5JJ6A 3R9MA 4FJZA 4KYOB 4I1MA 4GTVA 4D10C 1TN7A 4O1OA 4HRLA 5CHEE 2IEJA 3HXDA 4CRWA 5ENSD 2C0MA 1E8WA 3UKUG 4GTSA 3CK9A 5BW8C 1TEZA 3TWTA 4L9PA 4ABNA 5ITZF 3LYAA 3TAXA 3VLFA 3G2TA 1G3NB 5D0QD 1Y8MA 4G1TA 3MJWA 3RO2A 1DVPA 2J49A 4GAAA 3FTXA 2CFZA 5BNWA 4H7YA 3HVEA 1TN8A 2B6CA 3VTXA 5DIZA 2PL2A 2WXFA 3CKCA 2PQRA 2L0TB 5ENQD 3W9FA 3CVYA 3MA5A 3QKYA 3KS2A 5LCWJ 1FPPA 5FZRA 4U8HA 4ACLA 1DC2A 3UKRG 4ILIA 3CVWA 4HNAD 5KBAA
chains in the Genus database with same CATH topology
2KC7A 3ZYMA 2VTBA 2V0PA 4I17A 2KM4A 3CHPA 3CEQA 4HORA 4J8SA 5ENNA 4A1GA 4Q96A 3CQGB 4N3AA 2VSXE 2AW6A 4H7XA 3I4GA 3PEUB 4JVSA 3RIBA 3APFA 3NF1A 2LNIA 1OWNA 3P2BA 4AXHA 5BUZA 2KCKA 3SD5A 4PH4B 2YINA 3ASFA 2WB2A 4DK5A 2JEKA 3ZHEA 3FFLA 3ZW3A 3R9AB 2HO1A 2X6KA 2R5SA 1SZ9A 1W3BA 4J8EA 2BF0X 3OXFA 2E0IA 4KZCA 3I3NA 2WXMA 4N5CA 3I4RB 4UWLA 2OVFA 4DPRA 3PRZA 1QNFA 5BV0A 5A23A 4BSXA 1LF8A 4APFA 2OV8A 3IHYA 2LSUA 2X6HA 3Q49B 4F7AA 3HVEB 3L54A 4GA1A 1Z3XA 2FEZA 3P1UA 4IYPA 3FULA 5AYWD 2QFCA 3LPZA 2AVPA 5G05J 3FP3A 1S0PA 1HG5A 2ONDA 4RVBA 5A7DB 2FF4A 4L23A 2VQ2A 2IOSA 4JEUA 4JW1A 1XGWA 3TJPA 5M72A 5JHAA 5CCLA 2Q7FA 1JPLA 4L1BA 4ATGA 1JUQA 3PNTB 4ANUA 3RO3A 3JCKC 3OXGA 1E8XA 3PDNA 3LVRE 1ELWA 3JYSA 4EPZA 2X6JA 2GRLA 2IFUA 4KT6B 3ZIMA 4R7LA 2VGXB 2QY7A 4I1OB 3R7RA 4KVMA 4ANVA 1ZU2A 3PREA 4I2ZA 4GCNA 4N2QA 2A4ZA 4PUCA 5G04C 3FUKA 1UJKA 4O6FA 4PS8A 5FQ4A 2I6HA 3QOUA 4JHRA 3TL5A 3FUMA 3UMVA 2WXPA 3TXNA 5JJ7A 3QWPA 1OUVA 2YHCA 4ILHB 4LUNU 5LX8A 4OVVA 2X38A 3CR3A 3FH5A 2HYZA 3HYMB 4FLBA 3MGBA 1UG3A 1NZNA 3ASDA 3OTNA 4I6EA 5KJLA 3D9PA 4FHKA 3NZSA 2J07A 3EHMA 2I9CA 2DCPA 3MX3A 5DBKA 4GU5A 2UY1B 3ASGA 1EPUA 3PE3A 5LOZA 1HH8A 1HX8A 2NC9A 1IQUA 2E2EA 4LRZA 4EZJA 4XKCA 5T3RA 2ZU6B 4CEMA 4MLPA 3RRMB 3G2UA 4AOFA 4FC8A 3L08A 1U3CA 3L17A 3LS8A 2X6FA 4ILGA 4L2YA 5C2YA 4RG6A 4CDRA 2GW1A 4HXIA 4JL0A 3D9IA 4HOQA 1BPOA 3B7SA 3LJ3A 4F1SA 4FA6A 4CGWA 1HFAA 2FBNA 3CVQA 3PEVB 4JPSA 5FJYA 3FUDA 4J6IA 1WM5A 4EZLA 2IQCA 3B7UX 4GMLA 3BG1B 4LCTA 4E85A 4YVOA 4I9CA 4A55A 2I2OA 3FU3A 3Q47B 3AS4A 1UN8A 1E7UA 3B7RL 4HLEA 4KVOA 5AJDA 2MOWA 2X6IA 1HO8A 3ASHA 4I6JA 4HS2A 3ZHEB 4A1SA 4AIFA 3KD7A 3UT4A 2WQ7A 3D9JA 4CGVA 3CHMA 2WXRA 2L6JA 2J4BA 2WXNA 2XPIA 2FI7A 2IJGX 2VGYA 4ANWA 1HXIA 3IV0A 3SFZA 4CT4A 1WAO1 2JLBA 3ZPJA 4N3CA 4NQ0A 2IOLA 3NZUA 1UN9A 5FQ8A 4AEZC 3CV0A 3D3MA 4G26A 1N54A 4UWGA 3G2SA 4XI9A 2FO7A 4AM9A 4UWFA 4JXTA 2MRIA 1Z3YA 3MKQB 2WPVA 5EKQD 2XRYA 4IRUA 2J4DA 3S2AA 4V3IA 5CMWA 3CQCB 3JQ0A 4UQYA 3R7QA 4KZ0A 4XKBA 3K9IA 4AY5A 1IYGA 4PS3A 4C0EA 4I43A 1KT0A 4W9RA 2WM9A 4DI4A 3CIAA 4TRQA 5LCWC 4Q94A 5KJNA 3O48A 1X5BA 3FUJA 3ONKA 4UQXA 2GRMA 3GZSA 2CHWA 4JEHA 3PVLA 4UWKA 4U07A 4I6GA 3L6AA 5T4YA 3ZFWA 3S7BA 2MHKA 4DJAA 3U66A 5FZSA 4J8FA 1KT1A 2PM6A 5C1DA 2FULA 4BTAA 4UI9K 3D9LA 2ILRA 5E75A 4ANXA 4Y6CA 4BFRA 3E4BA 4FADA 4CDNA 2R17C 3QWVA 2VJ8A 4UI9C 3N71A 2M63A 3FH8A 1XNFA 2Y3AA 4XE0A 2WVIA 3SBTB 3QDNA 4BY6A 4F53A 3ML9A 2XRZA 4GZ5A 5EDSA 2C2LA 2UWJG 2YHEA 3PNLB 2KCLA 5CMYA 4ACKA 4QFVA 2PQNA 5T8IA 4AJWA 1SQMA 3SNXA 4B94A 4TV3A 3T5XA 3IKOB 3MKQA 4KBQA 4TUUA 3CK8A 4GCOA 2IONA 1NA0A 3CGHA 4BTBA 3ONLA 5AJLA 3ESLA 3FTVA 3ZEFA 4AV7A 2J09A 3LEWA 2XGMA 5JHBA 4N3BA 4JHJA 2XEVA 4AY6A 2AXZA 2WXGA 3QB2A 3FUFA 3HIZA 3AS8A 3UUXA 3FEYA 4F3VA 3TG4A 2WXQA 3AS5A 3MV3B 5HQ8A 4WNDA 4LEUA 4HOTA 3G2VA 5FZQA 4RG9A 3MYVA 3MCXA 1H2TC 4KMOA 1WY6A 2Y4TA 5G05C 3CVVA 4MKTA 1PAQA 2J08A 4WUYA 1UJJA 3LY9A 5LP0A 2I1KA 3CVUA 5AENA 3OAWA 1EF1C 3I5PA 5ARFA 4GYYA 1OWOA 1QZ2A 2CHXA 3CLJA 4HFGA 1B89A 3O4ZA 4WWOA 3ZXSA 4HOSA 2WXIA 2XHEA 1E90A 4BX8A 3FTYA 1HE8A 2Y4UA 1A17A 4GA2A 1ZBPA 4Q69A 4LERA 5ARGA 2YNQA 4FU3A 2NXPA 3Q4AB 4B8CB 2KZTB 2WXHA 3VTYA 3DBSA 3Q15A 4B8AA 4B0ZA 2VSOE 4DLOA 3PE4A 3SHFA 4P29A 5KJKA 4U63A 3FUNA 2AWIA 4DLQA 4GZDA 1IHGA 3SGHA 2GGFA 3AU4A 4HOUA 2XGSA 3KAEA 3OXLA 3RKVA 3LCAA 2DBAA 4GZCA 4GA0A 4JC8A 1H19A 3IHVA 3FUIA 3T5VA 1P5QA 3UX4A 4G25A 1H2UA 4G24A 4GB9A 3APCA 3ZRHA 5FT9A 5J90A 3LXUX 3PZDA 3U3WA 2HM8A 2LSVA 4GPKA 