1Y8MA

Solution structure of yeast mitochondria fission protein fis1
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
144
structure length
144
Chain Sequence
MTKVDFWPTLKDAYEPLYPQQLEILRQQVVSEGGPTATIQSRFNYAWGLIKSTDVNDERLGVKILTDIYKEAESRRRECLYYLTIGCYKLGEYSMAKRYVDTLFEHERNNKQVGALKSMVEDKIQKETLKGVVVAGGVHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel structure of the N terminus in yeast Fis1 correlates with a specialized function in mitochondrial fission.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Unknown function
molecule keywords Fis1
total genus 43
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2004-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14852 Fis1_TPR_N Fis1 N-terminal tetratricopeptide repeat
A PF14853 Fis1_TPR_C Fis1 C-terminal tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1y8mA01
4XIFA 3ASGA 4WNEA 3R9AB 1IYGA 4BT9A 3Q5MA 3Q47B 2BUGA 3S7FA 2XCBA 3OXFA 4J0UA 4RG6A 5JJTA 1KT0A 1IHGA 4CDRA 1NZNA 2XGOA 3FWVA 3S7BA 4BWRA 5KJNA 4BTAA 3NF1A 4ME2A 3CVPA 3U4TA 3RJVA 2ONDA 5JJ7A 2KATA 2KCLA 2MHKA 2UWJG 4RG9A 3ULQA 3ZGQA 4N3AA 3ZPJA 1KT1A 3S7DA 3SZ7A 3CK8A 2HYZA 4G23A 2C2LA 3GZ1A 4EQFA 3OXGA 4N2QA 3QOUA 3LY7A 4U0SA 2IF4A 2PL2A 1Y8MA 2PZIA 3CKBA 3MA5A 3QKYA 5G05C 3MKRA 3S7JA 3E4BA 4WUYA 4JA7A 4NQ0A 5HI7A 1QQEA 2I6HA 5G05J 3ASDA 3CV0A 3TG5A 2NC9A 5FT9A 1NA0A 5D0QD 4GZ5A 2L6JA 4UQXA 3BEEA 3TG4A 5BNWA 4XI0A 1ELWA 2FBNA 3LPZA 4I2WA 2UY1A 2VSYA 1HH8A 3LY8A 4I1AA 5EKQD 4JL0A 3VTXA 3GZ2A 3CEQA 1B89A 3RKVA 2VQ2A 2YHCA 3ZFWA 4AIFA 2R5SA 4IN3B 4F3VA 3QWVA 3QWPA 2HO1A 4H7XA 5FZSA 1ZU2A 4W9RA 5LCWJ 2JLBA 3CK9A 4O6FA 5CHEE 4HORA 2PQNA 5LCWC 5DIZA 2FF4A 5KJMA 4UI9J 5CCMA 4N5CA 5A7DB 1ZBPA 3N71A 3U3WA 1W3BA 2FO7A 2P58C 2XPIA 3Q15A 4N39A 5M72A 4UQZA 3ZHEA 4U04A 3HYMB 4I17A 3CK7A 5KJLA 3LCAA 3AS5A 2V5FA 4JHRA 4XI9A 3EDTB 4YNDA 1FCHA 2LSUA 4APOA 1A17A 2VGXA 2YQ8A 3CVNA 3O48A 4BT8A 3KD7A 4Y6CA 4I9CA 4U0ZA 3RO3A 4A1SA 5FZQA 5C1DA 4U0UA 3OXLA 5G04C 5A6CA 3PE3A 4ABNA 2E2EA 2VYIA 4GYOA 3IEGA 3MEKA 4AM9A 5BT1A 4CGVA 5G04J 1HXIA 1HZ4A 3CVLA 4GCOA 4HOSA 4KBQA 3K9IA 1TJCA 3AS8A 3Q49B 2XCCA 4JA9A 4LEUA 2GW1A 4U07A 4HOTA 3UUXA 2VGXB 3ASFA 2C0LA 4WNGA 1XNFA 3KS2A 2LNIA 4G25A 3LYAA 4GZ6A 4J8FA 2LSVA 3PDNA 5ARFA 5BW8C 2J9QA 3LKUA 5ARGA 3RIBA 2WPVA 4GA0A 4G1TA 4GYYA 4AY6A 4I9EA 1QZ2A 4WNFA 3RO2A 5HQ8A 4N2SA 5EX0A 2DBAA 2Q7FA 5DBKA 3UPVA 4NRHB 2IFUA 2FI7A 3KAEA 3ZHEB 5FJYA 4B94A 4H7YA 4HOQA 3FP3A 4GA2A 2HR2A 4J8DA 5KJKA 3URZA 3MV2B 4GCNA 5D0OD 3RU0A 2C0MA 2Y4UA 3WXXA 3VTYA 2KCKA 3PE4A 2AVPA 1WAO1 4KYOB 2VSNA 1PC2A 2XEVA 4UQYA 4UI9C 4I2ZA 1E96B 4BTBA 3SF4A 4G26A 3TGOA 1OUVA 4AY5A 4N3BA 1NA3A 5JJ6A 3Q4AB 2KC7A 4G2VA 4G24A 5FTPA 3GW4A 2WQHA 2XGMA 5FZRA 4Y6WA 2Y4TA 3JYSA 3GYZA 3FFLA 4YVOA 2OOEA 3QDNA 3CKCA 4GZ3A 4YVQC 1YA0A 5EX3A 3UQ3A 2FEZA 2UY1B 4HOUA 2KCVA 2VGYA 5CCLA 2QFCA 3ZN3A 3ASHA 4GA1A 2PQRA 4GYWA 4KXKB 4CGWA 4GPKA 3AS4A 3LY9A 4J8EA 3MV3B 1KLXA 3TAXA 4UI9K 1P5QA 3CVQA 1ELRA 3ESKA 4N3CA 2XGSA 5AYWD 1WM5A 3QWWA 4WNDA
chains in the Genus database with same CATH superfamily
3T5XA 3SFZA 2WMOA 4GMJA 3MYVA 2BUGA 3FY4A 3JQ0A 1L5JA 3DSXA 2KATA 3ZGQA 3ASOE 5T8IA 3E37A 4DUIA 3S2AA 4ZFHA 4U0SA 1LD8A 3C98A 1QQEA 2DWZA 3TG5A 3IHVA 1HH8A 3V31A 4UUCA 1D8DA 3ZNGA 3E33A 3CVYA 3V2OA 1IKND 4W9RA 4GTQA 2DYRE 4DX5D 5LCWC 4M7CA 5J90A 3FUHA 2PNNA 3N71A 5AN8A 1TJFA 2P58C 1KZOA 3AS5A 4C9BB 2XPYA 3L6AA 1X5BA 4FU3A 3Q79A 2VSOE 3KSLA 2WXMA 2LNIA 3U64A 3ONLA 3PEVB 3FUJA 5T3RA 3E30A 5BV0A 2RFAA 2C0MA 1H2VC 2XEVA 5ENTD 4J8YA 2KXPC 1N4SA 2L0TB 1E90A 2X6IA 2ZGDA 2UY1B 3LDZA 2QFCA 3PZ1A 3ASHA 1D9SA 5BXUA 3EU5A 4BT9A 1RZ4A 3FUDA 4NIKA 3S7BA 2WXGA 4XX5A 3BUAA 1TNBA 4TXPA 2P9IG 2J4BA 2XZDG 4FLHA 3RRNB 4NQ0A 4ATZD 2J4DA 1OCCE 2NC9A 5D0QD 2GGFA 4F6RD 4UQXA 4DLQA 1NL4A 2F8YA 3Q7AA 4F3VA 4TUUA 3DBSA 2H6IA 1ZBPA 2DZNA 4N39A 3HYMB 2AW6A 3P2BA 1BI7B 3ABKE 2BF0X 2V5FA 3EDTB 1A17A 5FQ7A 4J8SA 4I6GA 4LERA 3AS8A 3Q49B 2NXPA 2IQCA 4KT6B 1XNFA 4G25A 3C72A 1H0AA 3CVXA 5CRVA 2BKGA 2HM8A 4CZ2D 1QZ2A 2LAIA 2ZIRA 4HLLA 1Q2ZA 4K5AB 5KJKA 3DPDA 4BEPA 3FTVA 2RKKA 5D0OD 5ENQD 3MKQA 2H6HA 3HXFA 3RSEG 1H6OA 4G26A 4AY5A 1QBQA 1NA3A 4DX6D 1H19A 2XGMA 1KPSB 4HOUA 4JB8P 5CECB 1JWFA 2X6JA 1S70B 5ANLA 1IYGA 2RFMA 5JJTA 2XGOA 2XRYA 1O1SA 3U4TA 4GZDA 5JJ7A 1UJJA 3UTMA 2HYZA 3IHYA 3ZYKA 2X6HA 3MA5A 4G11A 3MKRA 4JA7A 4K5BA 1FVFA 5ENSD 1ELWA 1IHBA 2J8SD 4ANXA 4HBDA 4AIFA 2R5SA 3QWVA 3FULA 4PUCA 3U9WA 3B13A 1HS6A 3D9NA 5KJLA 3LCAA 5CRUA 4Q96A 3ZVVA 2EINE 2P9SG 4U0ZA 2OV8A 3PH0C 3F6QA 2XS8A 5B1AE 2Y1LE 3K9IA 2P9PG 3D9KA 4G1TA 4GYYA 1ELKA 3KAEA 3ZHEB 2XS1A 1SZAA 1WAO1 3KEAA 4CDNA 3X2QE 5BXOA 2I1KA 2LUHA 2J08A 3EHRA 3SBSA 1MX2A 4R7LA 3UKUG 5CCLA 4TV3A 3HXCA 3NAWA 3MV3B 3SQVA 3QWWA 1S64A 4WNEA 5LX8A 4XKCA 5LOZA 3UIPC 2ONDA 3CK8A 3OXGA 2FO1E 4KVMA 3D9IA 3S7JA 5HI7A 1AP7A 1OWOA 2LAHA 1HE8A 3ZW3A 4C0EA 2XRZA 3HVEB 3APDA 4M3OA 2VQ2A 1JWGA 3P1UA 4IULA 1S63A 4AOFA 4UI9J 4U63A 1MX4A 3VLDA 4XE0A 3PZ3A 1N0QA 4I17A 1D8EA 1N4RA 1MX6A 4BSXA 4GPMA 2LSUA 3FUMA 4L23A 3RO3A 1MQSA 2CHXA 4ILHB 3SNXA 3IEGA 4CGVA 1HXIA 2HE0A 4FJZA 2H6GA 2H6FA 3SI5A 4JHJA 5CMYA 2X6KA 3FH5A 5DBKA 3HIZA 3FH7A 3VLFA 3PZ2A 3Q78A 2OVBA 3D3MA 2VSNA 1OWPA 1PC2A 3PS6A 4DI3A 3ZKJA 1QNFA 2OEVA 3TGOA 3Q75A 4JD2G 1BI8B 4DJAA 4BX8A 2R2LA 3ENEA 4YVOA 1N0RA 3CKCA 1PY1A 3AS4A 4D10C 1N52A 1ELRA 1FPPA 3Q47B 3QB2A 4RSYA 4OVUA 4BWRA 5AQBA 2KCLA 2X38A 2UWJG 3ZXSA 2MOWA 