1Y8MA

Solution structure of yeast mitochondria fission protein fis1
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
144
structure length
144
Chain Sequence
MTKVDFWPTLKDAYEPLYPQQLEILRQQVVSEGGPTATIQSRFNYAWGLIKSTDVNDERLGVKILTDIYKEAESRRRECLYYLTIGCYKLGEYSMAKRYVDTLFEHERNNKQVGALKSMVEDKIQKETLKGVVVAGGVHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fis1
publication title Novel structure of the N terminus in yeast Fis1 correlates with a specialized function in mitochondrial fission.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Unknown function
total genus 43
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2004-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14852 Fis1_TPR_N Fis1 N-terminal tetratricopeptide repeat
A PF14853 Fis1_TPR_C Fis1 C-terminal tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1y8mA01
2AVPA 3LPZA 2L6JA 3FWVA 4I9CA 2XPIA 4RG6A 2VSNA 5JJ6A 3CKCA 1KLXA 2E2EA 2C0LA 1TJCA 3ASFA 3O48A 3HYMB 4UI9J 2KCVA 3LY7A 3FP3A 3WXXA 3K9IA 1NZNA 4J8DA 1NA3A 2UWJG 4UI9C 4U0SA 4XIFA 3LKUA 4NQ0A 3U4TA 5JJTA 2GW1A 5G05C 5KJNA 4O6FA 2I6HA 4GYWA 1HXIA 3U3WA 1NA0A 4N2QA 3MKRA 4I17A 4RG9A 2XGOA 4N3AA 3MV3B 4GA0A 2VYIA 2J9QA 3GW4A 2C2LA 4AY5A 5HI7A 3Q47B 3TAXA 2UY1B 3CVLA 3QWVA 3MA5A 4I9EA 4UQYA 5BW8C 3R9AB 4BTAA 2XGMA 2C0MA 5M72A 4J8FA 5EX3A 3QDNA 3Q4AB 1QZ2A 2KATA 4YVOA 3TG4A 3ASGA 3CKBA 2VQ2A 4XI0A 1YA0A 4N5CA 4ABNA 3N71A 2WPVA 1ELRA 3RO3A 4GZ3A 3ZFWA 4LEUA 3OXGA 5HQ8A 2ONDA 2VGXA 3URZA 4I2WA 2OOEA 3UUXA 4G2VA 2FI7A 1WM5A 2PZIA 4I2ZA 4H7XA 3UQ3A 3MV2B 4B94A 4AY6A 3SF4A 3CK7A 3NF1A 4I1AA 4WNDA 2Q7FA 2FO7A 5FZQA 3S7JA 4JA7A 2BUGA 2YHCA 3TGOA 1A17A 3GZ1A 3RU0A 4G1TA 3Q15A 5BNWA 1XNFA 4F3VA 3PDNA 1HH8A 3ZN3A 2Y4UA 5G05J 3ZGQA 1PC2A 3BEEA 2XEVA 2FF4A 3LCAA 2IFUA 2Y4TA 3KD7A 2XGSA 3QOUA 4WNGA 3FFLA 3Q49B 3IEGA 4N3CA 3S7BA 4U07A 4CGWA 5FZRA 5A7DB 5ARGA 4GCOA 4IN3B 2LSUA 2PL2A 4BT9A 4N39A 2KCLA 1ZBPA 4U0ZA 3RO2A 2NC9A 2XCBA 1P5QA 3GZ2A 3GYZA 3RKVA 4N2SA 3QKYA 5DIZA 3CEQA 3CK8A 3ZHEA 1WAO1 4GZ6A 2PQRA 1KT1A 4XI9A 5ARFA 3KS2A 5FTPA 1OUVA 4UQZA 2P58C 1E96B 5G04C 1KT0A 3CK9A 3UPVA 4KYOB 1W3BA 2JLBA 3E4BA 2KCKA 1QQEA 4ME2A 2R5SA 4CDRA 5D0OD 4G25A 4UQXA 4GCNA 3CV0A 2LNIA 5DBKA 5D0QD 2HO1A 4GA2A 3RIBA 4W9RA 4JL0A 4GPKA 3ZHEB 3RJVA 1FCHA 4HOSA 4WNFA 3S7DA 4GYOA 3VTYA 3QWWA 5CCLA 5EKQD 3PE4A 3CVNA 3EDTB 5FT9A 4NRHB 4G24A 5KJMA 1ELWA 5FZSA 1IHGA 3MEKA 2HYZA 2WQHA 4GA1A 4JHRA 5CCMA 3JYSA 4Y6CA 2VGXB 5LCWJ 2PQNA 4KXKB 3CVQA 2VSYA 3Q5MA 3LY8A 3TG5A 5AYWD 4AIFA 5LCWC 2UY1A 4BWRA 4H7YA 4YNDA 3OXFA 1HZ4A 2FBNA 5FJYA 2HR2A 5KJLA 2IF4A 5BT1A 4GZ5A 3ULQA 4HOUA 3AS4A 4Y6WA 4WUYA 1ZU2A 2DBAA 1Y8MA 3PE3A 2LSVA 4U04A 4N3BA 4HOTA 2FEZA 3AS5A 4APOA 4G26A 1B89A 5EX0A 4EQFA 4AM9A 3KAEA 3LY9A 2QFCA 5G04J 3VTXA 3ZPJA 3LYAA 4BTBA 3OXLA 4U0UA 4G23A 2YQ8A 4BT8A 3AS8A 3S7FA 5CHEE 4A1SA 4J0UA 3CVPA 4UI9K 4HORA 2XCCA 2KC7A 4KBQA 5JJ7A 3ASHA 3ASDA 2VGYA 4GYYA 2MHKA 3ESKA 5C1DA 2V5FA 4JA9A 4WNEA 1IYGA 4CGVA 4HOQA 5A6CA 4YVQC 3SZ7A 3QWPA 5KJKA 4J8EA
chains in the Genus database with same CATH superfamily