3FTSA 4J0UA 2V5FA 3SZ7A 1H2VC 4EECA 5FQ7A 1DNPA 3CVXA 3RJVA 2C0LA 3D9MA 1INZA 2YQ8A 3MKRA 1YA0A 3FY4A 2WXLA 3LY7A 3QWWA 2I1JA 4NRHB 4MS6A 1H0AA 5A6CA 4I1AA 1HG2A 3UPVA 3EJNA 3TXMA 2WXKA 3CHRA 3FUHA 2IF4A 3RRUA 5J08A 4AVXA 4B89A 3EIJA 2LAHA 3PUKA 3VLEA 4GZ3A 1Z6TA 1ELRA 4I2WA 2LO6A 2R59A 4NACA 4EZKA 3G2WA 1HS6A 3CHQA 2KZTA 5HI7A 1U3DA 3CK7A 2XPYA 4OYSA 1VDYA 1IQRA 3L22A 4UQZA 2VYIA 3D9NA 4BT9A 1GW6A 3GZ1A 4CDMA 4Y6WA 4EBAA 3FTZA 3URZA 1UW4B 3SF4A 5AIJA 3D9OA 3CVPA 4C9BB 4JZYA 3GYZA 3HHMA 2HR2A 3PH0C 3ZYQA 5LFAA 3DPDA 4UI9J 2WXJA 4U0ZA 2CFUA 3CHSA 4U0UA 4BX9A 4XZ4A 5FQ6A 2WXOA 3EDTB 1EDUA 3TGOA 4FP7A 4OVUA 2V8SE 3WXXA 3QJZA 3QAQA 2PZIA 3BG0B 3FTUA 4PS7A 4FLHA 4L2LA 5ANLA 4EQFA 3SI5A 1HU3A 2CG3A 5EX3A 2AXVA 4N39A 2OVBA 1OWLA 3MZLB 5FWQA 2CHZA 3HDXA 4J8DA 4HVBA 4NURA 2L9BA 3D9KA 5KJMA 3PS6A 2V4LA 1OWMA 1MHQA 3L13A 3GZ2A 4PDXA 2BUGA 3RRNB 4A3TA 3FTWA 4U04A 4AP2A 4CT0A 1HF8A 1QQEA 3CHOA 1FVHA 5JJTA 3ZYKA 4K03A 2P58C 3ENEA 3FWVA 5CCMA 3S7FA 3CVLA 3LVQE 1TJFA 4UWHA 1NA3A 2XCCA 2XGOA 1E7VA 3FU5A 5JJ6A 3QNKA 4FJZA 4KYOB 4JA9A 2KCVA 5G04J 3FU6A 1NP7A 2KATA 1ELKA 2CG2A 2RG8A 3BEEA 2J9QA 3JUIA 3L16A 4I1MA 4WNGA 3ULQA 4CCAA 4D10C 4RSYA 3FHEA 3LY8A 4G2VA 2VSNA 2RD0A 3IEGA 5CHEE 4YVQC 4GYWA 3SBSA 4URKA 4DI3A 4JA7A 4E6HA 5BV1A 2AXUA 3S7JA 1PY1A 4CRWA 3EIQC 2C0MA 1SZAA 3UQ3A 1E8WA 3IBEA 3LKUA 2NSZA 2BTDA 2XQ0A 5FTPA 3CK9A 5BW8C 1TEZA 5G55A 3RK6A 4K0RA 1PC2A 4G23A 4ABNA 3MV2B 3ZVVA 3LYAA 3TAXA 3ZGQA 1JWGA 5D0OD 3VLFA 3G2TA 3APDA 4BT8A 3LDZA 1E8ZA 3S7DA 2L0IA 4XX5A 3EHNA 5D0QD 4U0SA 4MRUA 1Y8MA 2LAIA 3VLDA 3AU5A 4G1TA 3MJWA 4WNEA 4M3OA 2VSYA 4A3VA 1OWPA 1L5JA 2A5UA 3RO2A 4G11A 1DVPA 1FVFA 2J49A 2WQ6A 2IU1A 5G2NA 4EBAG 4KXKB 4GAAA 4IULA 3FTXA 4C0MA 3ML8A 5E76A 1H6KA 3TG5A 2CFZA 3RU0A 4ME2A 4XIFA 5BNWA 4H7YA 3HVEA 4BWRA 1FCHA 3Q5MA 2EQXA 3NQPA 1MQSA 4YNDA 4FHJA 3KEZA 3MEKA 4APOA 3GW4A 3FDHA 3UT7A 2VTBB 1JWFA 4FJYA 4WAFA 3B7TA 3CSFA 3QK0A 4FULA 4GYOA 1E8YA 2DIWA 3QC1A 4L7TA 3VTXA 3U64A 4IN3B 5DIZA 4N2SA 3B13A 2XPZA 2PL2A 2WXFA 3U4TA 3CKCA 2PQRA 2X3MA 3T8MA 2L0TB 3FH7A 3ZN3A 2WQHA 3QARA 2VGXA 2PM7A 3ESKA 2WMOA 5BT1A 2XCBA 4GZ6A 3CVYA 3PUJA 3CVNA 3C98A 3CSTA 3U9WA 1KLXA 3MA5A 3JQ1A 3QKYA 1Y6IA 4I9EA 3ZYLA 3KS2A 5LCWJ 3UT8A 3CKBA 5FZRA 1N52A 1EYHA 1E96B 4WNFA 4WWNA 4U8HA 4JHKA 2WMNA 4ACLA 5ANRA 5EX0A 3FUEA 2UY1A 2OOEA 1TJCA 4WWPA 4XI0A 4ILIA 3FEXA 3CVWA 4GMJA 3FU0A 5KCMA 1HZ4A 5BPPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KC7 A;  4I17 A;  3CEQ A;  4HOR A;  4N3A A;  4H7X A;  3RIB A;  3NF1 A;  2LNI A;  2KCK A;  3ASF A;  3ZHE A;  3FFL A;  3R9A B;  2HO1 A;  2R5S A;  1W3B A;  4J8E A;  3OXF A;  4N5C A;  2LSU A;  3Q49 B;  4GA1 A;  2FEZ A;  5AYW D;  2QFC A;  3LPZ A;  2AVP A;  5G05 J;  3FP3 A;  2OND A;  5A7D B;  2FF4 A;  2VQ2 A;  5M72 A;  5CCL A;  2Q7F A;  3RO3 A;  3OXG A;  3PDN A;  1ELW A;  3JYS A;  2IFU A;  2VGX B;  1ZU2 A;  4I2Z A;  4N2Q A;  4GCN A;  5G04 C;  4O6F A;  2I6H A;  3QOU A;  4JHR A;  5JJ7 A;  3QWP A;  1OUV A;  2YHC A;  2HYZ A;  3HYM B;  1NZN A;  3ASD A;  5KJL A;  5DBK A;  2UY1 B;  3ASG A;  3PE3 A;  1HH8 A;  2NC9 A;  2E2E A;  4CDR A;  4RG6 A;  2GW1 A;  4JL0 A;  4HOQ A;  4CGW A;  2FBN A;  3CVQ A;  5FJY A;  1WM5 A;  4YVO A;  4I9C A;  3Q47 B;  3AS4 A;  3ASH A;  3ZHE B;  4A1S A;  4AIF A;  3KD7 A;  4CGV A;  2L6J A;  2XPI A;  2FI7 A;  2VGY A;  1HXI A;  1WAO 1;  2JLB A;  3ZPJ A;  4N3C A;  4NQ0 A;  3CV0 A;  4G26 A;  4XI9 A;  2FO7 A;  4AM9 A;  2WPV A;  5EKQ D;  4AY5 A;  4UQY A;  1IYG A;  3K9I A;  4W9R A;  1KT0 A;  5LCW C;  5KJN A;  3O48 A;  4UQX A;  4U07 A;  3ZFW A;  3S7B A;  2MHK A;  5FZS A;  4J8F A;  1KT1 A;  5C1D A;  4BTA A;  4UI9 K;  4Y6C A;  3E4B A;  3QWV A;  4UI9 C;  3N71 A;  1XNF A;  3QDN A;  4GZ5 A;  2C2L A;  2UWJ G;  2KCL A;  2PQN A;  4B94 A;  4KBQ A;  3CK8 A;  4GCO A;  1NA0 A;  4BTB A;  2XGM A;  4N3B A;  2XEV A;  4AY6 A;  3AS8 A;  3UUX A;  4F3V A;  3TG4 A;  3AS5 A;  3MV3 B;  5HQ8 A;  4WND A;  4LEU A;  4HOT A;  5FZQ A;  4RG9 