3G2TA 2WXKA 5BPPA 3JUEA 5G55A 4WWOA 3G2UA 3L54A 1FT2A 2I6HA 1SZ9A 5KCMA 3I4RB 4I2WA 4Z68A 3D9JA 3D9PA 3ABME 1ZU2A 1SVXA 1N95A 1S0PA 2FF4A 3HDXA 1W3BA 3Q15A 1LTXA 3TXNA 3T5VA 4AJWA 2WVIA 1HFAA 5KBAA 3NQPA 1Z3XA 1O1TA 5BT1A 4K0RA 3UI2A 4BX9A 3DSVA 4DX2A 1BLXB 4AY6A 4LNUD 4HRMB 5ITZF 5CBOA 5FJYA 3BU8A 2WXLA 4GCNA 3WXXA 2V4LA 4JHKA 2A5UA 4UQYA 3CHRA 3SD5A 4G24A 5A23A 1QYMA 1YA0A 1MHQA 1TN7A 3HXEA 3HVEA 4GYWA 4MS6A 2IOSA 4UI9K 3MX3A 2QZAA 3CVPA 3ULQA 2P9NG 4CCAA 2B0OE 2E0IA 3NOGD 4EECA 1E7VA 3UT4A 2PZIA 2RG8A 3CHSA 5AIJA 3TG4A 2WXQA 3ULEG 1OWLA 3VTXA 4CT4A 3SBTB 3IV0A 1YCSB 4FC8A 2I1JA 5CMWA 5EIBE 4JHRA 3ZXPA 2ETBA 4KVOA 3KD7A 4Y6CA 3SGHA 5A6CA 4AVXA 5CEDB 3PE3A 1FVHA 3TWSA 3MEKA 4JA9A 2XCCA 4U07A 3L22A 4FULA 3RK6A 2AXZA 3AG2E 3RIBA 1WG0A 4ACKA 4A1GA 2VTBA 4JPSA 4WNFA 5EX0A 4H7YA 2CHWA 2XZTG 2HR2A 3FP3A 3U66A 2DYSE 3JXIA 2AVPA 1K1BA 4I2ZA 3MKQB 3APCA 1H2UA 3OAWA 2Y4TA 3MGBA 4P29A 4TUMA 1E8XA 5CERB 4HQDA 3FH8A 1E8YA 4L2YA 3C3QA 3V2XA 4GTSA 5KJNA 4BTAA 3NF1A 5ENNA 2AJAA 3ZU7B 2C2LA 3FTYA 1TYQG 3UM0A 3SO8A 1Y8MA 3L16A 4UWGA 2X6FA 2XPZA 4I6EA 3LY8A 2R05A 3WG7E 3ZUVB 5AAOA 4N5QA 2I9CA 3NOCD 4FA6A 4JW1A 4TXQA 1HG2A 5M72A 4UQZA 3ZHEA 4U04A 3CK7A 3V30A 4YNDA 4RVBA 4KZ0A 2XEHA 5E75A 3OXLA 1N11A 5G04J 4LEUA 1V54E 1UN9A 3FUEA 1SQMA 1JCRA 2FULA 2LSVA 5E76A 3LKUA 1N4QA 4BERA 4PDXA 3RO2A 4HOQA 4BESA 3TWWA 3UMVA 3T9KA 4Q69A 5FQ4A 3J5PA 4N3BA 2KC7A 1WY6A 2VGYA 4GPKA 3C5RA 5LP0A 1EPUA 3ASGA 2R02A 3OXFA 4J0UA 2NYJA 4L7TA 2J07A 1K3ZD 3D9LA 4PH4B 4N3AA 2R03A 4G23A 3QOUA 3QKYA 3E4BA 3APFA 1X81A 2UY1A 2ZGGA 3MJWA 4LSZE 5CHEE 5DIZA 3ZYQA 5CCMA 3PNTB 2XHEA 1DC2A 3PUJA 1LF8A 3L17A 4YDWA 2LXMA 4U8YD 2I2OA 2YQ8A 4I9CA 1OCRE 4EZKA 4U0UA 5G04C 5EYLA 2F37A 3UXGA 1TJCA 4HI8A 4MLPA 2CFUA 3PDNA 3W9GA 4BY6A 3L08A 4EBAA 3NZUA 2IFUA 1UG3A 3MCXA 4TRQA 4AV7A 3PZ4A 2KM4A 4BTBA 4CDMA 1MYOA 4G8KA 3AG3E 4G2VA 4XKBA 5ENPD 4E85A 3GZSA 4DK5A 4GZ3A 4YVQC 1DCEA 4ANWA 2IEJA 4GA1A 2OEWA 2KZTA 5EYPF 4I1MA 4OAUC 2LXLA 4NACA 3EHQA 3JQ1A 2J09A 5B1BE 4EQFA 3BG0B 4WUYA 3CVWA 2ILRA 2WQ6A 4NURA 2L6JA 1NP7A 4JL0A 2XEEA 3IKOB 3UT7A 3QWPA 2JABA 3IXEA 4AEZC 3NZSA 3AU4A 2PQNA 4O1PA 3SY2A 3DWLG 3FU5A 1U3DA 4GTOA 4JVSA 4A55A 4TXRA 2QC9A 2CG3A 4LG6A 4L1BA 3KS2A 4FHKA 4WWNA 4UWLA 2XQ0A 3L82A 2PM6A 5G2NA 1G3NB 1OCOE 3DSSA 1AWCB 2R59A 1JCSA 3SF4A 3DRAA 2WXHA 3UX4A 3ML8A 3UQ3A 2RD0A 3L13A 2L0IA 1O5MA 2VTBB 1EF1C 5AQ7A 4F53A 2YINA 2DZOA 1TEZA 2MYOA 4CDRA 5HKPA 5FWQA 3RJVA 3FEYA 4LNGA 4RG9A 2OVFA 1KT1A 2WM9A 3ZEFA 2QYJA 3CV0A 2AXVA 5KNGA 2Y0BG 3EU9A 5BNWA 4HB5A 4XI0A 4F1PA 5JA4D 5ANRA 4I1OB 2VSYA 4HS2A 1HX8A 3RAUA 3LJ3A 1TN6A 1Z6TA 3GZ2A 5KNHD 1OCZE 3I3NA 1JCQA 4JXTA 3ZIMA 3CK9A 4B8CB 1OT8A 2X3MA 5A7DB 3U3WA 3FTSA 3CR3A 3EHMA 2Y3AA 5BV1A 4C48B 3NB2A 3D9HA 1HU3A 5LFAA 1TN8A 1BD8A 3CVNA 5C1DA 3FUNA 4B0ZA 3LVQE 5FQ8A 4GCOA 4HOSA 4GZCA 4J8FA 3I4GA 1LD7A 2J9QA 4GTVA 2CHZA 1H2TC 4B94A 4J8DA 4QFVA 3FTZA 2KCKA 3LXUX 4KYOB 4JEUA 1E96B 3GW4A 3QJZA 3FUIA 5EDSA 3AAAC 5EX3A 3UIOC 2GROB 4DLOA 4CGWA 3FTWA 1P5QA 4N3CA 4L9PA 3FUKA 5KWDA 3QNKA 2WXIA 4GMLA 3QK0A 3ESLA 4U96D 3QARA 2MHKA 4PS8A 4PS3A 1E8WA 2GRPB 3PVLA 3CKBA 4KMOA 5G05C 1H6PA 2L9BA 3ASDA 2IJGX 4DRXE 4ANUA 2FBNA 3SFXA 4HRLA 5AJLA 2HO1A 4URKA 4RLYA 3FU0A 2WXOA 3UT8A 3FEXA 3AJIA 1RW2A 3FHEA 3CHQA 4I43A 3FUFA 1IQUA 4FLBA 2WXFA 4APFA 4GB9A 4A1SA 1N94A 1FT1A 2M63A 4GYOA 5JHAA 5CEAA 2GW1A 5IY5E 1Z3YA 4HOTA 1OWNA 2C0LA 2QY7A 3DEPA 3CVUA 3CHOA 5JMND 2CG2A 5FIOA 1SW6A 3ABLE 3UKRG 4BFRA 2DBAA 2L6BA 2P9UG 3UPVA 3DSTA 4NRHB 2FI7A 3J5QB 2EILE 2Y4UA 1E7UA 3AG1E 3D9MA 4GTRA 3CGHA 5BUZA 1OUVA 4YDOA 4QQIA 3JYSA 3GYZA 1UN8A 2GRLA 1TNYA 3CHPA 2IONA 3OTNA 4WNDA 4A3VA 2KBXA 4CRWA 5FQ6A 1NZNA 5T4YA 3SFYA 2B6CA 4JEHA 2GRMA 4N2QA 1U2VG 3CSTA 1YMPA 3EJNA 1INZA 3L9TA 3TWQA 1NA0A 4L2LA 4BSZB 4UWFA 3LEWA 3CVVA 1B89A 2R17C 4IN3B 1OXJA 1Y6IA 4EBAG 5LCWJ 3W9FA 5J08A 2P2CP 3DPYA 3TWRA 1UJKA 3TXMA 5H7PA 3D9OA 3TWVA 3G2WA 2V4HC 2VYIA 4HI9A 1HZ4A 4KBQA 5D2MC 3UUXA 2VGXB 4U95D 3LYAA 4GZ6A 4J6IA 1KZPA 5AENA 4I9EA 4EPZA 3ASNE 1ZB1A 3ZRHA 2MRIA 4UWKA 4DPRA 5C2YA 5ENOD 2F8XK 2CFZA 1DNPA 4RQIA 2ZXWE 5CBNA 5JJ6A 5FTPA 1TNOA 5EN5D 4LRZA 2PM7A 2KCVA 2IO2C 3PRZA 2WB2A 5AYWD 2P9LG 4E6HA 4LNBA 3PZDA 1DCQA 4HLEA 4MBGA 4XIFA 1NI1A 3Q5MA 3NBNB 3C3OA 1TNZA 3B7RL 1KT0A 3DEOA 2DVWA 3ZPJA 2V5QC 1UW4B 3T8KA 3Q9UC 3CSFA 3FU3A 2Y69E 4ZHBA 2BTDA 4XZ4A 2ZU6B 2WXNA 3VLEA 1TNUA 4EZJA 2OCCE 5KJMA 2A4ZA 2XPIA 3HXDA 1HF8A 3EIJA 4HNAD 4WAFA 3BQOA 5ENRD 4U7EB 4XI9A 3UM1A 2A5EA 4ATGA 1PAQA 2E2EA 2ETAA 5AARA 3DSUA 2EIKE 3CVLA 3EUVA 3V79K 1YYHA 2DIWA 3HG0D 4HVBA 1Z5SC 3PREA 4J7WA 4GA0A 3C3RA 2NSZA 4N2SA 1TR4A 2V0PA 1WDYA 4O60A 3ULYA 5JHBA 3LJNA 2LO6A 2BKKB 4HFGA 4WWPA 4B93B 3Q4AB 5D66A 5B3SE 1A5EA 3UINC 4AXHA 4OVVA 3LY9A 2IOLA 3R7QA 1N54A 4X8QA 1K1AA 4U8VD 2EIME 3TJPA 3S7FA 1EDUA 1IHGA 4EZLA 4F1SA 4F7AA 3FU6A 3SZ7A 4ANVA 3SHFA 2WXRA 3JUIA 4FJYA 2PL2A 1OWMA 1HO8A 1SA4A 4BETA 2KZTB 3BEEA 3IBEA 4I1AA 4GTTA 5FINA 1JPLA 1U3CA 2GRNB 1VDYA 4H7XA 4CEMA 4O6FA 3HXBA 4N5CA 2FO7A 2IY0C 3ML9A 3FDHA 3Q7FA 4APOA 2VGXA 4BT8A 5FZQA 1NFIE 1MJ0A 3JXJA 4AM9A 4YDEA 3CQCB 4DX1A 3E32A 4OYSA 3PNLB 5ARFA 2WPVA 1H6KA 2YNQA 4I6JA 2Q7FA 4YDYA 2QYUA 4HRNA 4HXIA 3B7SA 3ZYMA 3MV2B 3PUKA 3PE4A 4ACLA 4GTPA 4IYPA 4IRUA 3HRAA 4UI9C 4LUNU 4FADA 3CLJA 5EILA 2WXJA 1K8KG 1V55E 4FHJA 3AG4E 3FTUA 3JCKC 2YHEA 4A63B 4DI4A 2PQRA 4ILIA 3TAXA 1IQRA 3ESKA 1WM5A 3R9AB 2XENA 4LCTA 3FWVA 1BPOA 