3APFA 4YDWA 5AQAA 3ENEA 3HXEA 4MRUA 3CKCA 3AG3E 1KLXA 2E2EA 4EECA 1TJCA 3O48A 2DWZA 1MYOA 3HYMB 1MX6A 1PAQA 3FP3A 1BLXB 4MS6A 4I1MA 4AV7A 3K9IA 4J8DA 2X6HA 2UWJG 4UI9C 2Y0BG 3EHNA 3LJ3A 3MGBA 3FTYA 3UM0A 2LXLA 2V8SE 5KJNA 3CSTA 1JUQA 1HXIA 1NA0A 2IOLA 4N2QA 4CCAA 3PNTB 1O5MA 3PRZA 2A4ZA 2XGOA 3LEWA 4N3AA 2VYIA 4XKCA 4WWNA 3Q78A 4PS3A 4IYPA 3Q47B 3UINC 5H7PA 5CRUA 2DCPA 4FHKA 4ANUA 3QWVA 3MA5A 2J09A 2RG8A 2AW6A 3IHYA 3JXIA 3SNXA 5JHBA 3RSEG 3T8MA 4IULA 5M72A 1H0AA 4U8VD 3AAAC 3Q4AB 2XPZA 2LAHA 2AXZA 5CBNA 1YA0A 4EBAA 3PREA 2IONA 1KPSB 2CG2A 2WPVA 2WXMA 1OCOE 5CEAA 3RO3A 3DSUA 3RK6A 4LEUA 5CRVA 1MX4A 2YHEA 3PVLA 3DSWA 4GTPA 3DEOA 4FJYA 4C48B 4I2ZA 4H7XA 3CQGB 3CK7A 4JD2G 5FZQA 2XRYA 3TGOA 3DRAA 1A17A 3GZ1A 2ZXWE 3OAWA 4KVMA 4ATGA 1KZPA 3FH7A 3PDNA 4KZ0A 5LX8A 1PC2A 1X81A 1LTXA 3G2VA 2XEVA 2WQ6A 2WVIA 2OEVA 2DYSE 4LNGA 4C0EA 2CFZA 3IXEA 3Q49B 2MYOA 2EINE 2X6KA 3AU4A 2LSUA 2R05A 4N39A 5BXUA 4Q96A 5FWQA 3Q79A 3RO2A 2EQXA 3W9GA 3BU8A 3G2TA 1Z3XA 3L9TA 4GTSA 3JQ1A 2XS1A 3KSQA 3P1UA 4BY6A 2CHXA 2B0OE 4BX9A 2XRZA 3CEQA 1HU3A 3D9PA 4I1OB 3O4ZA 4O1PA 4HI8A 2LO6A 5CECB 2PQRA 1KT1A 2VGEA 4XI9A 2I9CA 3T5XA 4GAAA 3KS2A 3CR3A 1OUVA 2P58C 2RD0A 1E96B 5G04C 3PZ2A 4KYOB 2QYJA 5ENQD 3SQVA 4AOFA 1W3BA 5G2NA 2JLBA 3D9JA 2F0YA 1DC2A 3D9MA 3SO8A 4ME2A 2ETBA 5D0OD 4ZFHA 2VJ8A 1IQRA 1HG5A 2LNIA 3NQPA 5D0QD 4GTVA 3MKQA 2PNNA 2GGFA 4JL0A 5JHAA 1EF1C 4GPKA 4HOSA 5FQ7A 5AENA 3LDZA 3NZSA 2WXRA 2EIKE 4BETA 3B7BA 2CHZA 5EKQD 1V54E 4JPSA 5FT9A 2AJAA 5FIOA 3L16A 3MEKA 3MX3A 1ZB1A 3JYSA 3KEZA 3UT4A 2MRIA 2PQNA 3CVQA 1H2TC 3T9KA 5LCWC 2UY1A 3DSSA 3KEAA 4HVBA 3FTZA 1TNYA 1N4SA 5BXOA 3G2UA 3QAQA 5IY5E 1K1BA 3ML9A 5KJLA 3AJIA 3U9WA 4DX7D 5D66A 4JZYA 4HNAD 4BESA 4CYMD 1GW6A 4L9PA 3TWRA 5E76A 2J08A 3FUEA 5ITZF 2V4LA 3AS5A 1OWMA 2V4HC 2CFUA 4R7LA 2XZTG 5ENRD 5EX0A 2E0IA 4AM9A 3LY9A 1TN7A 4FP7A 3ASOE 4DI4A 3BQOA 3OXLA 1U2VG 2YQ8A 1FT1A 5G55A 3RRNB 5BV1A 1N11A 5B1AE 2DYRE 2IEJA 1ELKA 1LD8A 1QNFA 4C0MA 1UG3A 5JJ7A 4GYYA 3PEVB 4P29A 2BEDA 2Y3AA 4ILHB 3HHMA 3L54A 3QJZA 2WXPA 2FO1E 5AIJA 1OWOA 3SGHA 5CBOA 2VSXE 3L08A 5KWDA 1HG2A 2DVWA 2AVPA 1BI8B 2WMOA 3FWVA 2XPIA 4OYSA 2IU1A 2ZU6B 1OT8A 1NI1A 1TEZA 4BSXA 4RSYA 2J8SD 3TWUA 3ASFA 2X38A 4BFRA 3LY7A 3UXGA 3D9OA 2J07A 3V2XA 3Q9UC 3WXXA 4AJWA 3KSLA 5EILA 1D8DA 3Q7FA 1K3ZD 3HXDA 3LKUA 4NQ0A 2LXMA 4HLEA 3CVYA 4I6GA 3EUVA 3E34A 3D9IA 3U3WA 2ETAA 1TJFA 3MKRA 2WXHA 4RG9A 2XZDG 4GTQA 3MV3B 3EIJA 1O1TA 1FVHA 4ANXA 2C2LA 4OVVA 1EPUA 4XZ4A 1MX2A 1S0PA 3ZRHA 1D8EA 4I9EA 3ISMC 1H6PA 4Z68A 3QNKA 4BTAA 2GRLA 4Q69A 3PUJA 2C0MA 5FINA 2VSOE 2H6HA 1H6OA 3QC1A 3TWXA 2KATA 1UN8A 3ASGA 2P9LG 1OY3D 3IBEA 3LS8A 4N5CA 4RVBA 4K5AB 3PZ3A 1UOHA 2F37A 3N71A 4J8SA 2AXVA 1HX8A 4B0ZA 3DWLG 5JMND 4E6HA 2VGXA 2IO3C 2H6FA 2M63A 3LXUX 5HRYA 2OOEA 3UUXA 1OWLA 2FI7A 1WM5A 5BUZA 5LP0A 3MV2B 3DXMG 1Z3YA 3NF1A 4I1AA 1EYHA 2Q7FA 2YHCA 4LG6A 3RU0A 5G05J 1IHBA 2WXQA 4ATZD 3VLDA 4TUUA 4JXTA 3D9KA 4J7WA 5AJDA 3ONKA 1OWPA 3FFLA 4CDMA 4LNBA 5AARA 1AWCB 3IEGA 3S7BA 3I5PA 3IHVA 1BD8A 3ULYA 2ETCA 5EDSA 4OAVB 2KCLA 3DSTA 3ABLE 4BSZB 3QARA 5T3RA 2IQCA 1P5QA 3BG0B 3AG2E 4WAFA 3B95A 3S2AA 3X2QE 4PS7A 4LERA 4JEHA 2CG3A 5B3SE 1OCZE 2XPYA 5DIZA 3SY2A 3TWQA 1O1RA 4FHJA 5ENPD 4XX5A 4J8YA 3HG0D 4HRMB 4ACLA 1KT0A 2GROB 3CK9A 4G8KA 3TJPA 1N95A 3L82A 1UJJA 3R7QA 3JQ0A 1TR4A 4GB9A 3FH8A 3FU0A 1EDUA 4O1OA 4CDRA 3SBTB 2WXIA 5DBKA 1HO8A 2NYJA 3FTWA 3NB2A 1HFAA 3RJVA 1FCHA 5CEDB 4LCTA 3QK0A 3S7DA 1N0RA 4GYOA 3VTYA 2DIWA 3G2WA 3QWWA 3PE4A 3CVNA 3DPDA 3UKRG 1N4RA 2QZAA 4NRHB 3APDA 1ELWA 3ESLA 1Z6TA 1IHGA 1TNZA 4EHMA 2WQHA 3FEXA 4JHRA 2P9IG 2R02A 4IRUA 4Y6CA 1H2VC 3UM2A 4KXKB 3HDXA 1QYMA 4PUCA 3FEYA 5KCMA 4TV3A 1E7VA 3E37A 5BPPA 2PM7A 3LY8A 2WM9A 4AIFA 4PDXA 4YNDA 3LJNA 1IXVA 3OXFA 1HZ4A 1PY1A 2BF0X 2F8XK 4YDYA 5AQ9A 5CMWA 3EIQC 4YDOA 3AS4A 4I6JA 2DBAA 3CHRA 4GZCA 2QC9A 3EJNA 2WMNA 1TNOA 4HOTA 1HE8A 2FEZA 1JCQA 2WXOA 3AG4E 4JB8P 4G26A 3TXMA 2V5QC 3WG7E 2L6BA 3KAEA 5AQBA 4J6IA 1H2UA 1L5JA 2JEKA 1N0QA 1DCEA 3EU5A 5FQ4A 1SA5A 5CHEE 3TWWA 4J0UA 4UI9K 3ML8A 4A55A 2ZGGA 3D3MA 3UT8A 1N9AA 