A;  2Y4T A;  5G05 C;  4WUY A;  3LY9 A;  5ARF A;  4GYY A;  1QZ2 A;  1B89 A;  4HOS A;  2Y4U A;  1A17 A;  4GA2 A;  1ZBP A;  5ARG A;  3Q4A B;  3VTY A;  3Q15 A;  3PE4 A;  5KJK A;  1IHG A;  4HOU A;  2XGS A;  3KAE A;  3OXL A;  3RKV A;  3LCA A;  2DBA A;  4GA0 A;  1P5Q A;  4G25 A;  4G24 A;  5FT9 A;  3U3W A;  2LSV A;  4GPK A;  4J0U A;  2V5F A;  3SZ7 A;  3RJV A;  2C0L A;  2YQ8 A;  3MKR A;  1YA0 A;  3LY7 A;  3QWW A;  4NRH B;  5A6C A;  3UPV A;  4I1A A;  2IF4 A;  4GZ3 A;  1ELR A;  4I2W A;  5HI7 A;  3CK7 A;  4UQZ A;  2VYI A;  4BT9 A;  3GZ1 A;  4Y6W A;  3URZ A;  3SF4 A;  3CVP A;  3GYZ A;  2HR2 A;  4UI9 J;  4U0Z A;  4U0U A;  3EDT B;  3TGO A;  3WXX A;  2PZI A;  4EQF A;  5EX3 A;  4N39 A;  4J8D A;  5KJM A;  3GZ2 A;  2BUG A;  4U04 A;  1QQE A;  5JJT A;  5CCM A;  2P58 C;  3FWV A;  3S7F A;  3CVL A;  1NA3 A;  2XCC A;  2XGO A;  5JJ6 A;  4KYO B;  5G04 J;  4JA9 A;  2KCV A;  2KAT A;  3BEE A;  4WNG A;  2J9Q A;  3ULQ A;  3LY8 A;  4G2V A;  2VSN A;  3IEG A;  5CHE E;  4YVQ C;  4GYW A;  4JA7 A;  3S7J A;  2C0M A;  3UQ3 A;  3LKU A;  5FTP A;  3CK9 A;  5BW8 C;  1PC2 A;  4G23 A;  4ABN A;  3MV2 B;  3LYA A;  3TAX A;  3ZGQ A;  5D0O D;  4BT8 A;  3S7D A;  5D0Q D;  4U0S A;  1Y8M A;  4G1T A;  4WNE A;  2VSY A;  3RO2 A;  4KXK B;  3TG5 A;  3RU0 A;  4ME2 A;  4XIF A;  5BNW A;  4H7Y A;  4BWR A;  1FCH A;  3Q5M A;  4YND A;  3MEK A;  4APO A;  3GW4 A;  4GYO A;  3VTX A;  4IN3 B;  5DIZ A;  4N2S A;  2PL2 A;  3U4T A;  3CKC A;  2PQR A;  3ZN3 A;  2WQH A;  2VGX A;  3ESK A;  5BT1 A;  2XCB A;  4GZ6 A;  3CVN A;  1KLX A;  3MA5 A;  3QKY A;  4I9E A;  3KS2 A;  5LCW J;  3CKB A;  5FZR A;  1E96 B;  4WNF A;  5EX0 A;  2UY1 A;  2OOE A;  1TJC A;  4XI0 A;  1HZ4 A; 
#chains in the Genus database with same CATH topology
 3DSU A;  4I17 A;  4DX6 D;  3CEQ A;  4J8S A;  3ZUV B;  4JVS A;  3ABK E;  1OWN A;  3P2B A;  4AXH A;  3SD5 A;  3ASF A;  3ZHE A;  3FFL A;  2R5S A;  2BF0 X;  3RAU A;  3SO8 A;  2OVF A;  5CEA A;  3PRZ A;  5BV0 A;  2LXL A;  1IHB A;  3L9T A;  3EHQ A;  2OV8 A;  3IHY A;  2QFC A;  2Y69 E;  1HG5 A;  5A7D B;  1OY3 D;  2NYJ A;  4GTR A;  4F6R D;  3PDN A;  4EPZ A;  2VGX B;  4I1O B;  4HLL A;  2P9U G;  5G04 C;  4OAU C;  1UJK A;  1WG0 A;  5FQ4 A;  5AQ9 A;  5EYP F;  1OUV A;  2YHC A;  1AP7 A;  2HYZ A;  3ASD A;  3D9P A;  3NZS A;  4A63 B;  2I9C A;  3MX3 A;  5LOZ A;  1EPU A;  1HX8 A;  2NC9 A;  2QYJ A;  2ZU6 B;  3RRM B;  4DX2 A;  4AOF A;  4FC8 A;  4ILG A;  1SVX A;  3DSV A;  4HOQ A;  3LJ3 A;  4F1S A;  1HFA A;  3FUD A;  4J6I A;  1WM5 A;  3B7U X;  2DYR E;  3ASN E;  3BG1 B;  4E85 A;  4A55 A;  2I2O A;  1AWC B;  1E7U A;  2H6H A;  4A1S A;  3D9J A;  5CBO A;  2XPI A;  2OEV A;  3B7B A;  3NBN B;  3SFZ A;  1FT1 A;  3F6Q A;  5IY5 E;  4AEZ C;  5FQ8 A;  3CV0 A;  2FO7 A;  3KEA A;  4UWF A;  4AM9 A;  4JXT A;  2MRI A;  1S63 A;  5EKQ D;  2XRY A;  1JCR A;  2J4D A;  4Q94 A;  3FUJ A;  4UQX A;  5EYL A;  2CHW A;  4CYM D;  3NOG D;  4U07 A;  3S7B A;  4UI9 K;  3D9L A;  5E75 A;  2R17 C;  2VJ8 A;  2M63 A;  1XNF A;  2Y3A A;  3DEP A;  3SBT B;  5D66 A;  5EDS A;  5CMY A;  4ACK A;  4J8Y A;  3KSL A;  3T5X A;  2MYO A;  2P9N G;  1NA0 A;  3UM1 A;  1V54 E;  2XGM A;  4JHJ A;  2P9I G;  3FEY A;  4U8V D;  3IXE A;  2WXQ A;  5HQ8 A;  1DCE A;  2ZXW E;  4LEU A;  3MYV A;  3MCX A;  1H2T C;  5BXU A;  3EHR A;  5G05 C;  3RSE G;  1PAQ A;  4WUY A;  1UJJ A;  3CVU A;  1OWO A;  3CLJ A;  1E90 A;  2Y0B G;  1ZBP A;  4LER A;  3Q4A B;  3HG0 D;  4ZHB A;  3DBS A;  3Q15 A;  3PE4 A;  3SHF A;  2XGS A;  3C3O A;  2DBA A;  4GB9 A;  5J90 A;  2V5F A;  3SZ7 A;  4EEC A;  5FQ7 A;  1DNP A;  3CVX A;  1N4R A;  3FY4 A;  3EJN A;  3CHR A;  3RRU A;  4AVX A;  3EIJ A;  3DSW A;  4GZ3 A;  3VLE A;  1HS6 A;  1TNY A;  2R03 A;  4DX1 A;  4Y6W A;  3D9O A;  3HHM A;  2P9L G;  4BX9 A;  1K1A A;  2HE0 A;  3BUA A;  2V8S E;  3L82 A;  3BG0 B;  1S64 A;  1KZO A;  4FLH A;  4EQF A;  5FWQ A;  2CHZ A;  4J8D A;  1OWM A;  3AG2 E;  4PDX A;  4CT0 A;  1V55 E;  3CVL A;  4HQD A;  3QNK A;  2GRR B;  3L16 A;  2KAT