4Q94A 3ZYLA 3DXKG 3GZ1A 2IF4A 3G2VA 3O4ZA 1DVPA 3RRMB 3LVRE 3RRUA 4KZCA 2JEKA 1E8ZA 3EIQC 4CYMD 3LPZA 3E34A 5EKQD 4K03A 2F0YA 4EHMA 3EHNA 2YHCA 3ZFWA 1SA5A 5FZSA 3R9MA 2JLBA 3CQGB 4UWHA 3UM3A 4GMRA 5HRYA 1O1RA 4XEIG 4ILGA 3Q73A 2P9KG 4ABNA 2EQXA 1EYHA 1OY3D 2BEDA 3LS8A 4K5CA 3DXMG 3ASFA 4WNGA 1GW6A 2J49A 5BW8C 3KSQA 2ZISA 4GA2A 4U8HA 3URZA 4G8LA 1N9AA 2AWIA 3DSWA 4PS7A 5HS0A 2WQHA 5AQAA 3FFLA 2IO3C 3ZN3A 4DX7D 4B8AA 1KLXA 3CVQA 2XGSA 3Q9NC 3B95A 3HHMA 3TWTA 2XCBA 4RG6A 1N4PA 3T8MA 3B7UX 4CT0A 4MKTA 4ME2A 3R7RA 2ETCA 3S7DA 3KEZA 1MZCA 2V8SE 3MZLB 3LY7A 2DCPA 1XGWA 4AP2A 4GAAA 3I5PA 5G05J 5AQ9A 5FT9A 4GZ5A 4JZYA 3CEQA 3RKVA 3PEUB 2AXUA 2WQ7A 3QC1A 2VJ8A 4HORA 3B7TA 2GRQB 2WMNA 1IXVA 3BG1B 3TL5A 1UOHA 2VGEA 4B89A 1FCHA 5EIDA 3O48A 3CHMA 4V3IA 4C0MA 3TWUA 1JUQA 1HG5A 1BU9A 3G2SA 4OAVB 5AJDA 5ARGA 4MRUA 4O1OA 3FTXA 3ONKA 5HQ8A 3TWXA 4FP7A 2WXPA 2VSXE 3RU0A 3VTYA 2GRRB 2EIJE 2IU1A 4GTMA 3ISMC 4A3TA 5FZRA 3QAQA 4Y6WA 2OOEA 3QDNA 2FEZA 4JC8A 3AU5A 4KXKB 4J8EA 4GU5A 3UM2A 3B7BA 3CIAA
chains in the Genus database with same CATH topology
3T5XA 3SFZA 4XIFA 2WMOA 4GMJA 3Q5MA 3Q47B 3MYVA 2BUGA 3FY4A 3JQ0A 4NACA 3B7RL 3QB2A 1KT0A 4RSYA 4OVUA 4BWRA 1L5JA 3JQ1A 2KATA 2KCLA 2UWJG 2X38A 3ZGQA 2MOWA 3ZPJA 3ZXSA 1UW4B 2J09A 5T8IA 3S2AA 3G2TA 4EQFA 2WXKA 4U0SA 5BPPA 3BG0B 3C98A 5G55A 4WWOA 3G2UA 3L54A 4WUYA 3CSFA 1QQEA 2I6HA 1SZ9A 3CVWA 2ILRA 3TG5A 2WQ6A 3IHVA 3FU3A 5KCMA 4NURA 2L6JA 3I4RB 1NP7A 4I2WA 1HH8A 2BTDA 3D9JA 3D9PA 4JL0A 4XZ4A 2ZU6B 3IKOB 2WXNA 3UT7A 3CVYA 5KJKA 3QWPA 3VLEA 1ZU2A 4W9RA 4AEZC 3NZSA 3AU4A 2PQNA 5LCWC 5J90A 4EZJA 3FUHA 1S0PA 2FF4A 3HDXA 5KJMA 2A4ZA 3N71A 1W3BA 3FU5A 1TJFA 2P58C 2XPIA 3Q15A 1HF8A 3EIJA 4WAFA 3TXNA 3T5VA 3AS5A 1U3DA 4AJWA 4C9BB 2WVIA 2XPYA 4XI9A 3L6AA 1HFAA 3NQPA 4JVSA 4A55A 1X5BA 1Z3XA 4ATGA 1PAQA 4FU3A 2E2EA 5BT1A 4K0RA 3CVLA 2CG3A 2VSOE 2DIWA 4HVBA 4BX9A 3PREA 2WXMA 4L1BA 3KS2A 2LNIA 4FHKA 4WWNA 3U64A 4GA0A 3ONLA 2NSZA 4UWLA 4AY6A 3PEVB 2XQ0A 3FUJA 5T3RA 4N2SA 2V0PA 2PM6A 5FJYA 5G2NA 2WXLA 5BV0A 4GCNA 5JHBA 2C0MA 3WXXA 2LO6A 2V4LA 1H2VC 4JHKA 2A5UA 2XEVA 4UQYA 2R59A 4HFGA 3CHRA 4WWPA 3SF4A 3SD5A 3Q4AB 2L0TB 4G24A 5A23A 2WXHA 1E90A 3UX4A 2X6IA 3ML8A 3UQ3A 2RD0A 1YA0A 1MHQA 3L13A 2L0IA 2UY1B 3LDZA 2QFCA 3HVEA 3ASHA 4GYWA 2VTBB 4AXHA 4OVVA 4MS6A 3LY9A 2IOSA 4UI9K 2IOLA 1EF1C 3R7QA 1N54A 4F53A 2YINA 3MX3A 4BT9A 3TJPA 3S7FA 1TEZA 3FUDA 1EDUA 1IHGA 4CDRA 4EZLA 3S7BA 2WXGA 4F1SA 4XX5A 5FWQA 3CVPA 3RJVA 3FEYA 4F7AA 3FU6A 2OVFA 4RG9A 3ULQA 1KT1A 3SZ7A 4CCAA 2J4BA 4ANVA 4FLHA 3SHFA 2WXRA 3JUIA 2E0IA 4FJYA 4EECA 1E7VA 2WM9A 3RRNB 2PL2A 3UT4A 2PZIA 3ZEFA 1OWMA 4NQ0A 1HO8A 2RG8A 2J4DA 3CV0A 2AXVA 2NC9A 3CHSA 2GGFA 2KZTB 5D0QD 4UQXA 3BEEA 3TG4A 2WXQA 4XI0A 5AIJA 5BNWA 1OWLA 5ANRA 3IBEA 4DLQA 4I1OB 4I1AA 2VSYA 4HS2A 1HX8A 3VTXA 3LJ3A 3GZ2A 1Z6TA 4CT4A 1U3CA 1JPLA 3SBTB 4F3VA 3I3NA 4HLEA 4JXTA 1VDYA 4H7XA 3ZIMA 4CEMA 4TUUA 3DBSA 3CK9A 4B8CB 3IV0A 4O6FA 2X3MA 4FC8A 2I1JA 4N5CA 5A7DB 1ZBPA 3U3WA 3FTSA 3EHMA 2FO7A 3CR3A 3FDHA 3ML9A 2Y3AA 4N39A 5BV1A 5CMWA 3HYMB 2AW6A 3P2BA 2BF0X 2V5FA 4JHRA 3EDTB 1HU3A 4KVOA 4APOA 5LFAA 1A17A 2VGXA 3CVNA 4J8SA 4I6GA 5FQ7A 3KD7A 4Y6CA 3SGHA 4BT8A 5C1DA 5FZQA 5A6CA 4LERA 4AVXA 3PE3A 3FUNA 1FVHA 3LVQE 3MEKA 4AM9A 5FQ8A 4B0ZA 4GCOA 4HOSA 4GZCA 3AS8A 4JA9A 3Q49B 2XCCA 2NXPA 3CQCB 4U07A 2IQCA 4KT6B 3L22A 4FULA 4OYSA 3PNLB 3RK6A 1XNFA 2AXZA 4G25A 4J8FA 5ARFA 3RIBA 3I4GA 3CVXA 1H0AA 2J9QA 2WPVA 4ACKA 1H6KA 4A1GA 2VTBA 2HM8A 2YNQA 1QZ2A 4I6JA 4JPSA 4WNFA 2LAIA 5EX0A 2CHZA 2Q7FA 1H2TC 4B94A 4H7YA 2CHWA 3DPDA 2HR2A 3FP3A 4HXIA 3B7SA 4J8DA 3FTZA 4QFVA 3ZYMA 3FTVA 3MV2B 3PUKA 5D0OD 3U66A 2KCKA 3MKQA 3PE4A 4ACLA 3LXUX 4IYPA 2AVPA 4IRUA 4KYOB 4JEUA 4UI9C 4I2ZA 1E96B 4G26A 4LUNU 3MKQB 4AY5A 1NA3A 4FADA 1H19A 3APCA 3CLJA 1H2UA 3GW4A 3OAWA 2WXJA 2XGMA 3QJZA 2Y4TA 3FUIA 5EDSA 4FHJA 3MGBA 5EX3A 3FTUA 3JCKC 4P29A 2YHEA 4HOUA 4DI4A 2PQRA 4DLOA 4CGWA 3FTWA 1E8XA 4ILIA 1JWFA 3TAXA 1IQRA 1P5QA 2X6JA 3ESKA 4N3CA 3FH8A 1WM5A 3FUKA 5ANLA 3QNKA 3R9AB 2WXIA 4GMLA 1IYGA 1E8YA 3QK0A 4L2YA 4LCTA 5JJTA 5KJNA 2XGOA 3FWVA 4BTAA 3ESLA 3NF1A 1BPOA 2XRYA 3U4TA 4GZDA 5ENNA 3QARA 4Q94A 2MHKA 5JJ7A 1UJJA 4PS8A 4PS3A 3ZYLA 2HYZA 3IHYA 1E8WA 2C2LA 3GZ1A 3ZYKA 3FTYA 2IF4A 1Y8MA 2X6HA 3CKBA 3G2VA 3MA5A 3O4ZA 3L16A 3MKRA 1DVPA 2X6FA 4G11A 4KMOA 4UWGA 5G05C 3LVRE 4JA7A 3RRMB 2XPZA 2L9BA 3RRUA 1FVFA 3ASDA 4KZCA 2JEKA 2IJGX 1E8ZA 4I6EA 3EIQC 1ELWA 4ANUA 2FBNA 3LPZA 3LY8A 5EKQD 4K03A 4ANXA 3EHNA 2YHCA 3ZFWA 4AIFA 2R5SA 5AJLA 3QWVA 3FULA 2HO1A 4PUCA 5FZSA 3U9WA 4URKA 3FU0A 2JLBA 3CQGB 2WXOA 4UWHA 3UT8A 2I9CA 3B13A 3FEXA 3FHEA 4FA6A 4JW1A 1HS6A 3CHQA 1HG2A 4I43A 3D9NA 3FUFA 5M72A 1IQUA 4UQZA 4U04A 3ZHEA 5KJLA 3CK7A 4FLBA 3LCAA 4ILGA 2WXFA 4Q96A 4APFA 4YNDA 4RVBA 3ZVVA 4GB9A 4KZ0A 4A1SA 4U0ZA 5E75A 3OXLA 2OV8A 4ABNA 2EQXA 3PH0C 1EYHA 2M63A 4GYOA 5JHAA 5G04J 3K9IA 4LEUA 3LS8A 1UN9A 2GW1A 4HOTA 1Z3YA 1OWNA 3FUEA 3ASFA 2C0LA 4WNGA 1SQMA 2QY7A 1GW6A 2FULA 2J49A 2LSVA 3CHOA 5E76A 5BW8C 2CG2A 3LKUA 3CVUA 3D9KA 4G1TA 4GYYA 4PDXA 3RO2A 4BFRA 2DBAA 3UPVA 1ELKA 2FI7A 4NRHB 3KAEA 3ZHEB 4HOQA 4GA2A 4U8HA 3URZA 2Y4UA 2AWIA 4PS7A 3UMVA 1SZAA 1E7UA 1WAO1 4CDNA 4Q69A 5FQ4A 3D9MA 3CGHA 5BUZA 1OUVA 4N3BA 2I1KA 2J08A 2KC7A 2WQHA 3SBSA 3JYSA 1WY6A 3GYZA 3FFLA 1UN8A 2GRLA 4R7LA 2VGYA 5CCLA 4TV3A 3ZN3A 4GPKA 3CHPA 3MV3B 4B8AA 1KLXA 5LP0A 3CVQA 1EPUA 2XGSA 2IONA 3OTNA 3QWWA 4WNDA 3ASGA 