3L13A 2OVBA 4MLPA 3ABKE 1UJKA 3ESKA 5KBAA 2V5FA 3V2OA 2XENA 4WNEA 2Y1LE 1IYGA 3ZU7B 4HOQA 4L2YA 3UKUG 4UWHA 4F7AA 2MOWA 4TXRA 5BV0A 5CMYA 2X6JA 1DVPA 4JVSA 1OXJA 4J8EA 4GMJA 2IOSA 4BERA 1G3NB 1RW2A 3I4GA 2GRPB 4UWLA 2VSNA 4HBDA 1FT2A 2P9KG 4NURA 2OEWA 3ZYLA 2XQ0A 4UI9J 4B89A 3MKQB 4HI9A 5AQ7A 2CHWA 3Q7AA 3CVVA 4A3TA 2P9NG 4DLQA 2X6IA 1NZNA 1AP7A 3FDHA 2QYUA 4U0SA 1K1AA 3U4TA 3FUKA 5JJTA 5G05C 3PH0C 3RRMB 2I6HA 3VLEA 4FC8A 5ENSD 3ONLA 1A5EA 2L0IA 3HXFA 1NL4A 1MHQA 4U63A 3CHOA 4TXPA 2J4DA 2J9QA 3U64A 5HI7A 3HIZA 3TAXA 2UY1B 4GPMA 2ILRA 3CVLA 1U3DA 4UQYA 3G2SA 4FA6A 5BW8C 3R9AB 4LRZA 3TWSA 4F6RD 5EIBE 5ANLA 3QDNA 1QZ2A 4B8AA 4ILIA 3TG4A 4A63B 3JCKC 2VQ2A 4HS2A 3SFZA 4XI0A 4L2LA 1ELRA 3EHRA 2AWIA 5J90A 3ZFWA 3OXGA 4XEIG 2KZTA 1UW4B 5HQ8A 1E90A 2ONDA 2OVFA 4I6EA 1OCRE 2A5UA 4I2WA 3RRUA 1JWFA 1K8KG 3HVEA 4L7TA 5AN8A 4AP2A 3NZUA 4BX8A 2PZIA 4FLBA 4F1PA 3CHSA 3ZIMA 4ANWA 3CHPA 3TXNA 4AY6A 4K5CA 3Q73A 4WNDA 4KVOA 3B7UX 4CRWA 4XKBA 4EZLA 4JA7A 2BUGA 3NAWA 1VDYA 4M3OA 3RAUA 3PNLB 4HB5A 3CVWA 1UN9A 3FULA 5BNWA 1XNFA 4F3VA 1HH8A 3ZN3A 4C9BB 3ZGQA 3ZKJA 4V3IA 3LCAA 2Y4TA 5E75A 3KD7A 2HE0A 2XGSA 4ILGA 1NFIE 5LOZA 2WXKA 3HVEB 3QOUA 4WWPA 4G11A 3GZSA 4UWFA 4U07A 3J5QB 4CGWA 5FZRA 4DX6D 5A7DB 3HXCA 4FADA 1SA4A 5ARGA 4IN3B 4BT9A 2DZNA 3V31A 4B8CB 2WXJA 2KXPC 2NC9A 4YDEA 4LSZE 4PS8A 3GYZA 4QQIA 3RKVA 2VTBA 3SI5A 3UI2A 1U3CA 4N2SA 3QKYA 3CK8A 4GZ6A 3CIAA 4NACA 3PZDA 3IKOB 4EZKA 1H19A 5EYPF 5FTPA 3B7RL 4K0RA 3UPVA 4DX5D 2J49A 3DBSA 3E33A 4A3VA 2H6IA 3DEPA 2GRMA 2KCKA 3LVQE 1JPLA 1QQEA 2R5SA 3HXBA 4Q94A 4UQXA 4CT4A 2AXUA 4GCNA 3CV0A 5ENTD 3FUDA 3T5VA 4QFVA 4ANVA 3DSXA 1JCSA 4W9RA 4FJZA 3C5RA 1MQSA 2L9BA 3FTVA 3ZEFA 3ABME 3I4RB 4WNFA 4ZHBA 2KM4A 5CCLA 2NSZA 3B13A 5KJMA 4HLLA 5FZSA 3U66A 2R2LA 1DCQA 5CCMA 2VGXB 5LCWJ 1H6KA 4KT6B 5FQ8A 3CHMA 1SVXA 3FU3A 5AYWD 1BU9A 2OV8A 2LUHA 2IJGX 2IF4A 3MYVA 4FLHA 1E8ZA 1N4QA 4HOUA 4Y6WA 4WUYA 1QBQA 1ZU2A 3CHQA 4B93B 3ZUVB 1Q2ZA 3C3QA 2WXGA 4KZCA 4JHJA 1Y8MA 2LSVA 4U04A 1FVFA 3MJWA 2EIJE 4JEUA 4M7CA 4DUIA 2LAIA 2GRRB 1WDYA 2EILE 4HFGA 3UM1A 3CVUA 2BKKB 2QFCA 3UM3A 3LVRE 3LYAA 3R9MA 5EYLA 2P9SG 4OAUC 3FU6A 4PH4B 2WXNA 1FPPA 4A1SA 2EIME 4HORA 2A5EA 3J5PA 2XCCA 1JCRA 5ANRA 3ASHA 4HXIA 2VGYA 5EN5D 2MHKA 3AU5A 1TNBA 4CGVA 4GTMA 4DX2A 3FUHA 1XGWA 1E8YA 3FU5A 3AG1E 4YVQC 4U8HA 1LF8A 2ZISA 4LUNU 4HQDA 5JA4D 3V79K 5KJKA 3EU9A 4F1SA 1SW6A 1E7UA 3LPZA 3ULEG 4LNUD 2L6JA 1RZ4A 3IV0A 4I9CA 2XS8A 4RG6A 2WB2A 3UMVA 5AAOA 1INZA 5KNHD 4DRXE 5JJ6A 3SFXA 1MZCA 1BI7B 3C3RA 1IKND 1MJ0A 2C0LA 4G8LA 4K03A 3UX4A 4XE0A 3ZYKA 1HS6A 2I1KA 2KCVA 3UT7A 1NP7A 2P9PG 4BEPA 4N5QA 2QY7A 1TNUA 2BTDA 3MZLB 4HRLA 1NA3A 4AXHA 4XIFA 3CVXA 1KZOA 4OVUA 2GW1A 3ZW3A 4TUMA 4O6FA 3FY4A 4GYWA 3Q75A 4GU5A 1E8XA 3DXKG 1N4PA 4I17A 4JHKA 1TN8A 3E30A 1BPOA 2F8YA 1DNPA 4GA0A 3CQCB 5B1BE 3GW4A 4AY5A 2RFMA 2ZIRA 3TWTA 4A1GA 5HS0A 5T8IA 3FHEA 3PEUB 2NXPA 5CERB 2R03A 1TN6A 4L1BA 1YYHA 2XGMA 4J8FA 5EX3A 2P9UG 2OCCE 3DSVA 1D9SA 2IY0C 4YVOA 3CKBA 2L0TB 4ABNA 4GTTA 1SQMA 3TWVA 2X3MA 4U95D 3CGHA 4FULA 4UUCA 3DPYA 4GZ3A 2WXLA 2RFAA 4WWOA 2XHEA 1Z5SC 2GRNB 5ENNA 4APFA 1N54A 4K5BA 3D9HA 4RLYA 3ZYQA 3URZA 2P2CP 3T8KA 5AJLA 4E85A 4G2VA 5ENOD 3FTSA 1WY6A 3I3NA 4AVXA 3L6AA 2Y69E 4DX1A 1S64A 2V0PA 3UQ3A 2XEEA 4B94A 4D10C 4MBGA 3SF4A 3ZXPA 2FO7A 4GMRA 3S7JA 4GTOA 3QB2A 4JC8A 4DI3A 4G1TA 4FU3A 2H6GA 3Q15A 2J4BA 4O60A 2Y4UA 2HM8A 3BEEA 3V30A 3P2BA 2FF4A 1E8WA 1HF8A 3CSFA 2IFUA 4EBAG 4UWGA 2DZOA 4KMOA 4TXQA 3NBNB 3ZXSA 4TRQA 2YINA 3ZNGA 4NIKA 4WNGA 1S63A 4N3CA 1SZAA 3C72A 4CT0A 3L17A 4GCOA 4JW1A 1JWGA 2PL2A 