A;  3BEE A;  2F0Y A;  3FHE A;  1MYO A;  2RD0 A;  4GYW A;  4K5A B;  5EIB E;  4C48 B;  1YCS B;  3S7J A;  1SA5 A;  3DXM G;  1PY1 A;  1SZA A;  1TR4 A;  3UQ3 A;  1N4Q A;  3ZGQ A;  3ULE G;  5D0O D;  1E8Z A;  4GTO A;  4MRU A;  4WNE A;  4M3O A;  2VSY A;  4A3V A;  1OWP A;  1L5J A;  2A5U A;  4G11 A;  1N9A A;  2XS1 A;  1FVF A;  2DZO A;  4KXK B;  3T8K A;  5E76 A;  4BWR A;  2EQX A;  4FHJ A;  3KEZ A;  3MEK A;  4YDE A;  2DIW A;  1H6P A;  3U64 A;  4IN3 B;  4N2S A;  2X3M A;  3FH7 A;  4U96 D;  2B0O E;  3CVN A;  3C98 A;  2BKG A;  5FIN A;  3SFY A;  5ENO D;  4I9E A;  4HI9 A;  5HRY A;  3UT8 A;  3CKB A;  1N52 A;  3V2O A;  4JHK A;  5EX0 A;  3FUE A;  2OOE A;  4WWP A;  5EIL A;  4U95 D;  3ZYM A;  2VTB A;  5B1A E;  3CHP A;  1SW6 A;  2GRO B;  2VSX E;  4LSZ E;  2ETB A;  3I4G A;  3KSQ A;  3PEU B;  1MX4 A;  5B1B E;  3E33 A;  4PH4 B;  2YIN A;  5CER B;  1BLX B;  4DK5 A;  2X6K A;  1SZ9 A;  1TNU A;  4B93 B;  3OXF A;  2IO2 C;  3I4R B;  4TUM A;  1QNF A;  5A23 A;  4DX7 D;  4BSX A;  1LF8 A;  3DST A;  2X6H A;  1Z3X A;  3FUL A;  5AYW D;  1S0P A;  1MX2 A;  4L23 A;  3TJP A;  5M72 A;  3PZ2 A;  5JHA A;  5CCL A;  1JPL A;  4ATG A;  1JUQ A;  3PNT B;  3JCK C;  1E8X A;  1ELW A;  2DYS E;  2GRP B;  2GRL A;  2X6J A;  2IFU A;  1TYQ G;  2QY7 A;  3R7R A;  4ANV A;  4KVM A;  5AN8 A;  4I2Z A;  4GCN A;  2A4Z A;  4PUC A;  3FUK A;  4O6F A;  4PS8 A;  4JHR A;  3TL5 A;  3UMV A;  3TXN A;  5JJ7 A;  5LX8 A;  2X38 A;  1D8E A;  3HYM B;  5KNH D;  3X2Q E;  3OTN A;  5ENT D;  2J07 A;  2DCP A;  4K5B A;  5DBK A;  4GU5 A;  2UY1 B;  1IQU A;  5T3R A;  1JCS A;  3AG1 E;  1U3C A;  3L17 A;  5C2Y A;  2X6F A;  4CDR A;  4RG6 A;  3DSS A;  4GTQ A;  4HXI A;  4JL0 A;  1BPO A;  2JAB A;  2OEW A;  3B7S A;  1NFI E;  2EIN E;  3Q78 A;  4UUC A;  4GML A;  3PZ1 A;  4YDW A;  4I9C A;  3FU3 A;  5KNG A;  3AS4 A;  2XEH A;  4HLE A;  4KVO A;  2MOW A;  3ASH A;  4I6J A;  4AIF A;  2H6G A;  2WQ7 A;  2L6J A;  4LNB A;  2VGY A;  3HXF A;  3NB2 A;  1HXI A;  1WAO 1;  3ZPJ A;  4NQ0 A;  1UN9 A;  5FIO A;  4XI9 A;  1N54 A;  2WPV A;  1OCZ E;  4V3I A;  3JQ0 A;  1IYG A;  4XKB A;  4DI4 A;  4W9R A;  1KT0 A;  4GTP A;  4BET A;  4DUI A;  4TRQ A;  5LCW C;  3ONK A;  2GRM A;  3W9G A;  5D2M C;  3TWV A;  4UWK A;  4DJA A;  2MHK A;  5FZS A;  1D8D A;  4J8F A;  3HXE A;  4HI8 A;  3Q75 A;  2ILR A;  4BER A;  3E30 A;  4CDN A;  3FH8 A;  3QDN A;  5EN5 D;  4GZ5 A;  2UWJ G;  3PNL B;  2KCL A;  4QFV A;  1SQM A;  4B94 A;  3DSX A;  4KBQ A;  3CK8 A;  4GCO A;  2ION A;  3TWS A;  1SA4 A;  3FTV A;  3ZEF A;  4HRM B;  5JHB A;  2V5Q C;  2IO3 C;  2XEV A;  4AY6 A;  2WXG A;  3FUF A;  2RFM A;  3HIZ A;  1O1S A;  2QZA A;  1KPS B;  1K3Z D;  3MV3 B;  4WND A;  2ETA A;  4KMO A;  4HRN A;  1WY6 A;  4JB8 P;  4CZ2 D;  1N94 A;  5AEN A;  1EF1 C;  1OCR E;  1B89 A;  2WXI A;  2R2L A;  5HKP A;  2WXH A;  1NI1 A;  5KJK A;  4U63 A;  3FUN A;  4DLQ A;  3ZKJ A;  3AU4 A;  1K1B A;  4ATZ D;  3ISM C;  4GA0 A;  3T5V A;  4G24 A;  3APC A;  5FT9 A;  3U3W A;  2HM8 A;  3FTS A;  1BI8 B;  3V79 K;  3D9M A;  1INZ A;  1IKN D;  5A6C A;  1LD7 A;  3FUH A;  2RFA A;  4B89 A;  1RW2 A;  2LO6 A;  2R59 A;  4NAC A;  4EZK A;  3CHQ A;  2R02 A;  5HI7 A;  1U3D A;  3CK7 A;  2P9S G;  4OYS A;  1VDY A;  2VYI A;  1UW4 B;  3BU8 A;  3C5R A;  1OT8 A;  3PH0 C;  3ZYQ A;  3PZ4 A;  3CHS A;  5FQ6 A;  3TWQ A;  2XZT G;  3WXX A;  2PZI A;  4L2L A;  4Z68 A;  4HVB A;  4NUR A;  2L9B A;  1DCQ A;  1MHQ A;  3L13 A;  4A3T A;  1N0Q A;  4K03 A;  3FWV A;  3SQV A;  1TJF A;  4UWH A;  3HXB A;  2XGO A;  3NOC D;  1E7V A;  3LJN A;  3FU6 A;  1NP7 A;  2CG2 A;  2RG8 A;  3JUI A;  2P9K G;  3ULQ A;  3ABM E;  4CCA A;  3LY8 A;  4YVQ C;  3SBS A;  4E6H A;  2ETC A;  5BV1 A;  1OXJ A;  3LKU A;  2NSZ A;  2BTD A;  2XQ0 A;  4O60 A;  2EIM E;  3RK6 A;  3MV2 B;  1JWG A;  2DWZ A;  1O1T A;  4BT8 A;  1WDY A;  2L0I A;  3EHN A;  3VLD A;  3AU5 A;  2LUH A;  4BES A;  2IU1 A;  3C72 A;  2EIJ E;  4C0M A;  2DZN A;  3TG5 A;  4ME2 A;  4XIF A;  1FCH A;  1LD8 A;  1O5M A;  4APO A;  3GW4 A;  