4WNEA 3HHMA 5LX8A 4A3VA 2XCBA 3OXFA 4J0UA 4RG6A 4CRWA 5FQ6A 4XKCA 1NZNA 5T4YA 3B7UX 3T8MA 4CT0A 4L7TA 4MKTA 4ME2A 5LOZA 3R7RA 2ONDA 2J07A 3D9LA 4PH4B 4JEHA 4N3AA 3S7DA 3KEZA 2GRMA 3CK8A 4G23A 2V8SE 4N2QA 3OXGA 3MZLB 4KVMA 3QOUA 3CSTA 3LY7A 2DCPA 1XGWA 3EJNA 3QKYA 3D9IA 3S7JA 4AP2A 1INZA 4GAAA 3E4BA 5HI7A 3APFA 3I5PA 5G05J 5FT9A 1OWOA 1NA0A 1HE8A 2LAHA 4GZ5A 4L2LA 4UWFA 3ZW3A 4C0EA 2XRZA 3HVEB 3APDA 2UY1A 4JZYA 3LEWA 3CVVA 4M3OA 3CEQA 1B89A 3RKVA 2VQ2A 1JWGA 3PEUB 2AXUA 2R17C 4IN3B 2WQ7A 3QC1A 3P1UA 1Y6IA 2VJ8A 4EBAG 5LCWJ 3MJWA 5J08A 5CHEE 4HORA 5DIZA 4IULA 4AOFA 3ZYQA 4UI9J 5CCMA 3PNTB 4U63A 2XHEA 3PUJA 3VLDA 3B7TA 4XE0A 4I17A 1UJKA 2WMNA 1LF8A 3L17A 3BG1B 3TL5A 4BSXA 3TXMA 4B89A 1FCHA 2LSUA 2I2OA 2YQ8A 3D9OA 3O48A 3FUMA 4L23A 4I9CA 3RO3A 1MQSA 4U0UA 3CHMA 4V3IA 5G04C 4EZKA 2CHXA 3G2WA 4ILHB 3SNXA 4C0MA 2VYIA 3IEGA 1JUQA 4CGVA 1HXIA 1HZ4A 4KBQA 1TJCA 4FJZA 3UUXA 2VGXB 1HG5A 4MLPA 3G2SA 3LYAA 4GZ6A 2CFUA 3PDNA 4J6IA 5AJDA 5ARGA 4BY6A 4MRUA 3PVLA 3L08A 4JHJA 3SI5A 5AENA 4I9EA 4EBAA 3FTXA 5CMYA 4EPZA 3ONKA 2X6KA 3NZUA 5HQ8A 3FH5A 5DBKA 3HIZA 2IFUA 3ZRHA 4FP7A 2WXPA 2MRIA 2VSXE 1UG3A 4UWKA 3MCXA 4DPRA 3FH7A 3VLFA 3RU0A 4TRQA 3VTYA 2OVBA 4AV7A 5C2YA 3D3MA 2VSNA 1OWPA 1PC2A 2IU1A 2KM4A 3PS6A 4DI3A 4BTBA 1QNFA 2CFZA 3TGOA 1DNPA 4CDMA 4A3TA 5JJ6A 4G2VA 5FTPA 4XKBA 4BX8A 4DJAA 5FZRA 3QAQA 4Y6WA 3ENEA 3GZSA 4E85A 4LRZA 4YVOA 4DK5A 2OOEA 3QDNA 2PM7A 3CKCA 4GZ3A 4YVQC 4ANWA 2FEZA 4JC8A 2KCVA 1PY1A 3AU5A 4GA1A 4KXKB 3AS4A 2KZTA 3PRZA 4GU5A 4J8EA 4D10C 1N52A 2WB2A 5AYWD 1ELRA 4E6HA 3PZDA 4I1MA 3CIAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XIF A;  3ASG A;  4WNE A;  3R9A B;  1IYG A;  4BT9 A;  3Q5M A;  3Q47 B;  2BUG A;  3S7F A;  2XCB A;  3OXF A;  4J0U A;  4RG6 A;  5JJT A;  1KT0 A;  1IHG A;  4CDR A;  1NZN A;  2XGO A;  3FWV A;  3S7B A;  4BWR A;  5KJN A;  4BTA A;  3NF1 A;  4ME2 A;  3CVP A;  3U4T A;  3RJV A;  2OND A;  5JJ7 A;  2KAT A;  2KCL A;  2MHK A;  2UWJ G;  4RG9 A;  3ULQ A;  3ZGQ A;  4N3A A;  3ZPJ A;  1KT1 A;  3S7D A;  3SZ7 A;  3CK8 A;  2HYZ A;  4G23 A;  2C2L A;  3GZ1 A;  4EQF A;  3OXG A;  4N2Q A;  3QOU A;  3LY7 A;  4U0S A;  2IF4 A;  2PL2 A;  1Y8M A;  2PZI A;  3CKB A;  3MA5 A;  3QKY A;  5G05 C;  3MKR A;  3S7J A;  3E4B A;  4WUY A;  4JA7 A;  4NQ0 A;  5HI7 A;  1QQE A;  2I6H A;  5G05 J;  3ASD A;  3CV0 A;  3TG5 A;  2NC9 A;  5FT9 A;  1NA0 A;  5D0Q D;  4GZ5 A;  2L6J A;  4UQX A;  3BEE A;  3TG4 A;  5BNW A;  4XI0 A;  1ELW A;  2FBN A;  3LPZ A;  4I2W A;  2UY1 A;  2VSY A;  1HH8 A;  3LY8 A;  4I1A A;  5EKQ D;  4JL0 A;  3VTX A;  3GZ2 A;  3CEQ A;  1B89 A;  3RKV A;  2VQ2 A;  2YHC A;  3ZFW A;  4AIF A;  2R5S A;  4IN3 B;  4F3V A;  3QWV A;  3QWP A;  2HO1 A;  4H7X A;  5FZS A;  1ZU2 A;  4W9R A;  5LCW J;  2JLB A;  3CK9 A;  4O6F A;  5CHE E;  4HOR A;  2PQN A;  5LCW C;  5DIZ A;  2FF4 A;  5KJM A;  4UI9 J;  5CCM A;  4N5C A;  5A7D B;  1ZBP A;  3N71 A;  3U3W A;  1W3B A;  2FO7 A;  2P58 C;  2XPI A;  3Q15 A;  4N39 A;  5M72 A;  4UQZ A;  3ZHE A;  4U04 A;  3HYM B;  4I17 A;  3CK7 A;  5KJL A;  3LCA A;  3AS5 A;  2V5F A;  4JHR A;  4XI9 A;  3EDT B;  4YND A;  1FCH A;  2LSU A;  4APO A;  1A17 A;  2VGX A;  2YQ8 A;  3CVN A;  3O48 A;  4BT8 A;  3KD7 A;  4Y6C A;  4I9C A;  4U0Z A;  3RO3 A;  4A1S A;  5FZQ A;  5C1D A;  4U0U A;  3OXL A;  5G04 C;  5A6C A;  3PE3 A;  4ABN A;  2E2E A;  2VYI A;  4GYO A;  3IEG A;  3MEK A;  4AM9 A;  5BT1 A;  4CGV A;  5G04 J;  1HXI A;  1HZ4 A;  3CVL A;  4GCO A;  4HOS A;  4KBQ A;  3K9I A;  1TJC A;  3AS8 A;  3Q49 B;  2XCC A;  4JA9 A;  4LEU A;  2GW1 A;  4U07 A;  4HOT A;  3UUX A;  2VGX B;  3ASF A;  2C0L A;  4WNG A;  1XNF A;  3KS2 A;  2LNI A;  4G25 A;  3LYA A;  4GZ6 A;  4J8F A;  2LSV A;  3PDN A;  5ARF A;  5BW8 C;  2J9Q A;  3LKU A;  5ARG A;  3RIB A;  2WPV A;  4GA0 A;  4G1T A;  4GYY A;  4AY6 A;  4I9E A;  1QZ2 A;  4WNF A;  3RO2 A;  5HQ8 A;  4N2S A;  5EX0 A;  2DBA A;  2Q7F A;  5DBK A;  3UPV A;  4NRH B;  2IFU A;  2FI7 A;  3KAE A;  3ZHE B;  5FJY A;  4B94 A;  4H7Y A;  4HOQ A;  3FP3 A;  4GA2 A;  2HR2 A;  4J8D A;  5KJK A;  3URZ A;  3MV2 B;  4GCN A;  5D0O D;  3RU0 A;  2C0M A;  2Y4U A;  3WXX A;  3VTY A;  2KCK A;  3PE4 A;  2AVP A;  1WAO 1;  4KYO B;  2VSN A;  1PC2 A;  2XEV A;  4UQY A;  4UI9 C;  4I2Z A;  1E96 B;  4BTB A;  3SF4 A;  4G26 A;  3TGO A;  1OUV A;  4AY5 A;  4N3B A;  1NA3 A;  5JJ6 A;  3Q4A B;  2KC7 A;  4G2V A;  4G24 A;  5FTP A;  3GW4 A;  2WQH A;  2XGM A;  5FZR A;  4Y6W A;  2Y4T A;  3JYS A;  3GYZ A;  3FFL A;  4YVO A;  2OOE A;  3QDN A;  3CKC A;  4GZ3 A;  4YVQ C;  1YA0 A;  5EX3 A;  3UQ3 A;  2FEZ A;  2UY1 B;  4HOU A;  2KCV A;  2VGY A;  5CCL A;  2QFC A;  3ZN3 A;  3ASH A;  4GA1 A;  2PQR A;  4GYW A;  4KXK B;  4CGW A;  4GPK A;  3AS4 A;  3LY9 A;  4J8E A;  3MV3 B;  1KLX A;  3TAX A;  4UI9 K;  1P5Q A;  3CVQ A;  1ELR A;  3ESK A;  4N3C A;  2XGS A;  5AYW D;  1WM5 A;  3QWW A;  4WND A; 
#chains in the Genus database with same CATH topology