5KNGA 2I2OA 1ZBPA 4U0ZA 2XCBA 4RQIA 1N52A 3GZ2A 2KBXA 3ZYMA 4GMLA 2BKGA 3MCXA 3ZHEA 1WAO1 1OCCE 4U96D 5J08A 1O1SA 3BG1B 5ARFA 3FUNA 3B7TA 4UQZA 2R17C 4ACKA 2YNQA 1N94A 3C3OA 2I1JA 3JUIA 5A23A 3CLJA 3E4BA 2WXFA 4L23A 4EPZA 4G25A 4HRNA 3FUIA 2HO1A 3W9FA 4I43A 4GA2A 3RIBA 4EZJA 3C98A 3TL5A 5T4YA 4DK5A 3ZHEB 4U7EB 3D9NA 4F53A 3ZVVA 4DJAA 3JUEA 3UIOC 1LD7A 4CZ2D 3BUAA 3EDTB 5D2MC 4G24A 3SFYA 3R7RA 2PM6A 2HYZA 3SD5A 2KZTB 1Y6IA 4GTRA 4GA1A 3E32A 3NOGD 5FQ6A 3FUJA 3PS6A 1SZ9A 4CDNA 1S70B 2VSYA 3FTXA 4GZDA 3JXJA 3Q5MA 3TG5A 3FUMA 4BWRA 4H7YA 4URKA 3FUFA 3FH5A 2FBNA 5FJYA 2HR2A 4UWKA 2FULA 5BT1A 4GZ5A 3ULQA 4CEMA 1X5BA 4DLOA 5LFAA 3APCA 1OWNA 5HKPA 3PE3A 3PUKA 1V55E 3D9LA 4N3BA 2XEHA 3OTNA 4APOA 3PZ4A 1B89A 4EQFA 4DPRA 5G04J 3NOCD 3VTXA 3ZPJA 3PZ1A 4BTBA 1TYQG 4U0UA 4G23A 2IO2C 2X6FA 2R59A 1YMPA 3UIPC 3SBSA 3FTUA 4BT8A 3AS8A 4AEZC 3S7FA 3VLFA 1WG0A 3Q9NC 2GRQB 3CVPA 2ZGDA 3ASNE 4MKTA 3B7SA 2KC7A 4KBQA 5C2YA 2WQ7A 2RKKA 3F6QA 3ASDA 2VTBB 5C1DA 2B6CA 4JA9A 3EHMA 2JABA 3HRAA 3L22A 3SHFA 4U8YD 5A6CA 1IQUA 5EIDA 1YCSB 3SZ7A 3EHQA 3QWPA 3UTMA 4X8QA
chains in the Genus database with same CATH topology
2AVPA 3LPZA 3APFA 2WMOA 2L6JA 3FWVA 3IV0A 4I9CA 2XPIA 4RG6A 2WB2A 3UMVA 1INZA 4OYSA 2IU1A 2ZU6B 3I4GA 3ENEA 4MRUA 4UWLA 2VSNA 5JJ6A 3CKCA 1TEZA 1KLXA 4BSXA 2E2EA 4EECA 2C0LA 3UX4A 4K03A 4XE0A 4RSYA 4NURA 1TJCA 3ASFA 3ZYKA 3ZYLA 3O48A 1HS6A 2XQ0A 2I1KA 2X38A 3HYMB 4UI9J 4B89A 4BFRA 2KCVA 3LY7A 3MKQB 3UT7A 1NP7A 3D9OA 2CHWA 1PAQA 2J07A 3FP3A 3CVVA 3WXXA 2QY7A 4MS6A 4A3TA 4AJWA 4DLQA 2BTDA 2X6IA 3MZLB 4I1MA 4AV7A 3K9IA 1NZNA 4J8DA 1NA3A 2X6HA 3FDHA 2UWJG 4UI9C 4AXHA 4U0SA 3EHNA 3LJ3A 3MGBA 4XIFA 3LKUA 3FTYA 4NQ0A 3U4TA 3CVXA 4HLEA 3CVYA 3FUKA 4OVUA 5JJTA 2GW1A 5G05C 2V8SE 5KJNA 4I6GA 3ZW3A 3PH0C 3RRMB 4O6FA 3FY4A 2I6HA 3D9IA 3CSTA 4GYWA 1JUQA 4GU5A 1HXIA 3U3WA 1NA0A 1E8XA 3VLEA 2IOLA 4FC8A 1TJFA 4N2QA 3MKRA 3ONLA 2WXHA 3PNTB 4CCAA 3PRZA 4I17A 2A4ZA 4JHKA 4RG9A 2XGOA 2L0IA 3LEWA 1BPOA 4N3AA 3MV3B 1MHQA 3EIJA 4U63A 3CHOA 1DNPA 1FVHA 4GA0A 2VYIA 2J4DA 4XKCA 3CQCB 4ANXA 2J9QA 3U64A 3GW4A 4WWNA 2C2LA 4OVVA 4AY5A 4PS3A 4IYPA 5HI7A 1EPUA 3Q47B 4XZ4A 3HIZA 3TAXA 4A1GA 5T8IA 2UY1B 3FHEA 3PEUB 2DCPA 4FHKA 2NXPA 2ILRA 1S0PA 1U3DA 3CVLA 3ZRHA 4ANUA 3QWVA 3MA5A 3G2SA 4I9EA 4UQYA 4L1BA 4FA6A 5BW8C 2J09A 3QNKA 3R9AB 2RG8A 4LRZA 2GRLA 4BTAA 2AW6A 2XGMA 3PUJA 4Q69A 2C0MA 3IHYA 2VSOE 3SNXA 5JHBA 3T8MA 4IULA 5M72A 4J8FA 1H0AA 3QC1A 5EX3A 5ANLA 3QDNA 1E7UA 3Q4AB 1QZ2A 2KATA 2XPZA 2LAHA 4YVOA 4B8AA 1UN8A 4ILIA 3TG4A 3ASGA 3CKBA 2AXZA 3JCKC 2VQ2A 3IBEA 4HS2A 3SFZA 3LS8A 4XI0A 4L2LA 1YA0A 2L0TB 4N5CA 4ABNA 4RVBA 4EBAA 1SQMA 3PREA 2IONA 3N71A 2CG2A 2WPVA 1ELRA 2X3MA 2WXMA 4J8SA 3RO3A 3CGHA 4FULA 2AXVA 2AWIA 5J90A 4GZ3A 1HX8A 3ZFWA 3RK6A 2WXLA 4B0ZA 4LEUA 3OXGA 4WWOA 2XHEA 2KZTA 5ENNA 1UW4B 5HQ8A 1E90A 4APFA 4E6HA 1N54A 2ONDA 2YHEA 2VGXA 2OVFA 3PVLA 4I6EA 3ZYQA 2M63A 3URZA 2A5UA 3LXUX 5AJLA 4I2WA 3RRUA 2OOEA 3UUXA 1JWFA 4E85A 4G2VA 1OWLA 3HVEA 4FJYA 4L7TA 3FTSA 1WY6A 2FI7A 1WM5A 3I3NA 3NZUA 4AP2A 4AVXA 2PZIA 3L6AA 4BX8A 4FLBA 3CHSA 4I2ZA 2V0PA 3ZIMA 4ANWA 5BUZA 5LP0A 4H7XA 3UQ3A 3MV2B 3CHPA 1Z3YA 4B94A 3TXNA 4D10C 3CQGB 4AY6A 3SF4A 3CK7A 3NF1A 4I1AA 1EYHA 4WNDA 2Q7FA 2FO7A 4KVOA 3B7UX 4CRWA 4XKBA 5FZQA 4EZLA 2XRYA 3S7JA 4JA7A 2BUGA 2YHCA 3TGOA 3QB2A 1VDYA 4JC8A 1A17A 4M3OA 4DI3A 3GZ1A 3RU0A 4G1TA 4FU3A 3PNLB 3OAWA 3Q15A 4KVMA 3CVWA 1UN9A 3FULA 4ATGA 1XNFA 4F3VA 3FH7A 5BNWA 3PDNA 2J4BA 1HH8A 4KZ0A 3ZN3A 4C9BB 5LX8A 2Y4UA 5G05J 3ZGQA 2WXQA 1PC2A 2HM8A 3BEEA 3VLDA 4V3IA 3G2VA 2XEVA 3P2BA 2FF4A 