2VTB B;  4FJY A;  3BQO A;  4WAF A;  4GYO A;  3QK0 A;  4FUL A;  4L7T A;  3QC1 A;  2F37 A;  3ASO E;  3T8M A;  2WQH A;  3QAR A;  2VGX A;  2PM7 A;  3ESK A;  2WMO A;  5BT1 A;  2XCB A;  2IY0 C;  4MBG A;  3CST A;  3JQ1 A;  1Y6I A;  3ZYL A;  2KXP C;  1N11 A;  1E96 B;  1N4P A;  5ANR A;  1TJC A;  4XI0 A;  3FEX A;  3ZNG A;  3FU0 A;  5KCM A;  5BPP A;  1TNO A;  2V0P A;  3E32 A;  4HOR A;  3EU9 A;  4XEI G;  5ENN A;  4Q96 A;  3RIB A;  2R05 A;  3APF A;  2LNI A;  2KCK A;  3R9A B;  2HO1 A;  1W3B A;  4J8E A;  3I3N A;  3Q7F A;  1TNB A;  4UWL A;  4OAV B;  1MJ0 A;  4APF A;  2LSU A;  3Q49 B;  3HVE B;  3P1U A;  5AQA A;  2DVW A;  2AVP A;  3FP3 A;  2OND A;  5KWD A;  2FF4 A;  2VQ2 A;  4JW1 A;  1QYM A;  2Q7F A;  3RO3 A;  3OXG A;  3LVR E;  1LTX A;  4KT6 B;  2PNN A;  3UTM A;  3ZIM A;  3PRE A;  4N2Q A;  5HS0 A;  1TN6 A;  4M7C A;  3QOU A;  2WXP A;  3QWP A;  4LUN U;  4OVV A;  3FH5 A;  3MGB A;  1UG3 A;  1NZN A;  4I6E A;  4FHK A;  2J8S D;  3PE3 A;  4N5Q A;  2KBX A;  3HRA A;  4CEM A;  4MLP A;  3G2U A;  4L2Y A;  2GW1 A;  3D9I A;  2RKK A;  4FA6 A;  4CGW A;  2FBN A;  3CVQ A;  3PEV B;  5FJY A;  4EZL A;  2IQC A;  3TWW A;  3J5Q B;  3PZ3 A;  5AJD A;  4HS2 A;  3ZHE B;  3DRA A;  3KD7 A;  2WXN A;  2IJG X;  4ANW A;  3IV0 A;  4CT4 A;  3SY2 A;  2JLB A;  4N3C A;  1ZB1 A;  2IOL A;  4G26 A;  2XS8 A;  1Z3Y A;  4JD2 G;  4IRU A;  3CQC B;  4UQY A;  4AY5 A;  3R7Q A;  1N95 A;  4I43 A;  4U8Y D;  2F8Y A;  2WM9 A;  3CIA A;  3Q79 A;  5KJN A;  3DEO A;  1X5B A;  3GZS A;  5T4Y A;  3U66 A;  4I6G A;  3L6A A;  5EID A;  1KT1 A;  3TWR A;  2FO1 E;  1YMP A;  4BTA A;  1D9S A;  4ANX A;  4LNG A;  3E4B A;  5CRU A;  4FAD A;  3QWV A;  4UI9 C;  3DXK G;  3ML9 A;  1N0R A;  2YHE A;  1JCQ A;  4LG6 A;  3Q73 A;  3SNX A;  4TV3 A;  2ZIR A;  3IKO B;  3MKQ A;  4BTB A;  3ONL A;  4NIK A;  3LEW A;  4N3B A;  5AAO A;  3Q9N C;  4F3V A;  3TG4 A;  4YDY A;  4HOT A;  3G2V A;  5FZQ A;  4RG9 A;  3UM2 A;  2P2C P;  3CVV A;  4MKT A;  2J08 A;  2I1K A;  4HFG A;  1QZ2 A;  3O4Z A;  3UI2 A;  4HOS A;  2H6I A;  1HE8 A;  1A17 A;  4GA2 A;  4Q69 A;  5ARG A;  4FU3 A;  4B8C B;  3VTY A;  1K8K G;  4B8A A;  4DLO A;  4P29 A;  2GGF A;  3OXL A;  3RKV A;  3UXG A;  2BED A;  2F8X K;  3PZD A;  4GPK A;  4J0U A;  1H2V C;  5AQ7 A;  3MKR A;  1YA0 A;  3ABL E;  3V31 A;  3UPV A;  3TXM A;  3ZU7 B;  2IF4 A;  5J08 A;  2LAH A;  1ELR A;  2KZT A;  2VGE A;  2XPY A;  3HXC A;  1IQR A;  2GRN B;  3L22 A;  3B95 A;  3D9N A;  4BT9 A;  2XEN A;  2XZD G;  1GW6 A;  4CDM A;  3EUV A;  4EBA A;  3SF4 A;  5AIJ A;  3CVP A;  4JZY A;  5ENP D;  3GYZ A;  4RLY A;  3UM0 A;  4U0Z A;  4GPM A;  2CFU A;  5CRV A;  2WXO A;  1EDU A;  4HB5 A;  1OCC E;  3QAQ A;  2GRQ B;  5ANL A;  3SI5 A;  5EX3 A;  3V30 A;  2Y1L E;  2OVB A;  4N39 A;  3MZL B;  3HDX A;  2V4H C;  2EIL E;  3D9K A;  3PS6 A;  3RRN B;  5CED B;  4AP2 A;  1HF8 A;  1QQE A;  2QYU A;  3S7F A;  3LVQ E;  2BKK B;  1NA3 A;  3FU5 A;  5G04 J;  4JA9 A;  2KCV A;  3AJI A;  1ELK A;  4WNG A;  2J9Q A;  4RSY A;  4G2V A;  2VSN A;  3IEG A;  4URK A;  4DI3 A;  4JA7 A;  4X8Q A;  2AXU A;  3EIQ C;  3IBE A;  1MX6 A;  5FTP A;  5G55 A;  4K0R A;  1PC2 A;  4G23 A;  1S70 B;  3ZVV A;  3APD A;  3LDZ A;  3WG7 E;  3S7D A;  4XX5 A;  4U0S A;  2LAI A;  1IXV A;  2WQ6 A;  5G2N A;  4EBA G;  4IUL A;  2AJA A;  3ML8 A;  1H6K A;  3RU0 A;  3Q5M A;  3NQP A;  1MQS A;  4YND A;  3FDH A;  3UIN C;  3UT7 A;  1JWF A;  3D9H A;  3B7T A;  3CSF A;  1E8Y A;  1QBQ A;  3B13 A;  2XPZ A;  3TWX A;  3U4T A;  3C3Q A;  3ZN3 A;  1O1R A;  4GZ6 A;  4GMR A;  3PUJ A;  3ZXP A;  3U9W A;  1KLX A;  1UOH A;  2L6B A;  4ZFH A;  5CEC B;  1EYH A;  4DRX E;  4WNF A;  4WWN A;  2WMN A;  2UY1 A;  4GMJ A;  2A5E A;  1HZ4 A;  3NAW A;  2KC7 A;  2KM4 A;  4K5C A;  1NL4 A;  4A1G A;  3CQG B;  4N3A A;  2AW6 A;  4H7X A;  1Q2Z A;  3NF1 A;  4O1P A;  3ULY A;  5BUZ A;  2ZIS A;  2WB2 A;  4GTM A;  2JEK A;  3ZW3 A;  4KZC A;  2E0I A;  2WXM A;  4N5C A;  4DPR A;  1A5E A;  4F7A A;  3L54 A;  4GA1 A;  2FEZ A;  4IYP A;  5H7P A;  5CBN