 3T5X A;  3SFZ A;  2WMO A;  4GMJ A;  3MYV A;  2BUG A;  3FY4 A;  3JQ0 A;  1L5J A;  3DSX A;  2KAT A;  3ZGQ A;  3ASO E;  5T8I A;  3E37 A;  4DUI A;  3S2A A;  4ZFH A;  4U0S A;  1LD8 A;  3C98 A;  1QQE A;  2DWZ A;  3TG5 A;  3IHV A;  1HH8 A;  3V31 A;  4UUC A;  1D8D A;  3ZNG A;  3E33 A;  3CVY A;  3V2O A;  1IKN D;  4W9R A;  4GTQ A;  2DYR E;  4DX5 D;  5LCW C;  4M7C A;  5J90 A;  3FUH A;  2PNN A;  3N71 A;  5AN8 A;  1TJF A;  2P58 C;  1KZO A;  3AS5 A;  4C9B B;  2XPY A;  3L6A A;  1X5B A;  4FU3 A;  3Q79 A;  2VSO E;  3KSL A;  2WXM A;  2LNI A;  3U64 A;  3ONL A;  3PEV B;  3FUJ A;  5T3R A;  3E30 A;  5BV0 A;  2RFA A;  2C0M A;  1H2V C;  2XEV A;  5ENT D;  4J8Y A;  2KXP C;  1N4S A;  2L0T B;  1E90 A;  2X6I A;  2ZGD A;  2UY1 B;  3LDZ A;  2QFC A;  3PZ1 A;  3ASH A;  1D9S A;  5BXU A;  3EU5 A;  4BT9 A;  1RZ4 A;  3FUD A;  4NIK A;  3S7B A;  2WXG A;  4XX5 A;  3BUA A;  1TNB A;  4TXP A;  2P9I G;  2J4B A;  2XZD G;  4FLH A;  3RRN B;  4NQ0 A;  4ATZ D;  2J4D A;  1OCC E;  2NC9 A;  5D0Q D;  2GGF A;  4F6R D;  4UQX A;  4DLQ A;  1NL4 A;  2F8Y A;  3Q7A A;  4F3V A;  4TUU A;  3DBS A;  2H6I A;  1ZBP A;  2DZN A;  4N39 A;  3HYM B;  2AW6 A;  3P2B A;  1BI7 B;  3ABK E;  2BF0 X;  2V5F A;  3EDT B;  1A17 A;  5FQ7 A;  4J8S A;  4I6G A;  4LER A;  3AS8 A;  3Q49 B;  2NXP A;  2IQC A;  4KT6 B;  1XNF A;  4G25 A;  3C72 A;  1H0A A;  3CVX A;  5CRV A;  2BKG A;  2HM8 A;  4CZ2 D;  1QZ2 A;  2LAI A;  2ZIR A;  4HLL A;  1Q2Z A;  4K5A B;  5KJK A;  3DPD A;  4BEP A;  3FTV A;  2RKK A;  5D0O D;  5ENQ D;  3MKQ A;  2H6H A;  3HXF A;  3RSE G;  1H6O A;  4G26 A;  4AY5 A;  1QBQ A;  1NA3 A;  4DX6 D;  1H19 A;  2XGM A;  1KPS B;  4HOU A;  4JB8 P;  5CEC B;  1JWF A;  2X6J A;  1S70 B;  5ANL A;  1IYG A;  2RFM A;  5JJT A;  2XGO A;  2XRY A;  1O1S A;  3U4T A;  4GZD A;  5JJ7 A;  1UJJ A;  3UTM A;  2HYZ A;  3IHY A;  3ZYK A;  2X6H A;  3MA5 A;  4G11 A;  3MKR A;  4JA7 A;  4K5B A;  1FVF A;  5ENS D;  1ELW A;  1IHB A;  2J8S D;  4ANX A;  4HBD A;  4AIF A;  2R5S A;  3QWV A;  3FUL A;  4PUC A;  3U9W A;  3B13 A;  1HS6 A;  3D9N A;  5KJL A;  3LCA A;  5CRU A;  4Q96 A;  3ZVV A;  2EIN E;  2P9S G;  4U0Z A;  2OV8 A;  3PH0 C;  3F6Q A;  2XS8 A;  5B1A E;  2Y1L E;  3K9I A;  2P9P G;  3D9K A;  4G1T A;  4GYY A;  1ELK A;  3KAE A;  3ZHE B;  2XS1 A;  1SZA A;  1WAO 1;  3KEA A;  4CDN A;  3X2Q E;  5BXO A;  2I1K A;  2LUH A;  2J08 A;  3EHR A;  3SBS A;  1MX2 A;  4R7L A;  3UKU G;  5CCL A;  4TV3 A;  3HXC A;  3NAW A;  3MV3 B;  3SQV A;  3QWW A;  1S64 A;  4WNE A;  5LX8 A;  4XKC A;  5LOZ A;  3UIP C;  2OND A;  3CK8 A;  3OXG A;  2FO1 E;  4KVM A;  3D9I A;  3S7J A;  5HI7 A;  1AP7 A;  1OWO A;  2LAH A;  1HE8 A;  3ZW3 A;  4C0E A;  2XRZ A;  3HVE B;  3APD A;  4M3O A;  2VQ2 A;  1JWG A;  3P1U A;  4IUL A;  1S63 A;  4AOF A;  4UI9 J;  4U63 A;  1MX4 A;  3VLD A;  4XE0 A;  3PZ3 A;  1N0Q A;  4I17 A;  1D8E A;  1N4R A;  1MX6 A;  4BSX A;  4GPM A;  2LSU A;  3FUM A;  4L23 A;  3RO3 A;  1MQS A;  2CHX A;  4ILH B;  3SNX A;  3IEG A;  4CGV A;  1HXI A;  2HE0 A;  4FJZ A;  2H6G A;  2H6F A;  3SI5 A;  4JHJ A;  5CMY A;  2X6K A;  3FH5 A;  5DBK A;  3HIZ A;  3FH7 A;  3VLF A;  3PZ2 A;  3Q78 A;  2OVB A;  3D3M A;  2VSN A;  1OWP A;  1PC2 A;  3PS6 A;  4DI3 A;  3ZKJ A;  1QNF A;  2OEV A;  3TGO A;  3Q75 A;  4JD2 G;  1BI8 B;  4DJA A;  4BX8 A;  2R2L A;  3ENE A;  4YVO A;  1N0R A;  3CKC A;  1PY1 A;  3AS4 A;  4D10 C;  1N52 A;  1ELR A;  1FPP A;  3Q47 B;  3QB2 A;  4RSY A;  4OVU A;  4BWR A;  5AQB A;  2KCL A;  2X38 A;  2UWJ G;  3ZXS A;  2MOW A;  3G2T A;  2WXK A;  5BPP A;  3JUE A;  5G55 A;  4WWO A;  3G2U A;  3L54 A;  1FT2 A;  2I6H A;  1SZ9 A;  5KCM A;  3I4R B;  4I2W A;  4Z68 A;  3D9J A;  3D9P A;  3ABM E;  1ZU2 A;  1SVX A;  1N95 A;  1S0P A;  2FF4 A;  3HDX A;  1W3B A;  3Q15 A;  1LTX A;  3TXN A;  3T5V A;  4AJW A;  2WVI A;  1HFA A;  5KBA A;  3NQP A;  1Z3X A;  1O1T A;  5BT1 A;  4K0R A;  3UI2 A;  4BX9 A;  3DSV A;  4DX2 A;  1BLX B;  4AY6 A;  4LNU D;  4HRM B;  5ITZ F;  5CBO A;  5FJY A;  3BU8 A;  2WXL A;  4GCN A;  3WXX A;  2V4L A;  4JHK A;  2A5U A;  4UQY A;  3CHR A;  3SD5 A;  4G24 A;  5A23 A;  1QYM A;  1YA0 A;  1MHQ A;  1TN7 A;  3HXE A;  3HVE A;  4GYW A;  4MS6 A;  2IOS A;  4UI9 K;  3MX3 A;  2QZA A;  3CVP A;  3ULQ A;  2P9N G;  4CCA A;  2B0O E;  2E0I A;  3NOG D;  4EEC A;  1E7V A;  3UT4 A;  2PZI A;  2RG8 A;  3CHS A;  5AIJ A;  3TG4 A;  2WXQ A;  3ULE G;  1OWL A;  3VTX A;  4CT4 A;  3SBT B;  3IV0 A;  1YCS B;  4FC8 A;  2I1J A;  5CMW A;  5EIB E;  4JHR A;  3ZXP A;  2ETB A;  4KVO A;  3KD7 A;  4Y6C A;  3SGH A;  5A6C A;  4AVX A;  5CED B;  3PE3 A;  1FVH A;  3TWS A;  3MEK A;  4JA9 A;  2XCC A;  4U07 A;  3L22 A;  4FUL A;  3RK6 A;  2AXZ A;  3AG2 E;  3RIB A;  1WG0 A;  4ACK A;  4A1G A;  2VTB A;  4JPS A;  4WNF A;  5EX0 A;  4H7Y A;  2CHW A;  2XZT G;  2HR2 A;  3FP3 A;  3U66 A;  2DYS E;  3JXI A;  2AVP A;  1K1B A;  4I2Z A;  3MKQ B;  3APC A;  1H2U A;  3OAW A;  2Y4T A;  3MGB A;  4P29 A;  4TUM A;  1E8X A;  5CER B;  4HQD A;  3FH8 A;  1E8Y A;  4L2Y A;  3C3Q A;  3V2X A;  4GTS A;  5KJN A;  4BTA A;  3NF1 A;  5ENN A;  2AJA A;  3ZU7 B;  2C2L A;  3FTY A;  1TYQ G;  3UM0 A;  3SO8 A;  1Y8M A;  3L16 A;  4UWG A;  2X6F A;  2XPZ A;  4I6E A;  3LY8 A;  2R05 A;  3WG7 E;  3ZUV B;  5AAO A;  4N5Q A;  2I9C A;  3NOC D;  4FA6 A;  4JW1 A;  4TXQ A;  1HG2 A;  5M72 A;  4UQZ A;  3ZHE A;  4U04 A;  3CK7 A;  3V30 A;  4YND A;  4RVB A;  4KZ0 A;  2XEH A;  5E75 A;  3OXL A;  1N11 A;  5G04 J;  4LEU A;  1V54 E;  1UN9 A;  3FUE A;  1SQM A;  1JCR A;  2FUL A;  2LSV A;  5E76 A;  3LKU A;  1N4Q A;  4BER A;  4PDX A;  3RO2 A;  4HOQ A;  4BES A;  3TWW A;  3UMV A;  3T9K A;  4Q69 A;  5FQ4 A;  3J5P A;  4N3B A;  2KC7 A;  1WY6 A;  2VGY A;  4GPK A;  3C5R A;  5LP0 A;  1EPU A;  3ASG A;  2R02 A;  3OXF A;  4J0U A;  2NYJ A;  4L7T A;  2J07 A;  1K3Z D;  3D9L A;  4PH4 B;  4N3A A;  2R03 A;  4G23 A;  3QOU A;  3QKY A;  3E4B A;  3APF A;  1X81 A;  2UY1 A;  2ZGG A;  3MJW A;  4LSZ E;  5CHE E;  5DIZ A;  3ZYQ A;  5CCM A;  3PNT B;  2XHE A;  1DC2 A;  3PUJ A;  1LF8 A;  3L17 A;  4YDW A;  2LXM A;  4U8Y D;  2I2O A;  2YQ8 A;  4I9C A;  1OCR E;  4EZK A;  4U0U A;  5G04 C;  5EYL A;  2F37 A;  3UXG A;  1TJC A;  4HI8 A;  4MLP A;  2CFU A;  3PDN A;  3W9G A;  4BY6 A;  3L08 A;  4EBA A;  3NZU A;  2IFU A;  1UG3 A;  3MCX A;  4TRQ A;  4AV7 A;  3PZ4 A;  2KM4 A;  4BTB A;  4CDM A;  1MYO A;  4G8K A;  3AG3 E;  4G2V A;  4XKB A;  5ENP D;  4E85 A;  3GZS A;  4DK5 A;  4GZ3 A;  4YVQ C;  1DCE A;  4ANW A;  2IEJ A;  4GA1 A;  2OEW A;  2KZT A;  5EYP F;  4I1M A;  4OAU C;  2LXL A;  4NAC A;  3EHQ A;  3JQ1 A;  2J09 A;  5B1B E;  4EQF A;  3BG0 B;  4WUY A;  3CVW A;  2ILR A;  2WQ6 A;  4NUR A;  2L6J A;  1NP7 A;  4JL0 A;  2XEE A;  3IKO B;  3UT7 A;  3QWP A;  2JAB A;  3IXE A;  4AEZ C;  3NZS A;  3AU4 A;  2PQN A;  4O1P A;  3SY2 A;  3DWL G;  3FU5 A;  1U3D A;  4GTO A;  4JVS A;  4A55 A;  4TXR A;  2QC9 A;  2CG3 A;  4LG6 A;  4L1B A;  3KS2 A;  4FHK A;  4WWN A;  4UWL A;  2XQ0 A;  3L82 A;  2PM6 A;  5G2N A;  1G3N B;  1OCO E;  3DSS A;  1AWC B;  2R59 A;  1JCS A;  3SF4 A;  3DRA A;  2WXH A;  3UX4 A;  3ML8 A;  3UQ3 A;  2RD0 A;  3L13 A;  2L0I A;  1O5M A;  2VTB B;  1EF1 C;  5AQ7 A;  4F53 A;  2YIN A;  2DZO A;  1TEZ A;  2MYO A;  4CDR A;  5HKP A;  5FWQ A;  3RJV A;  3FEY A;  4LNG A;  4RG9 A;  2OVF A;  1KT1 A;  2WM9 A;  3ZEF A;  2QYJ A;  3CV0 A;  2AXV A;  5KNG A;  2Y0B G;  3EU9 A;  5BNW A;  4HB5 A;  4XI0 A;  4F1P A;  5JA4 D;  5ANR A;  4I1O B;  2VSY A;  4HS2 A;  1HX8 A;  3RAU A;  3LJ3 A;  1TN6 A;  1Z6T A;  3GZ2 A;  5KNH D;  1OCZ E;  3I3N A;  1JCQ A;  4JXT A;  3ZIM A;  3CK9 A;  4B8C B;  1OT8 A;  2X3M A;  5A7D B;  3U3W A;  3FTS A;  3CR3 A;  3EHM A;  2Y3A A;  5BV1 A;  4C48 B;  3NB2 A;  3D9H A;  1HU3 A;  5LFA A;  1TN8 A;  1BD8 A;  3CVN A;  5C1D A;  3FUN A;  4B0Z A;  3LVQ E;  5FQ8 A;  4GCO A;  4HOS A;  4GZC A;  4J8F A;  3I4G A;  1LD7 A;  2J9Q A;  4GTV A;  2CHZ A;  1H2T C;  4B94 A;  4J8D A;  4QFV A;  3FTZ A;  2KCK A;  3LXU X;  4KYO B;  4JEU A;  1E96 B;  3GW4 A;  3QJZ A;  3FUI A;  5EDS A;  3AAA C;  5EX3 A;  3UIO C;  2GRO B;  4DLO A;  4CGW A;  3FTW A;  1P5Q A;  4N3C A;  4L9P A;  3FUK A;  5KWD A;  3QNK A;  2WXI A;  4GML A;  3QK0 A;  3ESL A;  4U96 D;  3QAR A;  2MHK A;  4PS8 A;  4PS3 A;  1E8W A;  2GRP B;  3PVL A;  3CKB A;  4KMO A;  5G05 C;  1H6P A;  2L9B A;  3ASD A;  2IJG X;  4DRX E;  4ANU A;  2FBN A;  3SFX A;  4HRL A;  5AJL A;  2HO1 A;  4URK A;  4RLY A;  3FU0 A;  2WXO A;  3UT8 A;  3FEX A;  3AJI A;  1RW2 A;  3FHE A;  3CHQ A;  4I43 A;  3FUF A;  1IQU A;  4FLB A;  2WXF A;  4APF A;  4GB9 A;  4A1S A;  1N94 A;  1FT1 A;  2M63 A;  4GYO A;  5JHA A;  5CEA A;  2GW1 A;  5IY5 E;  1Z3Y A;  4HOT A;  1OWN A;  2C0L A;  2QY7 A;  3DEP A;  3CVU A;  3CHO A;  5JMN D;  2CG2 A;  5FIO A;  1SW6 A;  3ABL E;  3UKR G;  4BFR A;  2DBA A;  2L6B A;  2P9U G;  3UPV A;  3DST A;  4NRH B;  2FI7 A;  3J5Q B;  2EIL E;  2Y4U A;  1E7U A;  3AG1 E;  3D9M A;  4GTR A;  3CGH A;  5BUZ A;  1OUV A;  4YDO A;  4QQI A;  3JYS A;  3GYZ A;  1UN8 A;  2GRL A;  1TNY A;  3CHP A;  2ION A;  3OTN A;  4WND A;  4A3V A;  2KBX A;  4CRW A;  5FQ6 A;  1NZN A;  5T4Y A;  3SFY A;  2B6C A;  4JEH A;  2GRM A;  4N2Q A;  1U2V G;  3CST A;  1YMP A;  3EJN A;  1INZ A;  3L9T A;  3TWQ A;  1NA0 A;  4L2L A;  4BSZ B;  4UWF A;  3LEW A;  3CVV A;  1B89 A;  2R17 C;  4IN3 B;  1OXJ A;  1Y6I A;  4EBA G;  5LCW J;  3W9F A;  5J08 A;  2P2C P;  3DPY A;  3TWR A;  1UJK A;  3TXM A;  5H7P A;  3D9O A;  3TWV A;  3G2W A;  2V4H C;  2VYI A;  4HI9 A;  1HZ4 A;  4KBQ A;  5D2M C;  3UUX A;  2VGX B;  4U95 D;  3LYA A;  4GZ6 A;  4J6I A;  1KZP A;  5AEN A;  4I9E A;  4EPZ A;  3ASN E;  1ZB1 A;  3ZRH A;  2MRI A;  4UWK A;  4DPR A;  5C2Y A;  5ENO D;  2F8X K;  2CFZ A;  1DNP A;  4RQI A;  2ZXW E;  5CBN A;  5JJ6 A;  5FTP A;  1TNO A;  5EN5 D;  4LRZ A;  2PM7 A;  2KCV A;  2IO2 C;  3PRZ A;  2WB2 A;  5AYW D;  2P9L G;  4E6H A;  4LNB A;  3PZD A;  1DCQ A;  4HLE A;  4MBG A;  4XIF A;  1NI1 A;  3Q5M A;  3NBN B;  3C3O A;  1TNZ A;  3B7R L;  1KT0 A;  3DEO A;  2DVW A;  3ZPJ A;  2V5Q C;  1UW4 B;  3T8K A;  3Q9U C;  3CSF A;  3FU3 A;  2Y69 E;  4ZHB A;  2BTD A;  4XZ4 A;  2ZU6 B;  2WXN A;  3VLE A;  1TNU A;  4EZJ A;  2OCC E;  5KJM A;  2A4Z A;  2XPI A;  3HXD A;  1HF8 A;  3EIJ A;  4HNA D;  4WAF A;  3BQO A;  5ENR D;  4U7E B;  4XI9 A;  3UM1 A;  2A5E A;  4ATG A;  1PAQ A;  2E2E A;  2ETA A;  5AAR A;  3DSU A;  2EIK E;  3CVL A;  3EUV A;  3V79 K;  1YYH A;  2DIW A;  3HG0 D;  4HVB A;  1Z5S C;  3PRE A;  4J7W A;  4GA0 A;  3C3R A;  2NSZ A;  4N2S A;  1TR4 A;  2V0P A;  1WDY A;  4O60 A;  3ULY A;  5JHB A;  3LJN A;  2LO6 A;  2BKK B;  4HFG A;  4WWP A;  4B93 B;  3Q4A B;  5D66 A;  5B3S E;  1A5E A;  3UIN C;  4AXH A;  4OVV A;  3LY9 A;  2IOL A;  3R7Q A;  1N54 A;  4X8Q A;  1K1A A;  4U8V D;  2EIM E;  3TJP A;  3S7F A;  1EDU A;  1IHG A;  4EZL A;  4F1S A;  4F7A A;  3FU6 A;  3SZ7 A;  4ANV A;  3SHF A;  2WXR A;  3JUI A;  4FJY A;  2PL2 A;  1OWM A;  1HO8 A;  1SA4 A;  4BET A;  2KZT B;  3BEE A;  3IBE A;  4I1A A;  4GTT A;  5FIN A;  1JPL A;  1U3C A;  2GRN B;  1VDY A;  4H7X A;  4CEM A;  4O6F A;  3HXB A;  4N5C A;  2FO7 A;  2IY0 C;  3ML9 A;  3FDH A;  3Q7F A;  4APO A;  2VGX A;  4BT8 A;  5FZQ A;  1NFI E;  1MJ0 A;  3JXJ A;  4AM9 A;  4YDE A;  3CQC B;  4DX1 A;  3E32 A;  4OYS A;  3PNL B;  5ARF A;  2WPV A;  1H6K A;  2YNQ A;  4I6J A;  2Q7F A;  4YDY A;  2QYU A;  4HRN A;  4HXI A;  3B7S A;  3ZYM A;  3MV2 B;  3PUK A;  3PE4 A;  4ACL