1E8WA 1HF8A 3LCAA 3CSFA 2IFUA 4EBAG 2WQ6A 2Y4TA 4TUUA 4UWGA 4KMOA 5E75A 3KD7A 2WVIA 4JXTA 2XGSA 3D9KA 4ILGA 3ZXSA 5LOZA 4TRQA 2YINA 2WXKA 3HVEB 5AJDA 3ONKA 3QOUA 4WWPA 4G11A 4WNGA 3GZSA 4C0EA 1OWPA 2CFZA 3FFLA 4CDMA 4UWFA 3Q49B 3IEGA 4N3CA 2X6KA 1SZAA 3S7BA 4U07A 4CT0A 3AU4A 4CGWA 3I5PA 5FZRA 5A7DB 3IHVA 3L17A 4FADA 5ARGA 4GCOA 4IN3B 2LSUA 4JW1A 1JWGA 2PL2A 4BT9A 5EDSA 4N39A 4B8CB 2KCLA 4Q96A 2I2OA 1ZBPA 2WXJA 5FWQA 4U0ZA 3QARA 5T3RA 3RO2A 2EQXA 2NC9A 2IQCA 1P5QA 2XCBA 3G2TA 1Z3XA 3BG0B 1N52A 3GZ2A 4WAFA 4PS8A 3JQ1A 3S2AA 3GYZA 3RKVA 4PS7A 2VTBA 3P1UA 4JEHA 4LERA 4GMLA 3ZYMA 3SI5A 4BY6A 2CHXA 2CG3A 4BX9A 2XRZA 1U3CA 3MCXA 2XPYA 4N2SA 3QKYA 5DIZA 3CEQA 1HU3A 3D9PA 3CK8A 3O4ZA 4I1OB 1WAO1 4GZ6A 3ZHEA 2LO6A 4FHJA 3CIAA 4NACA 3PZDA 5J08A 2PQRA 1KT1A 3IKOB 4EZKA 3BG1B 4XI9A 1H19A 5ARFA 2I9CA 3FUNA 4GAAA 3T5XA 3KS2A 3B7TA 3CR3A 4XX5A 5FTPA 1OUVA 4UQZA 2P58C 2R17C 4ACKA 2RD0A 1E96B 2YNQA 3B7RL 5G04C 4K0RA 4ACLA 1KT0A 3CK9A 3TJPA 4KYOB 3UPVA 2J49A 4AOFA 3DBSA 1W3BA 5G2NA 2JLBA 1UJJA 2I1JA 3D9JA 3R7QA 3JUIA 4A3VA 3JQ0A 4GB9A 5A23A 3CLJA 3E4BA 3FH8A 3D9MA 1EDUA 2WXFA 3FU0A 2GRMA 2KCKA 4L23A 3LVQE 1JPLA 1QQEA 4ME2A 2R5SA 4CDRA 4EPZA 5D0OD 4Q94A 4G25A 4UQXA 3SBTB 4CT4A 2VJ8A 2WXIA 2AXUA 4GCNA 3CV0A 1IQRA 1HG5A 2LNIA 5DBKA 3NQPA 3FUDA 5D0QD 3FUIA 3T5VA 2HO1A 1HO8A 4QFVA 4ANVA 4I43A 4GA2A 3MKQA 3RIBA 3FTWA 4EZJA 4W9RA 2GGFA 3C98A 1HFAA 4FJZA 4JL0A 5T4YA 3TL5A 1EF1C 4DK5A 5JHAA 4GPKA 1MQSA 2L9BA 3ZHEB 3RJVA 1FCHA 5FQ7A 3FTVA 5AENA 4HOSA 3LDZA 4LCTA 3ZEFA 3NZSA 3D9NA 4F53A 3QK0A 3I4RB 2WXRA 4WNFA 3S7DA 4GYOA 3ZVVA 4DJAA 2CHZA 3VTYA 2DIWA 2KM4A 3G2WA 3QWWA 3PE4A 5EKQD 5CCLA 3CVNA 4JPSA 3DPDA 2NSZA 3EDTB 3B13A 5FT9A 4NRHB 4G24A 5KJMA 3APDA 1ELWA 5FZSA 3U66A 3ESLA 3L16A 3R7RA 1Z6TA 2PM6A 1IHGA 3MEKA 2HYZA 3SD5A 3MX3A 2KZTB 2WQHA 3FEXA 1Y6IA 4GA1A 4JHRA 4IRUA 5CCMA 3JYSA 3KEZA 4Y6CA 2VGXB 3UT4A 5LCWJ 1H2VC 1H6KA 2MRIA 5FQ6A 4KT6B 2PQNA 4KXKB 5FQ8A 3HDXA 3FUJA 4PUCA 3CHMA 1SZ9A 3PS6A 4CDNA 3FEYA 5KCMA 3CVQA 2VSYA 3FTXA 4GZDA 4TV3A 1E7VA 3FU3A 3Q5MA 5BPPA 2PM7A 3LY8A 3TG5A 2WM9A 1H2TC 5AYWD 4AIFA 5LCWC 2UY1A 3FUMA 4PDXA 4H7YA 4BWRA 4URKA 3FUFA 3OXFA 4YNDA 1HZ4A 2OV8A 3FH5A 4HVBA 3FTZA 1PY1A 2BF0X 2FBNA 5FJYA 2HR2A 3G2UA 3QAQA 4UWKA 2FULA 2IJGX 3ML9A 5KJLA 2IF4A 3MYVA 5BT1A 4FLHA 4GZ5A 1E8ZA 3ULQA 4CEMA 4HOUA 5CMWA 1X5BA 3EIQC 3U9WA 4DLOA 3AS4A 4Y6WA 5LFAA 4WUYA 3APCA 4JZYA 4I6JA 1ZU2A 3CHQA 1OWNA 2WXGA 4KZCA 4JHJA 1GW6A 2DBAA 1Y8MA 3CHRA 3PE3A 2LSVA 4GZCA 4U04A 3PUKA 3EJNA 2WMNA 3D9LA 1FVFA 3MJWA 5E76A 4N3BA 2J08A 4JEUA 3FUEA 4HOTA 1HE8A 2FEZA 2V4LA 3AS5A 1OWMA 2LAIA 2WXOA 2CFUA 4R7LA 3OTNA 4APOA 4HFGA 4G26A 3TXMA 1B89A 5EX0A 3CVUA 2E0IA 4EQFA 4AM9A 3KAEA 4DPRA 3LY9A 2QFCA 4FP7A 3LVRE 4J6IA 5G04J 3VTXA 1H2UA 3LYAA 3ZPJA 1L5JA 4DI4A 4BTBA 3OXLA 2JEKA 4U0UA 4G23A 2YQ8A 3FU6A 2X6FA 2R59A 4BT8A 5G55A 3FTUA 3SBSA 4PH4B 5FQ4A 3RRNB 5BV1A 2WXNA 3AS8A 4AEZC 3S7FA 5CHEE 3VLFA 4A1SA 4J0UA 3CVPA 4UI9K 3ML8A 4HORA 4A55A 1ELKA 1QNFA 3D3MA 4MKTA 3UT8A 3B7SA 4C0MA 2XCCA 2KC7A 1UG3A 4KBQA 5C2YA 5JJ7A 5ANRA 3ASHA 2OVBA 3L13A 4HXIA 4MLPA 2WQ7A 3ASDA 1UJKA 2VGYA 3PEVB 2MHKA 3ESKA 4GYYA 4P29A 2VTBB 3AU5A 5C1DA 2V5FA 2Y3AA 4JA9A 3EHMA 4WNEA 1IYGA 3L22A 4CGVA 4HOQA 4ILHB 3HHMA 4L2YA 3L54A 3FUHA 3SHFA 3QJZA 2WXPA 5A6CA 1XGWA 1E8YA 4UWHA 1IQUA 3FU5A 4F7AA 2MOWA 4YVQC 5BV0A 4U8HA 1OWOA 3SGHA 5CMYA 5AIJA 2VSXE 1LF8A 3L08A 2X6JA 1DVPA 3SZ7A 4LUNU 4JVSA 1HG2A 3QWPA 5KJKA 4J8EA 4F1SA 4GMJA 2IOSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AVP A;  3LPZ A;  2L6J A;  3FWV A;  4I9C A;  2XPI A;  4RG6 A;  2VSN A;  5JJ6 A;  3CKC A;  1KLX A;  2E2E A;  2C0L A;  1TJC A;  3ASF A;  3O48 A;  3HYM B;  4UI9 J;  2KCV A;  3LY7 A;  3FP3 A;  3WXX A;  3K9I A;  1NZN A;  4J8D A;  1NA3 A;  2UWJ G;  4UI9 C;  4U0S A;  4XIF A;  3LKU A;  4NQ0 A;  3U4T A;  5JJT A;  2GW1 A;  5G05 C;  5KJN A;  4O6F A;  2I6H A;  4GYW A;  1HXI A;  3U3W A;  1NA0 A;  4N2Q A;  3MKR A;  4I17 A;  4RG9 A;  2XGO A;  4N3A A;  3MV3 B;  4GA0 A;  2VYI A;  2J9Q A;  3GW4 A;  2C2L A;  4AY5 A;  5HI7 A;  3Q47 B;  3TAX A;  2UY1 B;  3CVL A;  3QWV A;  3MA5 A;  4I9E A;  4UQY A;  5BW8 C;  3R9A B;  4BTA A;  2XGM A;  2C0M A;  5M72 A;  4J8F A;  5EX3 A;  3QDN A;  3Q4A B;  1QZ2 A;  2KAT A;  4YVO A;  3TG4 A;  3ASG A;  3CKB A;  2VQ2 A;  4XI0 A;  1YA0 A;  4N5C A;  4ABN A;  3N71 A;  2WPV A;  1ELR A;  3RO3 A;  4GZ3 A;  3ZFW A;  4LEU A;  3OXG A;  5HQ8 A;  2OND A;  2VGX A;  3URZ A;  4I2W A;  2OOE A;  3UUX A;  4G2V A;  2FI7 A;  1WM5 A;  2PZI A;  4I2Z A;  4H7X A;  3UQ3 A;  3MV2 B;  4B94 A;  4AY6 A;  3SF4 A;  3CK7 A;  3NF1 A;  4I1A A;  4WND A;  2Q7F A;  2FO7 A;  5FZQ A;  3S7J A;  4JA7 A;  2BUG A;  2YHC A;  3TGO A;  1A17 A;  3GZ1 A;  3RU0 A;  4G1T A;  3Q15 A;  5BNW A;  1XNF A;  4F3V A;  3PDN A;  1HH8 A;  3ZN3 A;  2Y4U A;  5G05 J;  3ZGQ A;  1PC2 A;  3BEE A;  2XEV A;  2FF4 A;  3LCA A;  2IFU A;  2Y4T A;  3KD7 A;  2XGS A;  3QOU A;  4WNG A;  3FFL A;  3Q49 B;  3IEG A;  4N3C A;  3S7B A;  4U07 A;  4CGW A;  5FZR A;  5A7D B;  5ARG A;  4GCO A;  4IN3 B;  2LSU A;  2PL2 A;  4BT9 A;  4N39 A;  2KCL A;  1ZBP A;  4U0Z A;  3RO2 A;  2NC9 A;  2XCB A;  1P5Q A;  3GZ2 A;  3GYZ A;  3RKV A;  4N2S A;  3QKY A;  5DIZ A;  3CEQ A;  3CK8 A;  3ZHE A;  1WAO 1;  4GZ6 A;  2PQR A;  1KT1 A;  4XI9 A;  5ARF A;  3KS2 A;  5FTP A;  1OUV A;  4UQZ A;  2P58 C;  1E96 B;  5G04 C;  1KT0 A;  3CK9 A;  3UPV A;  4KYO B;  1W3B A;  2JLB A;  3E4B A;  2KCK A;  1QQE A;  4ME2 A;  2R5S A;  4CDR A;  5D0O D;  4G25 A;  4UQX A;  4GCN A;  3CV0 A;  2LNI A;  5DBK A;  5D0Q D;  2HO1 A;  4GA2 A;  3RIB A;  4W9R A;  4JL0 A;  4GPK A;  3ZHE B;  3RJV A;  1FCH A;  4HOS A;  4WNF A;  3S7D A;  4GYO A;  3VTY A;  3QWW A;  5CCL A;  5EKQ D;  3PE4 A;  3CVN A;  3EDT B;  5FT9 A;  4NRH B;  4G24 A;  5KJM A;  1ELW A;  5FZS A;  1IHG A;  3MEK A;  2HYZ A;  2WQH A;  4GA1 A;  4JHR A;  5CCM A;  3JYS A;  4Y6C A;  2VGX B;  5LCW J;  2PQN A;  4KXK B;  3CVQ A;  2VSY A;  3Q5M A;  3LY8 A;  3TG5 A;  5AYW D;  4AIF A;  5LCW C;  2UY1 A;  4BWR A;  4H7Y A;  4YND A;  3OXF A;  1HZ4 A;  2FBN A;  5FJY A;  2HR2 A;  5KJL A;  2IF4 A;  5BT1 A;  4GZ5 A;  3ULQ A;  4HOU A;  3AS4 A;  4Y6W A;  4WUY A;  1ZU2 A;  2DBA A;  1Y8M A;  3PE3 A;  2LSV A;  4U04 A;  4N3B A;  4HOT A;  2FEZ A;  3AS5 A;  4APO A;  4G26 A;  1B89 A;  5EX0 A;  4EQF A;  4AM9 A;  3KAE A;  3LY9 A;  2QFC A;  5G04 J;  3VTX A;  3ZPJ A;  3LYA A;  4BTB A;  3OXL A;  4U0U A;  4G23 A;  2YQ8 A;  4BT8 A;  3AS8 A;  3S7F A;  5CHE E;  4A1S A;  4J0U A;  3CVP A;  4UI9 K;  4HOR A;  2XCC A;  2KC7 A;  4KBQ A;  5JJ7 A;  3ASH A;  3ASD A;  2VGY A;  4GYY A;  2MHK A;  3ESK A;  5C1D A;  2V5F A;  4JA9 A;  4WNE A;  1IYG A;  4CGV A;  4HOQ A;  5A6C A;  4YVQ C;  3SZ7 A;  3QWP A;  5KJK A;  4J8E A; 
#chains in the Genus database with same CATH topology