A;  3JUE A;  3LPZ A;  5G05 J;  3T9K A;  4RVB A;  3EU5 A;  2IOS A;  2XEE A;  4JEU A;  1XGW A;  2OCC E;  4L1B A;  3UIP C;  3Q7A A;  4ANU A;  3E37 A;  3JYS A;  4G8K A;  4R7L A;  4U7E B;  1ZU2 A;  3Q9U C;  2I6H A;  3FUM A;  4ILH B;  3CR3 A;  4FLB A;  5KJL A;  3EHM A;  4F1P A;  3ASG A;  1HH8 A;  4YDO A;  2E2E A;  4LRZ A;  4EZJ A;  4XKC A;  3L08 A;  1MZC A;  3LS8 A;  3DPY A;  4JPS A;  3JXI A;  3DWL G;  4LNU D;  4LCT A;  4TXP A;  4YVO A;  3Q47 B;  1UN8 A;  3B7R L;  4GTT A;  2X6I A;  1HO8 A;  5JMN D;  3UT4 A;  4CGV A;  3CHM A;  2WXR A;  4TXR A;  2J4B A;  3SFX A;  4EHM A;  2FI7 A;  4DX5 D;  3AAA C;  2P9P G;  5JA4 D;  4RQI A;  3NZU A;  3D3M A;  4UWG A;  3G2S A;  3AG3 E;  1BI7 B;  3MKQ B;  3C3R A;  3S2A A;  5CMW A;  4KZ0 A;  3K9I A;  4PS3 A;  4C0E A;  3O48 A;  4JEH A;  3PVL A;  3ZFW A;  2PM6 A;  5C1D A;  1X81 A;  2FUL A;  1BU9 A;  4BFR A;  4Y6C A;  2QC9 A;  3UIO C;  4G8L A;  3N71 A;  4J7W A;  4XE0 A;  2WVI A;  4BY6 A;  4F53 A;  2XRZ A;  2C2L A;  3AG4 E;  2PQN A;  5T8I A;  4AJW A;  5AAR A;  2EIK E;  4TUU A;  5BXO A;  3CGH A;  5AJL A;  3ESL A;  5ENR D;  2J09 A;  4AV7 A;  2AXZ A;  3QB2 A;  5B3S E;  3AS8 A;  3UUX A;  3AS5 A;  1TNZ A;  3TWU A;  1YYH A;  2Y4T A;  3V2X A;  3LY9 A;  5LP0 A;  1FT2 A;  3OAW A;  3I5P A;  5ARF A;  4GYY A;  2CHX A;  4WWO A;  4BSZ B;  3ZXS A;  2XHE A;  4BX8 A;  3FTY A;  2Y4U A;  2YNQ A;  2NXP A;  2KZT B;  4B0Z A;  2VSO E;  3J5P A;  2AWI A;  4GZD A;  1IHG A;  3SGH A;  3JXJ A;  4HOU A;  3KAE A;  1Z5S C;  3LCA A;  4GZC A;  4JC8 A;  1H19 A;  3IHV A;  3FUI A;  1P5Q A;  2LXM A;  3UX4 A;  4G25 A;  1H2U A;  3ZRH A;  3LXU X;  2LSV A;  2ZGD A;  3RJV A;  2C0L A;  4TXQ A;  3UM3 A;  2YQ8 A;  3QWW A;  3LY7 A;  2WXL A;  2I1J A;  4NRH B;  4MS6 A;  1H0A A;  1H6O A;  1HG2 A;  4I1A A;  2WXK A;  3PUK A;  2ZGG A;  1Z6T A;  4I2W A;  1N4S A;  4QQI A;  3G2W A;  1OCO E;  1KZP A;  4UQZ A;  4BEP A;  3GZ1 A;  1U2V G;  3FTZ A;  3URZ A;  2H6F A;  4C9B B;  2HR2 A;  5LFA A;  3DPD A;  4UI9 J;  3E34 A;  2WXJ A;  4U0U A;  4XZ4 A;  3EDT B;  3TGO A;  4FP7 A;  1RZ4 A;  4OVU A;  5AQB A;  3QJZ A;  3FTU A;  4PS7 A;  1HU3 A;  2CG3 A;  2AXV A;  1OWL A;  1BD8 A;  5KJM A;  2V4L A;  3GZ2 A;  2BUG A;  3FTW A;  4U04 A;  3CHO A;  1FVH A;  5JJT A;  3ZYK A;  5CCM A;  2P58 C;  3ENE A;  4HBD A;  2XCC A;  5JJ6 A;  3R9M A;  4FJZ A;  4KYO B;  4I1M A;  4GTV A;  4D10 C;  1TN7 A;  4O1O A;  4HRL A;  5CHE E;  2IEJ A;  3HXD A;  4CRW A;  5ENS D;  2C0M A;  1E8W A;  3UKU G;  4GTS A;  3CK9 A;  5BW8 C;  1TEZ A;  3TWT A;  4L9P A;  4ABN A;  5ITZ F;  3LYA A;  3TAX A;  3VLF A;  3G2T A;  1G3N B;  5D0Q D;  1Y8M A;  4G1T A;  3MJW A;  3RO2 A;  1DVP A;  2J49 A;  4GAA A;  3FTX A;  2CFZ A;  5BNW A;  4H7Y A;  3HVE A;  1TN8 A;  2B6C A;  3VTX A;  5DIZ A;  2PL2 A;  2WXF A;  3CKC A;  2PQR A;  2L0T B;  5ENQ D;  3W9F A;  3CVY A;  3MA5 A;  3QKY A;  3KS2 A;  5LCW J;  1FPP A;  5FZR A;  4U8H A;  4ACL A;  1DC2 A;  3UKR G;  4ILI A;  3CVW A;  4HNA D;  5KBA A; 
#chains in the Genus database with same CATH homology
 2KC7 A;  3ZYM A;  2VTB A;  2V0P A;  4I17 A;  2KM4 A;  3CHP A;  3CEQ A;  4HOR A;  4J8S A;  5ENN A;  4A1G A;  4Q96 A;  3CQG B;  4N3A A;  2VSX E;  2AW6 A;  4H7X A;  3I4G A;  3PEU B;  4JVS A;  3RIB A;  3APF A;  3NF1 A;  2LNI A;  1OWN A;  3P2B A;  4AXH A;  5BUZ A;  2KCK A;  3SD5 A;  4PH4 B;  2YIN A;  3ASF A;  2WB2 A;  4DK5 A;  2JEK A;  3ZHE A;  3FFL A;  3ZW3 A;  3R9A B;  2HO1 A;  2X6K A;  2R5S A;  1SZ9 A;  1W3B A;  4J8E A;  2BF0 X;  3OXF A;  2E0I A;  4KZC A;  3I3N A;  2WXM A;  4N5C A;  3I4R B;  4UWL A;  2OVF A;  4DPR A;  3PRZ A;  1QNF A;  5BV0 A;  5A23 A;  4BSX A;  1LF8 A;  4APF A;  2OV8 A;  3IHY A;  2LSU A;  2X6H A;  3Q49 B;  4F7A A;  3HVE B;  3L54 A;  4GA1 A;  1Z3X A;  2FEZ A;  3P1U A;  4IYP A;  3FUL A;  5AYW D;  2QFC A;  3LPZ A;  2AVP A;  5G05 J;  3FP3 A;  1S0P A;  1HG5 A;  2OND A;  4RVB A;  5A7D B;  2FF4 A;  4L23 A;  2VQ2 A;  2IOS A;  4JEU A;  4JW1 A;  1XGW A;  3TJP A;  5M72 A;  5JHA A;  