A;  4GTP A;  4IYP A;  4IRU A;  3HRA A;  4UI9 C;  4LUN U;  4FAD A;  3CLJ A;  5EIL A;  2WXJ A;  1K8K G;  1V55 E;  4FHJ A;  3AG4 E;  3FTU A;  3JCK C;  2YHE A;  4A63 B;  4DI4 A;  2PQR A;  4ILI A;  3TAX A;  1IQR A;  3ESK A;  1WM5 A;  3R9A B;  2XEN A;  4LCT A;  3FWV A;  1BPO A;  4Q94 A;  3ZYL A;  3DXK G;  3GZ1 A;  2IF4 A;  3G2V A;  3O4Z A;  1DVP A;  3RRM B;  3LVR E;  3RRU A;  4KZC A;  2JEK A;  1E8Z A;  3EIQ C;  4CYM D;  3LPZ A;  3E34 A;  5EKQ D;  4K03 A;  2F0Y A;  4EHM A;  3EHN A;  2YHC A;  3ZFW A;  1SA5 A;  5FZS A;  3R9M A;  2JLB A;  3CQG B;  4UWH A;  3UM3 A;  4GMR A;  5HRY A;  1O1R A;  4XEI G;  4ILG A;  3Q73 A;  2P9K G;  4ABN A;  2EQX A;  1EYH A;  1OY3 D;  2BED A;  3LS8 A;  4K5C A;  3DXM G;  3ASF A;  4WNG A;  1GW6 A;  2J49 A;  5BW8 C;  3KSQ A;  2ZIS A;  4GA2 A;  4U8H A;  3URZ A;  4G8L A;  1N9A A;  2AWI A;  3DSW A;  4PS7 A;  5HS0 A;  2WQH A;  5AQA A;  3FFL A;  2IO3 C;  3ZN3 A;  4DX7 D;  4B8A A;  1KLX A;  3CVQ A;  2XGS A;  3Q9N C;  3B95 A;  3HHM A;  3TWT A;  2XCB A;  4RG6 A;  1N4P A;  3T8M A;  3B7U X;  4CT0 A;  4MKT A;  4ME2 A;  3R7R A;  2ETC A;  3S7D A;  3KEZ A;  1MZC A;  2V8S E;  3MZL B;  3LY7 A;  2DCP A;  1XGW A;  4AP2 A;  4GAA A;  3I5P A;  5G05 J;  5AQ9 A;  5FT9 A;  4GZ5 A;  4JZY A;  3CEQ A;  3RKV A;  3PEU B;  2AXU A;  2WQ7 A;  3QC1 A;  2VJ8 A;  4HOR A;  3B7T A;  2GRQ B;  2WMN A;  1IXV A;  3BG1 B;  3TL5 A;  1UOH A;  2VGE A;  4B89 A;  1FCH A;  5EID A;  3O48 A;  3CHM A;  4V3I A;  4C0M A;  3TWU A;  1JUQ A;  1HG5 A;  1BU9 A;  3G2S A;  4OAV B;  5AJD A;  5ARG A;  4MRU A;  4O1O A;  3FTX A;  3ONK A;  5HQ8 A;  3TWX A;  4FP7 A;  2WXP A;  2VSX E;  3RU0 A;  3VTY A;  2GRR B;  2EIJ E;  2IU1 A;  4GTM A;  3ISM C;  4A3T A;  5FZR A;  3QAQ A;  4Y6W A;  2OOE A;  3QDN A;  2FEZ A;  4JC8 A;  3AU5 A;  4KXK B;  4J8E A;  4GU5 A;  3UM2 A;  3B7B A;  3CIA A; 
#chains in the Genus database with same CATH homology
 3T5X A;  3SFZ A;  4XIF A;  2WMO A;  4GMJ A;  3Q5M A;  3Q47 B;  3MYV A;  2BUG A;  3FY4 A;  3JQ0 A;  4NAC A;  3B7R L;  3QB2 A;  1KT0 A;  4RSY A;  4OVU A;  4BWR A;  1L5J A;  3JQ1 A;  2KAT A;  2KCL A;  2UWJ G;  2X38 A;  3ZGQ A;  2MOW A;  3ZPJ A;  3ZXS A;  1UW4 B;  2J09 A;  5T8I A;  3S2A A;  3G2T A;  4EQF A;  2WXK A;  4U0S A;  5BPP A;  3BG0 B;  3C98 A;  5G55 A;  4WWO A;  3G2U A;  3L54 A;  4WUY A;  3CSF A;  1QQE A;  2I6H A;  1SZ9 A;  3CVW A;  2ILR A;  3TG5 A;  2WQ6 A;  3IHV A;  3FU3 A;  5KCM A;  4NUR A;  2L6J A;  3I4R B;  1NP7 A;  4I2W A;  1HH8 A;  2BTD A;  3D9J A;  3D9P A;  4JL0 A;  4XZ4 A;  2ZU6 B;  3IKO B;  2WXN A;  3UT7 A;  3CVY A;  5KJK A;  3QWP A;  3VLE A;  1ZU2 A;  4W9R A;  4AEZ C;  3NZS A;  3AU4 A;  2PQN A;  5LCW C;  5J90 A;  4EZJ A;  3FUH A;  1S0P A;  2FF4 A;  3HDX A;  5KJM A;  2A4Z A;  3N71 A;  1W3B A;  3FU5 A;  1TJF A;  2P58 C;  2XPI A;  3Q15 A;  1HF8 A;  3EIJ A;  4WAF A;  3TXN A;  3T5V A;  3AS5 A;  1U3D A;  4AJW A;  4C9B B;  2WVI A;  2XPY A;  4XI9 A;  3L6A A;  1HFA A;  3NQP A;  4JVS A;  4A55 A;  1X5B A;  1Z3X A;  4ATG A;  1PAQ A;  4FU3 A;  2E2E A;  5BT1 A;  4K0R A;  3CVL A;  2CG3 A;  2VSO E;  2DIW A;  4HVB A;  4BX9 A;  3PRE A;  2WXM A;  4L1B A;  3KS2 A;  2LNI A;  4FHK A;  4WWN A;  3U64 A;  4GA0 A;  3ONL A;  2NSZ A;  4UWL A;  4AY6 A;  3PEV B;  2XQ0 A;  3FUJ A;  5T3R A;  4N2S A;  2V0P A;  2PM6 A;  5FJY A;  5G2N A;  2WXL A;  5BV0 A;  4GCN A;  5JHB A;  2C0M A;  3WXX A;  2LO6 A;  2V4L A;  1H2V C;  4JHK A;  2A5U A;  2XEV A;  4UQY A;  2R59 A;  4HFG A;  3CHR A;  4WWP A;  3SF4 A;  3SD5 A;  3Q4A B;  2L0T B;  4G24 A;  5A23 A;  2WXH A;  1E90 A;  3UX4 A;  2X6I A;  3ML8 A;  3UQ3 A;  2RD0 A;  1YA0 A;  1MHQ A;  3L13 A;  2L0I A;  2UY1 B;  3LDZ A;  2QFC A;  3HVE A;  3ASH A;  4GYW A;  2VTB B;  4AXH A;  4OVV A;  4MS6 A;  3LY9 A;  2IOS A;  4UI9 K;  2IOL A;  1EF1 C;  3R7Q A;  1N54 A;  4F53 A;  2YIN A;  3MX3 A;  4BT9 A;  3TJP A;  3S7F A;  1TEZ A;  3FUD A;  1EDU A;  1IHG A;  4CDR A;  4EZL A;  3S7B A;  2WXG A;  4F1S A;  4XX5 A;  5FWQ A;  3CVP A;  3RJV A;  3FEY A;  4F7A A;  3FU6 A;  2OVF A;  4RG9 A;  3ULQ A;  1KT1 A;  3SZ7 A;  4CCA A;  2J4B A;  4ANV A;  4FLH A;  3SHF A;  2WXR A;  3JUI A;  2E0I A;  4FJY A;  4EEC A;  1E7V A;  2WM9 A;  3RRN B;  2PL2 A;  3UT4 A;  2PZI A;  3ZEF A;  1OWM A;  4NQ0 A;  1HO8 A;  2RG8 A;  2J4D A;  3CV0 A;  2AXV A;  2NC9 A;  3CHS A;  2GGF A;  2KZT B;  5D0Q D;  4UQX A;  3BEE A;  3TG4 A;  2WXQ A;  4XI0 A;  5AIJ A;  5BNW A;  1OWL A;  5ANR A;  3IBE A;  4DLQ A;  4I1O B;  4I1A A;  2VSY A;  4HS2 A;  1HX8 A;  3VTX A;  3LJ3 A;  3GZ2 A;  1Z6T A;  4CT4 A;  1U3C A;  1JPL A;  3SBT B;  4F3V A;  3I3N A;  4HLE A;  4JXT A;  1VDY A;  4H7X A;  3ZIM A;  4CEM A;  4TUU A;  3DBS A;  3CK9 A;  4B8C B;  3IV0 A;  4O6F A;  2X3M A;  4FC8 A;  2I1J A;  4N5C A;  5A7D B;  1ZBP A;  3U3W A;  3FTS A;  3EHM A;  2FO7 A;  3CR3 A;  3FDH A;  3ML9 A;  2Y3A A;  4N39 A;  5BV1 A;  5CMW A;  3HYM B;  2AW6 A;  3P2B A;  2BF0 X;  2V5F A;  4JHR A;  3EDT B;  1HU3 A;  4KVO A;  4APO A;  5LFA A;  1A17 A;  2VGX A;  3CVN A;  4J8S A;  4I6G A;  5FQ7 A;  3KD7 A;  4Y6C A;  3SGH A;  4BT8 A;  5C1D A;  5FZQ A;  5A6C A;  4LER A;  4AVX A;  3PE3 A;  3FUN A;  1FVH A;  3LVQ E;  3MEK A;  4AM9 A;  5FQ8 A;  4B0Z A;  4GCO A;  4HOS A;  4GZC A;  3AS8 A;  4JA9 A;  3Q49 B;  2XCC A;  2NXP A;  3CQC B;  4U07 A;  2IQC A;  4KT6 B;  3L22 A;  4FUL A;  4OYS A;  3PNL B;  3RK6 A;  1XNF A;  2AXZ A;  4G25 A;  4J8F A;  5ARF A;  3RIB A;  3I4G A;  3CVX