 3APF A;  4YDW A;  5AQA A;  3ENE A;  3HXE A;  4MRU A;  3CKC A;  3AG3 E;  1KLX A;  2E2E A;  4EEC A;  1TJC A;  3O48 A;  2DWZ A;  1MYO A;  3HYM B;  1MX6 A;  1PAQ A;  3FP3 A;  1BLX B;  4MS6 A;  4I1M A;  4AV7 A;  3K9I A;  4J8D A;  2X6H A;  2UWJ G;  4UI9 C;  2Y0B G;  3EHN A;  3LJ3 A;  3MGB A;  3FTY A;  3UM0 A;  2LXL A;  2V8S E;  5KJN A;  3CST A;  1JUQ A;  1HXI A;  1NA0 A;  2IOL A;  4N2Q A;  4CCA A;  3PNT B;  1O5M A;  3PRZ A;  2A4Z A;  2XGO A;  3LEW A;  4N3A A;  2VYI A;  4XKC A;  4WWN A;  3Q78 A;  4PS3 A;  4IYP A;  3Q47 B;  3UIN C;  5H7P A;  5CRU A;  2DCP A;  4FHK A;  4ANU A;  3QWV A;  3MA5 A;  2J09 A;  2RG8 A;  2AW6 A;  3IHY A;  3JXI A;  3SNX A;  5JHB A;  3RSE G;  3T8M A;  4IUL A;  5M72 A;  1H0A A;  4U8V D;  3AAA C;  3Q4A B;  2XPZ A;  2LAH A;  2AXZ A;  5CBN A;  1YA0 A;  4EBA A;  3PRE A;  2ION A;  1KPS B;  2CG2 A;  2WPV A;  2WXM A;  1OCO E;  5CEA A;  3RO3 A;  3DSU A;  3RK6 A;  4LEU A;  5CRV A;  1MX4 A;  2YHE A;  3PVL A;  3DSW A;  4GTP A;  3DEO A;  4FJY A;  4C48 B;  4I2Z A;  4H7X A;  3CQG B;  3CK7 A;  4JD2 G;  5FZQ A;  2XRY A;  3TGO A;  3DRA A;  1A17 A;  3GZ1 A;  2ZXW E;  3OAW A;  4KVM A;  4ATG A;  1KZP A;  3FH7 A;  3PDN A;  4KZ0 A;  5LX8 A;  1PC2 A;  1X81 A;  1LTX A;  3G2V A;  2XEV A;  2WQ6 A;  2WVI A;  2OEV A;  2DYS E;  4LNG A;  4C0E A;  2CFZ A;  3IXE A;  3Q49 B;  2MYO A;  2EIN E;  2X6K A;  3AU4 A;  2LSU A;  2R05 A;  4N39 A;  5BXU A;  4Q96 A;  5FWQ A;  3Q79 A;  3RO2 A;  2EQX A;  3W9G A;  3BU8 A;  3G2T A;  1Z3X A;  3L9T A;  4GTS A;  3JQ1 A;  2XS1 A;  3KSQ A;  3P1U A;  4BY6 A;  2CHX A;  2B0O E;  4BX9 A;  2XRZ A;  3CEQ A;  1HU3 A;  3D9P A;  4I1O B;  3O4Z A;  4O1P A;  4HI8 A;  2LO6 A;  5CEC B;  2PQR A;  1KT1 A;  2VGE A;  4XI9 A;  2I9C A;  3T5X A;  4GAA A;  3KS2 A;  3CR3 A;  1OUV A;  2P58 C;  2RD0 A;  1E96 B;  5G04 C;  3PZ2 A;  4KYO B;  2QYJ A;  5ENQ D;  3SQV A;  4AOF A;  1W3B A;  5G2N A;  2JLB A;  3D9J A;  2F0Y A;  1DC2 A;  3D9M A;  3SO8 A;  4ME2 A;  2ETB A;  5D0O D;  4ZFH A;  2VJ8 A;  1IQR A;  1HG5 A;  2LNI A;  3NQP A;  5D0Q D;  4GTV A;  3MKQ A;  2PNN A;  2GGF A;  4JL0 A;  5JHA A;  1EF1 C;  4GPK A;  4HOS A;  5FQ7 A;  5AEN A;  3LDZ A;  3NZS A;  2WXR A;  2EIK E;  4BET A;  3B7B A;  2CHZ A;  5EKQ D;  1V54 E;  4JPS A;  5FT9 A;  2AJA A;  5FIO A;  3L16 A;  3MEK A;  3MX3 A;  1ZB1 A;  3JYS A;  3KEZ A;  3UT4 A;  2MRI A;  2PQN A;  3CVQ A;  1H2T C;  3T9K A;  5LCW C;  2UY1 A;  3DSS A;  3KEA A;  4HVB A;  3FTZ A;  1TNY A;  1N4S A;  5BXO A;  3G2U A;  3QAQ A;  5IY5 E;  1K1B A;  3ML9 A;  5KJL A;  3AJI A;  3U9W A;  4DX7 D;  5D66 A;  4JZY A;  4HNA D;  4BES A;  4CYM D;  1GW6 A;  4L9P A;  3TWR A;  5E76 A;  2J08 A;  3FUE A;  5ITZ F;  2V4L A;  3AS5 A;  1OWM A;  2V4H C;  2CFU A;  4R7L A;  2XZT G;  5ENR D;  5EX0 A;  2E0I A;  4AM9 A;  3LY9 A;  1TN7 A;  4FP7 A;  3ASO E;  4DI4 A;  3BQO A;  3OXL A;  1U2V G;  2YQ8 A;  1FT1 A;  5G55 A;  3RRN B;  5BV1 A;  1N11 A;  5B1A E;  2DYR E;  2IEJ A;  1ELK A;  1LD8 A;  1QNF A;  4C0M A;  1UG3 A;  5JJ7 A;  4GYY A;  3PEV B;  4P29 A;  2BED A;  2Y3A A;  4ILH B;  3HHM A;  3L54 A;  3QJZ A;  2WXP A;  2FO1 E;  5AIJ A;  1OWO A;  3SGH A;  5CBO A;  2VSX E;  3L08 A;  5KWD A;  1HG2 A;  2DVW A;  2AVP A;  1BI8 B;  2WMO A;  3FWV A;  2XPI A;  4OYS A;  2IU1 A;  2ZU6 B;  1OT8 A;  1NI1 A;  1TEZ A;  4BSX A;  4RSY A;  2J8S D;  3TWU A;  3ASF A;  2X38 A;  4BFR A;  3LY7 A;  3UXG A;  3D9O A;  2J07 A;  3V2X A;  3Q9U C;  3WXX A;  4AJW A;  3KSL A;  5EIL A;  1D8D A;  3Q7F A;  1K3Z D;  3HXD A;  3LKU A;  4NQ0 A;  2LXM A;  4HLE A;  3CVY A;  4I6G A;  3EUV A;  3E34 A;  3D9I A;  3U3W A;  2ETA A;  1TJF A;  3MKR A;  2WXH A;  4RG9 A;  2XZD G;  4GTQ A;  3MV3 B;  3EIJ A;  1O1T A;  1FVH A;  4ANX A;  2C2L A;  4OVV A;  1EPU A;  4XZ4 A;  1MX2 A;  1S0P A;  3ZRH A;  1D8E A;  4I9E A;  3ISM C;  1H6P A;  4Z68 A;  3QNK A;  4BTA A;  2GRL A;  4Q69 A;  3PUJ A;  2C0M A;  5FIN A;  2VSO E;  2H6H A;  1H6O A;  3QC1 A;  3TWX A;  2KAT A;  1UN8 A;  3ASG