5CCL A;  2Q7F A;  1JPL A;  4L1B A;  4ATG A;  1JUQ A;  3PNT B;  4ANU A;  3RO3 A;  3JCK C;  3OXG A;  1E8X A;  3PDN A;  3LVR E;  1ELW A;  3JYS A;  4EPZ A;  2X6J A;  2GRL A;  2IFU A;  4KT6 B;  3ZIM A;  4R7L A;  2VGX B;  2QY7 A;  4I1O B;  3R7R A;  4KVM A;  4ANV A;  1ZU2 A;  3PRE A;  4I2Z A;  4GCN A;  4N2Q A;  2A4Z A;  4PUC A;  5G04 C;  3FUK A;  1UJK A;  4O6F A;  4PS8 A;  5FQ4 A;  2I6H A;  3QOU A;  4JHR A;  3TL5 A;  3FUM A;  3UMV A;  2WXP A;  3TXN A;  5JJ7 A;  3QWP A;  1OUV A;  2YHC A;  4ILH B;  4LUN U;  5LX8 A;  4OVV A;  2X38 A;  3CR3 A;  3FH5 A;  2HYZ A;  3HYM B;  4FLB A;  3MGB A;  1UG3 A;  1NZN A;  3ASD A;  3OTN A;  4I6E A;  5KJL A;  3D9P A;  4FHK A;  3NZS A;  2J07 A;  3EHM A;  2I9C A;  2DCP A;  3MX3 A;  5DBK A;  4GU5 A;  2UY1 B;  3ASG A;  1EPU A;  3PE3 A;  5LOZ A;  1HH8 A;  1HX8 A;  2NC9 A;  1IQU A;  2E2E A;  4LRZ A;  4EZJ A;  4XKC A;  5T3R A;  2ZU6 B;  4CEM A;  4MLP A;  3RRM B;  3G2U A;  4AOF A;  4FC8 A;  3L08 A;  1U3C A;  3L17 A;  3LS8 A;  2X6F A;  4ILG A;  4L2Y A;  5C2Y A;  4RG6 A;  4CDR A;  2GW1 A;  4HXI A;  4JL0 A;  3D9I A;  4HOQ A;  1BPO A;  3B7S A;  3LJ3 A;  4F1S A;  4FA6 A;  4CGW A;  1HFA A;  2FBN A;  3CVQ A;  3PEV B;  4JPS A;  5FJY A;  3FUD A;  4J6I A;  1WM5 A;  4EZL A;  2IQC A;  3B7U X;  4GML A;  3BG1 B;  4LCT A;  4E85 A;  4YVO A;  4I9C A;  4A55 A;  2I2O A;  3FU3 A;  3Q47 B;  3AS4 A;  1UN8 A;  1E7U A;  3B7R L;  4HLE A;  4KVO A;  5AJD A;  2MOW A;  2X6I A;  1HO8 A;  3ASH A;  4I6J A;  4HS2 A;  3ZHE B;  4A1S A;  4AIF A;  3KD7 A;  3UT4 A;  2WQ7 A;  3D9J A;  4CGV A;  3CHM A;  2WXR A;  2L6J A;  2J4B A;  2WXN A;  2XPI A;  2FI7 A;  2IJG X;  2VGY A;  4ANW A;  1HXI A;  3IV0 A;  3SFZ A;  4CT4 A;  1WAO 1;  2JLB A;  3ZPJ A;  4N3C A;  4NQ0 A;  2IOL A;  3NZU A;  1UN9 A;  5FQ8 A;  4AEZ C;  3CV0 A;  3D3M A;  4G26 A;  1N54 A;  4UWG A;  3G2S A;  4XI9 A;  2FO7 A;  4AM9 A;  4UWF A;  4JXT A;  2MRI A;  1Z3Y A;  3MKQ B;  2WPV A;  5EKQ D;  2XRY A;  4IRU A;  2J4D A;  3S2A A;  4V3I A;  5CMW A;  3CQC B;  3JQ0 A;  4UQY A;  3R7Q A;  4KZ0 A;  4XKB A;  3K9I A;  4AY5 A;  1IYG A;  4PS3 A;  4C0E A;  4I43 A;  1KT0 A;  4W9R A;  2WM9 A;  4DI4 A;  3CIA A;  4TRQ A;  5LCW C;  4Q94 A;  5KJN A;  3O48 A;  1X5B A;  3FUJ A;  3ONK A;  4UQX A;  2GRM A;  3GZS A;  2CHW A;  4JEH A;  3PVL A;  4UWK A;  4U07 A;  4I6G A;  3L6A A;  5T4Y A;  3ZFW A;  3S7B A;  2MHK A;  4DJA A;  3U66 A;  5FZS A;  4J8F A;  1KT1 A;  2PM6 A;  5C1D A;  2FUL A;  4BTA A;  4UI9 K;  3D9L A;  2ILR A;  5E75 A;  4ANX A;  4Y6C A;  4BFR A;  3E4B A;  4FAD A;  4CDN A;  2R17 C;  3QWV A;  2VJ8 A;  4UI9 C;  3N71 A;  2M63 A;  3FH8 A;  1XNF A;  2Y3A A;  4XE0 A;  2WVI A;  3SBT B;  3QDN A;  4BY6 A;  4F53 A;  3ML9 A;  2XRZ A;  4GZ5 A;  5EDS A;  2C2L A;  2UWJ G;  2YHE A;  3PNL B;  2KCL A;  5CMY A;  4ACK A;  4QFV A;  2PQN A;  5T8I A;  4AJW A;  1SQM A;  3SNX A;  4B94 A;  4TV3 A;  3T5X A;  3IKO B;  3MKQ A;  4KBQ A;  4TUU A;  3CK8 A;  4GCO A;  2ION A;  1NA0 A;  3CGH A;  4BTB A;  3ONL A;  5AJL A;  3ESL A;  3FTV A;  3ZEF A;  4AV7 A;  2J09 A;  3LEW A;  2XGM A;  5JHB A;  4N3B A;  4JHJ A;  2XEV A;  4AY6 A;  2AXZ A;  2WXG A;  3QB2 A;  3FUF A;  3HIZ A;  3AS8 A;  3UUX A;  3FEY A;  4F3V A;  3TG4 A;  2WXQ A;  3AS5 A;  3MV3 B;  5HQ8 A;  4WND A;  4LEU A;  4HOT A;  3G2V A;  5FZQ A;  4RG9 A;  3MYV A;  3MCX A;  1H2T C;  4KMO A;  1WY6 A;  2Y4T A;  5G05 C;  3CVV A;  4MKT A;  1PAQ A;  2J08 A;  4WUY A;  1UJJ A;  3LY9 A;  5LP0 A;  2I1K A;  3CVU A;  5AEN A;  3OAW A;  1EF1 C;  3I5P A;  5ARF A;  4GYY A;  1OWO A;  1QZ2 A;  2CHX A;  3CLJ A;  4HFG A;  1B89 A;  3O4Z A;  4WWO A;  3ZXS A;  4HOS A;  2WXI A;  2XHE A;  1E90 A;  4BX8 A;  3FTY A;  1HE8 A;  2Y4U A;  1A17 A;  4GA2 A;  1ZBP A;  4Q69 A;  4LER A;  5ARG A;  2YNQ A;  4FU3 A;  2NXP A;  3Q4A B;  4B8C B;  2KZT B;  2WXH A;  3VTY A;  3DBS A;  3Q15 A;  4B8A A;  4B0Z A;  2VSO E;  4DLO A;  3PE4 A;  3SHF A;  4P29 A;  5KJK A;  4U63 A;  3FUN A;  2AWI A;  4DLQ A;  4GZD A;  1IHG A;  3SGH A;  