A;  1H0A A;  2J9Q A;  2WPV A;  4ACK A;  1H6K A;  4A1G A;  2VTB A;  2HM8 A;  2YNQ A;  1QZ2 A;  4I6J A;  4JPS A;  4WNF A;  2LAI A;  5EX0 A;  2CHZ A;  2Q7F A;  1H2T C;  4B94 A;  4H7Y A;  2CHW A;  3DPD A;  2HR2 A;  3FP3 A;  4HXI A;  3B7S A;  4J8D A;  3FTZ A;  4QFV A;  3ZYM A;  3FTV A;  3MV2 B;  3PUK A;  5D0O D;  3U66 A;  2KCK A;  3MKQ A;  3PE4 A;  4ACL A;  3LXU X;  4IYP A;  2AVP A;  4IRU A;  4KYO B;  4JEU A;  4UI9 C;  4I2Z A;  1E96 B;  4G26 A;  4LUN U;  3MKQ B;  4AY5 A;  1NA3 A;  4FAD A;  1H19 A;  3APC A;  3CLJ A;  1H2U A;  3GW4 A;  3OAW A;  2WXJ A;  2XGM A;  3QJZ A;  2Y4T A;  3FUI A;  5EDS A;  4FHJ A;  3MGB A;  5EX3 A;  3FTU A;  3JCK C;  4P29 A;  2YHE A;  4HOU A;  4DI4 A;  2PQR A;  4DLO A;  4CGW A;  3FTW A;  1E8X A;  4ILI A;  1JWF A;  3TAX A;  1IQR A;  1P5Q A;  2X6J A;  3ESK A;  4N3C A;  3FH8 A;  1WM5 A;  3FUK A;  5ANL A;  3QNK A;  3R9A B;  2WXI A;  4GML A;  1IYG A;  1E8Y A;  3QK0 A;  4L2Y A;  4LCT A;  5JJT A;  5KJN A;  2XGO A;  3FWV A;  4BTA A;  3ESL A;  3NF1 A;  1BPO A;  2XRY A;  3U4T A;  4GZD A;  5ENN A;  3QAR A;  4Q94 A;  2MHK A;  5JJ7 A;  1UJJ A;  4PS8 A;  4PS3 A;  3ZYL A;  2HYZ A;  3IHY A;  1E8W A;  2C2L A;  3GZ1 A;  3ZYK A;  3FTY A;  2IF4 A;  1Y8M A;  2X6H A;  3CKB A;  3G2V A;  3MA5 A;  3O4Z A;  3L16 A;  3MKR A;  1DVP A;  2X6F A;  4G11 A;  4KMO A;  4UWG A;  5G05 C;  3LVR E;  4JA7 A;  3RRM B;  2XPZ A;  2L9B A;  3RRU A;  1FVF A;  3ASD A;  4KZC A;  2JEK A;  2IJG X;  1E8Z A;  4I6E A;  3EIQ C;  1ELW A;  4ANU A;  2FBN A;  3LPZ A;  3LY8 A;  5EKQ D;  4K03 A;  4ANX A;  3EHN A;  2YHC A;  3ZFW A;  4AIF A;  2R5S A;  5AJL A;  3QWV A;  3FUL A;  2HO1 A;  4PUC A;  5FZS A;  3U9W A;  4URK A;  3FU0 A;  2JLB A;  3CQG B;  2WXO A;  4UWH A;  3UT8 A;  2I9C A;  3B13 A;  3FEX A;  3FHE A;  4FA6 A;  4JW1 A;  1HS6 A;  3CHQ A;  1HG2 A;  4I43 A;  3D9N A;  3FUF A;  5M72 A;  1IQU A;  4UQZ A;  4U04 A;  3ZHE A;  5KJL A;  3CK7 A;  4FLB A;  3LCA A;  4ILG A;  2WXF A;  4Q96 A;  4APF A;  4YND A;  4RVB A;  3ZVV A;  4GB9 A;  4KZ0 A;  4A1S A;  4U0Z A;  5E75 A;  3OXL A;  2OV8 A;  4ABN A;  2EQX A;  3PH0 C;  1EYH A;  2M63 A;  4GYO A;  5JHA A;  5G04 J;  3K9I A;  4LEU A;  3LS8 A;  1UN9 A;  2GW1 A;  4HOT A;  1Z3Y A;  1OWN A;  3FUE A;  3ASF A;  2C0L A;  4WNG A;  1SQM A;  2QY7 A;  1GW6 A;  2FUL A;  2J49 A;  2LSV A;  3CHO A;  5E76 A;  5BW8 C;  2CG2 A;  3LKU A;  3CVU A;  3D9K A;  4G1T A;  4GYY A;  4PDX A;  3RO2 A;  4BFR A;  2DBA A;  3UPV A;  1ELK A;  2FI7 A;  4NRH B;  3KAE A;  3ZHE B;  4HOQ A;  4GA2 A;  4U8H A;  3URZ A;  2Y4U A;  2AWI A;  4PS7 A;  3UMV A;  1SZA A;  1E7U A;  1WAO 1;  4CDN A;  4Q69 A;  5FQ4 A;  3D9M A;  3CGH A;  5BUZ A;  1OUV A;  4N3B A;  2I1K A;  2J08 A;  2KC7 A;  2WQH A;  3SBS A;  3JYS A;  1WY6 A;  3GYZ A;  3FFL A;  1UN8 A;  2GRL A;  4R7L A;  2VGY A;  5CCL A;  4TV3 A;  3ZN3 A;  4GPK A;  3CHP A;  3MV3 B;  4B8A A;  1KLX A;  5LP0 A;  3CVQ A;  1EPU A;  2XGS A;  2ION A;  3OTN A;  3QWW A;  4WND A;  3ASG A;  4WNE A;  3HHM A;  5LX8 A;  4A3V A;  2XCB A;  3OXF A;  4J0U A;  4RG6 A;  4CRW A;  5FQ6 A;  4XKC A;  1NZN A;  5T4Y A;  3B7U X;  3T8M A;  4CT0 A;  4L7T A;  4MKT A;  4ME2 A;  5LOZ A;  3R7R A;  2OND A;  2J07 A;  3D9L A;  4PH4 B;  4JEH A;  4N3A A;  3S7D A;  3KEZ A;  2GRM A;  3CK8 A;  4G23 A;  2V8S E;  4N2Q A;  3OXG A;  3MZL B;  4KVM A;  3QOU A;  3CST A;  3LY7 A;  2DCP A;  1XGW A;  3EJN A;  3QKY A;  3D9I A;  3S7J A;  4AP2 A;  1INZ A;  4GAA A;  3E4B A;  5HI7 A;  3APF A;  3I5P A;  5G05 J;  5FT9 A;  1OWO A;  1NA0 A;  1HE8 A;  2LAH A;  4GZ5 A;  4L2L A;  4UWF A;  3ZW3 A;  4C0E A;  2XRZ A;  3HVE B;  3APD A;  2UY1 A;  4JZY A;  3LEW A;  3CVV A;  4M3O A;  3CEQ A;  1B89 A;  3RKV A;  2VQ2 A;  1JWG A;  3PEU B;  2AXU A;  2R17 C;  4IN3 B;  2WQ7 A;  3QC1 A;  3P1U A;  1Y6I A;  2VJ8 A;  4EBA G;  5LCW J;  3MJW A;  5J08 A;  5CHE E;  4HOR A;  5DIZ A;  4IUL A;  4AOF A;  3ZYQ A;  4UI9 J;  5CCM A;  3PNT B;  4U63 A;  2XHE A;  3PUJ A;  3VLD A;  3B7T A;  4XE0 A;  4I17 A;  1UJK A;  2WMN A;  1LF8 A;  3L17 A;  3BG1 B;  3TL5 A;  4BSX A;  3TXM A;  4B89 A;  1FCH A;  2LSU A;  2I2O A;  2YQ8 A;  3D9O A;  3O48 A;  3FUM A;  4L23 A;  4I9C A;  3RO3 A;  1MQS A;  4U0U A;  3CHM A;  4V3I A;  5G04 C;  4EZK A;  2CHX A;  3G2W A;  4ILH B;  3SNX A;  4C0M A;  2VYI A;  3IEG A;  1JUQ A;  4CGV A;  1HXI A;  1HZ4 A;  4KBQ A;  1TJC A;  4FJZ A;  3UUX A;  2VGX B;  1HG5 A;  4MLP A;  3G2S A;  3LYA A;  4GZ6 A;  2CFU A;  3PDN A;  4J6I A;  5AJD A;  5ARG A;  4BY6 A;  4MRU A;  3PVL A;  3L08 A;  4JHJ A;  3SI5 A;  5AEN A;  4I9E A;  4EBA A;  3FTX A;  5CMY A;  4EPZ A;  3ONK A;  2X6K A;  3NZU A;  5HQ8 A;  3FH5 A;  5DBK A;  3HIZ A;  2IFU A;  3ZRH A;  4FP7 A;  2WXP A;  2MRI A;  2VSX E;  1UG3 A;  4UWK A;  3MCX A;  4DPR A;  3FH7 A;  3VLF A;  3RU0 A;  4TRQ A;  3VTY A;  2OVB A;  4AV7 A;  5C2Y A;  3D3M A;  2VSN A;  1OWP A;  1PC2 A;  2IU1 A;  2KM4 A;  3PS6 A;  4DI3 A;  4BTB A;  1QNF A;  2CFZ A;  3TGO A;  1DNP A;  4CDM A;  4A3T A;  5JJ6 A;  4G2V A;  5FTP A;  4XKB A;  4BX8 A;  4DJA A;  5FZR A;  3QAQ A;  4Y6W A;  3ENE A;  3GZS A;  4E85 A;  4LRZ A;  4YVO A;  4DK5 A;  2OOE A;  3QDN A;  2PM7 A;  3CKC A;  4GZ3 A;  4YVQ C;  4ANW A;  2FEZ A;  4JC8 A;  2KCV A;  1PY1 A;  3AU5 A;  4GA1 A;  4KXK B;  3AS4 A;  2KZT A;  3PRZ A;  4GU5 A;  4J8E A;  4D10 C;  1N52 A;  2WB2 A;  5AYW D;  1ELR A;  4E6H A;  3PZD A;  4I1M A;  3CIA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...