2GGF A;  3AU4 A;  4HOU A;  2XGS A;  3KAE A;  3OXL A;  3RKV A;  3LCA A;  2DBA A;  4GZC A;  4GA0 A;  4JC8 A;  1H19 A;  3IHV A;  3FUI A;  3T5V A;  1P5Q A;  3UX4 A;  4G25 A;  1H2U A;  4G24 A;  4GB9 A;  3APC A;  3ZRH A;  5FT9 A;  5J90 A;  3LXU X;  3PZD A;  3U3W A;  2HM8 A;  2LSV A;  4GPK A;  3FTS A;  4J0U A;  2V5F A;  3SZ7 A;  1H2V C;  4EEC A;  5FQ7 A;  1DNP A;  3CVX A;  3RJV A;  2C0L A;  3D9M A;  1INZ A;  2YQ8 A;  3MKR A;  1YA0 A;  3FY4 A;  2WXL A;  3LY7 A;  3QWW A;  2I1J A;  4NRH B;  4MS6 A;  1H0A A;  5A6C A;  4I1A A;  1HG2 A;  3UPV A;  3EJN A;  3TXM A;  2WXK A;  3CHR A;  3FUH A;  2IF4 A;  3RRU A;  5J08 A;  4AVX A;  4B89 A;  3EIJ A;  2LAH A;  3PUK A;  3VLE A;  4GZ3 A;  1Z6T A;  1ELR A;  4I2W A;  2LO6 A;  2R59 A;  4NAC A;  4EZK A;  3G2W A;  1HS6 A;  3CHQ A;  2KZT A;  5HI7 A;  1U3D A;  3CK7 A;  2XPY A;  4OYS A;  1VDY A;  1IQR A;  3L22 A;  4UQZ A;  2VYI A;  3D9N A;  4BT9 A;  1GW6 A;  3GZ1 A;  4CDM A;  4Y6W A;  4EBA A;  3FTZ A;  3URZ A;  1UW4 B;  3SF4 A;  5AIJ A;  3D9O A;  3CVP A;  4C9B B;  4JZY A;  3GYZ A;  3HHM A;  2HR2 A;  3PH0 C;  3ZYQ A;  5LFA A;  3DPD A;  4UI9 J;  2WXJ A;  4U0Z A;  2CFU A;  3CHS A;  4U0U A;  4BX9 A;  4XZ4 A;  5FQ6 A;  2WXO A;  3EDT B;  1EDU A;  3TGO A;  4FP7 A;  4OVU A;  2V8S E;  3WXX A;  3QJZ A;  3QAQ A;  2PZI A;  3BG0 B;  3FTU A;  4PS7 A;  4FLH A;  4L2L A;  5ANL A;  4EQF A;  3SI5 A;  1HU3 A;  2CG3 A;  5EX3 A;  2AXV A;  4N39 A;  2OVB A;  1OWL A;  3MZL B;  5FWQ A;  2CHZ A;  3HDX A;  4J8D A;  4HVB A;  4NUR A;  2L9B A;  3D9K A;  5KJM A;  3PS6 A;  2V4L A;  1OWM A;  1MHQ A;  3L13 A;  3GZ2 A;  4PDX A;  2BUG A;  3RRN B;  4A3T A;  3FTW A;  4U04 A;  4AP2 A;  4CT0 A;  1HF8 A;  1QQE A;  3CHO A;  1FVH A;  5JJT A;  3ZYK A;  4K03 A;  2P58 C;  3ENE A;  3FWV A;  5CCM A;  3S7F A;  3CVL A;  3LVQ E;  1TJF A;  4UWH A;  1NA3 A;  2XCC A;  2XGO A;  1E7V A;  3FU5 A;  5JJ6 A;  3QNK A;  4FJZ A;  4KYO B;  4JA9 A;  2KCV A;  5G04 J;  3FU6 A;  1NP7 A;  2KAT A;  1ELK A;  2CG2 A;  2RG8 A;  3BEE A;  2J9Q A;  3JUI A;  3L16 A;  4I1M A;  4WNG A;  3ULQ A;  4CCA A;  4D10 C;  4RSY A;  3FHE A;  3LY8 A;  4G2V A;  2VSN A;  2RD0 A;  3IEG A;  5CHE E;  4YVQ C;  4GYW A;  3SBS A;  4URK A;  4DI3 A;  4JA7 A;  4E6H A;  5BV1 A;  2AXU A;  3S7J A;  1PY1 A;  4CRW A;  3EIQ C;  2C0M A;  1SZA A;  3UQ3 A;  1E8W A;  3IBE A;  3LKU A;  2NSZ A;  2BTD A;  2XQ0 A;  5FTP A;  3CK9 A;  5BW8 C;  1TEZ A;  5G55 A;  3RK6 A;  4K0R A;  1PC2 A;  4G23 A;  4ABN A;  3MV2 B;  3ZVV A;  3LYA A;  3TAX A;  3ZGQ A;  1JWG A;  5D0O D;  3VLF A;  3G2T A;  3APD A;  4BT8 A;  3LDZ A;  1E8Z A;  3S7D A;  2L0I A;  4XX5 A;  3EHN A;  5D0Q D;  4U0S A;  4MRU A;  1Y8M A;  2LAI A;  3VLD A;  3AU5 A;  4G1T A;  3MJW A;  4WNE A;  4M3O A;  2VSY A;  4A3V A;  1OWP A;  1L5J A;  2A5U A;  3RO2 A;  4G11 A;  1DVP A;  1FVF A;  2J49 A;  2WQ6 A;  2IU1 A;  5G2N A;  4EBA G;  4KXK B;  4GAA A;  4IUL A;  3FTX A;  4C0M A;  3ML8 A;  5E76 A;  1H6K A;  3TG5 A;  2CFZ A;  3RU0 A;  4ME2 A;  4XIF A;  5BNW A;  4H7Y A;  3HVE A;  4BWR A;  1FCH A;  3Q5M A;  2EQX A;  3NQP A;  1MQS A;  4YND A;  4FHJ A;  3KEZ A;  3MEK A;  4APO A;  3GW4 A;  3FDH A;  3UT7 A;  2VTB B;  1JWF A;  4FJY A;  4WAF A;  3B7T A;  3CSF A;  3QK0 A;  4FUL A;  4GYO A;  1E8Y A;  2DIW A;  3QC1 A;  4L7T A;  3VTX A;  3U64 A;  4IN3 B;  5DIZ A;  4N2S A;  3B13 A;  2XPZ A;  2PL2 A;  2WXF A;  3U4T A;  3CKC A;  2PQR A;  2X3M A;  3T8M A;  2L0T B;  3FH7 A;  3ZN3 A;  2WQH A;  3QAR A;  2VGX A;  2PM7 A;  3ESK A;  2WMO A;  5BT1 A;  2XCB A;  4GZ6 A;  3CVY A;  3PUJ A;  3CVN A;  3C98 A;  3CST A;  3U9W A;  1KLX A;  3MA5 A;  3JQ1 A;  3QKY A;  1Y6I A;  4I9E A;  3ZYL A;  3KS2 A;  5LCW J;  3UT8 A;  3CKB A;  5FZR A;  1N52 A;  1EYH A;  1E96 B;  4WNF A;  4WWN A;  4U8H A;  4JHK A;  2WMN A;  4ACL A;  5ANR A;  5EX0 A;  3FUE A;  2UY1 A;  2OOE A;  1TJC A;  4WWP A;  4XI0 A;  4ILI A;  3FEX A;  3CVW A;  4GMJ A;  3FU0 A;  5KCM A;  1HZ4 A;  5BPP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...