A;  2P9L G;  1OY3 D;  3IBE A;  3LS8 A;  4N5C A;  4RVB A;  4K5A B;  3PZ3 A;  1UOH A;  2F37 A;  3N71 A;  4J8S A;  2AXV A;  1HX8 A;  4B0Z A;  3DWL G;  5JMN D;  4E6H A;  2VGX A;  2IO3 C;  2H6F A;  2M63 A;  3LXU X;  5HRY A;  2OOE A;  3UUX A;  1OWL A;  2FI7 A;  1WM5 A;  5BUZ A;  5LP0 A;  3MV2 B;  3DXM G;  1Z3Y A;  3NF1 A;  4I1A A;  1EYH A;  2Q7F A;  2YHC A;  4LG6 A;  3RU0 A;  5G05 J;  1IHB A;  2WXQ A;  4ATZ D;  3VLD A;  4TUU A;  4JXT A;  3D9K A;  4J7W A;  5AJD A;  3ONK A;  1OWP A;  3FFL A;  4CDM A;  4LNB A;  5AAR A;  1AWC B;  3IEG A;  3S7B A;  3I5P A;  3IHV A;  1BD8 A;  3ULY A;  2ETC A;  5EDS A;  4OAV B;  2KCL A;  3DST A;  3ABL E;  4BSZ B;  3QAR A;  5T3R A;  2IQC A;  1P5Q A;  3BG0 B;  3AG2 E;  4WAF A;  3B95 A;  3S2A A;  3X2Q E;  4PS7 A;  4LER A;  4JEH A;  2CG3 A;  5B3S E;  1OCZ E;  2XPY A;  5DIZ A;  3SY2 A;  3TWQ A;  1O1R A;  4FHJ A;  5ENP D;  4XX5 A;  4J8Y A;  3HG0 D;  4HRM B;  4ACL A;  1KT0 A;  2GRO B;  3CK9 A;  4G8K A;  3TJP A;  1N95 A;  3L82 A;  1UJJ A;  3R7Q A;  3JQ0 A;  1TR4 A;  4GB9 A;  3FH8 A;  3FU0 A;  1EDU A;  4O1O A;  4CDR A;  3SBT B;  2WXI A;  5DBK A;  1HO8 A;  2NYJ A;  3FTW A;  3NB2 A;  1HFA A;  3RJV A;  1FCH A;  5CED B;  4LCT A;  3QK0 A;  3S7D A;  1N0R A;  4GYO A;  3VTY A;  2DIW A;  3G2W A;  3QWW A;  3PE4 A;  3CVN A;  3DPD A;  3UKR G;  1N4R A;  2QZA A;  4NRH B;  3APD A;  1ELW A;  3ESL A;  1Z6T A;  1IHG A;  1TNZ A;  4EHM A;  2WQH A;  3FEX A;  4JHR A;  2P9I G;  2R02 A;  4IRU A;  4Y6C A;  1H2V C;  3UM2 A;  4KXK B;  3HDX A;  1QYM A;  4PUC A;  3FEY A;  5KCM A;  4TV3 A;  1E7V A;  3E37 A;  5BPP A;  2PM7 A;  3LY8 A;  2WM9 A;  4AIF A;  4PDX A;  4YND A;  3LJN A;  1IXV A;  3OXF A;  1HZ4 A;  1PY1 A;  2BF0 X;  2F8X K;  4YDY A;  5AQ9 A;  5CMW A;  3EIQ C;  4YDO A;  3AS4 A;  4I6J A;  2DBA A;  3CHR A;  4GZC A;  2QC9 A;  3EJN A;  2WMN A;  1TNO A;  4HOT A;  1HE8 A;  2FEZ A;  1JCQ A;  2WXO A;  3AG4 E;  4JB8 P;  4G26 A;  3TXM A;  2V5Q C;  3WG7 E;  2L6B A;  3KAE A;  5AQB A;  4J6I A;  1H2U A;  1L5J A;  2JEK A;  1N0Q A;  1DCE A;  3EU5 A;  5FQ4 A;  1SA5 A;  5CHE E;  3TWW A;  4J0U A;  4UI9 K;  3ML8 A;  4A55 A;  2ZGG A;  3D3M A;  3UT8 A;  1N9A A;  3L13 A;  2OVB A;  4MLP A;  3ABK E;  1UJK A;  3ESK A;  5KBA A;  2V5F A;  3V2O A;  2XEN A;  4WNE A;  2Y1L E;  1IYG A;  3ZU7 B;  4HOQ A;  4L2Y A;  3UKU G;  4UWH A;  4F7A A;  2MOW A;  4TXR A;  5BV0 A;  5CMY A;  2X6J A;  1DVP A;  4JVS A;  1OXJ A;  4J8E A;  4GMJ A;  2IOS A;  4BER A;  1G3N B;  1RW2 A;  3I4G A;  2GRP B;  4UWL A;  2VSN A;  4HBD A;  1FT2 A;  2P9K G;  4NUR A;  2OEW A;  3ZYL A;  2XQ0 A;  4UI9 J;  4B89 A;  3MKQ B;  4HI9 A;  5AQ7 A;  2CHW A;  3Q7A A;  3CVV A;  4A3T A;  2P9N G;  4DLQ A;  2X6I A;  1NZN A;  1AP7 A;  3FDH A;  2QYU A;  4U0S A;  1K1A A;  3U4T A;  3FUK A;  5JJT A;  5G05 C;  3PH0 C;  3RRM B;  2I6H A;  3VLE A;  4FC8 A;  5ENS D;  3ONL A;  1A5E A;  2L0I A;  3HXF A;  1NL4 A;  1MHQ A;  4U63 A;  3CHO A;  4TXP A;  2J4D A;  2J9Q A;  3U64 A;  5HI7 A;  3HIZ A;  3TAX A;  2UY1 B;  4GPM A;  2ILR A;  3CVL A;  1U3D A;  4UQY A;  3G2S A;  4FA6 A;  5BW8 C;  3R9A B;  4LRZ A;  3TWS A;  4F6R D;  5EIB E;  5ANL A;  3QDN A;  1QZ2 A;  4B8A A;  4ILI A;  3TG4 A;  4A63 B;  3JCK C;  2VQ2 A;  4HS2 A;  3SFZ A;  4XI0 A;  4L2L A;  1ELR A;  3EHR A;  2AWI A;  5J90 A;  3ZFW A;  3OXG A;  4XEI G;  2KZT A;  1UW4 B;  5HQ8 A;  1E90 A;  2OND A;  2OVF A;  4I6E A;  1OCR E;  2A5U A;  4I2W A;  3RRU A;  1JWF A;  1K8K G;  3HVE A;  4L7T A;  5AN8 A;  4AP2 A;  3NZU A;  4BX8 A;  2PZI A;  4FLB A;  4F1P A;  3CHS A;  3ZIM A;  4ANW A;  3CHP A;  3TXN A;  4AY6 A;  4K5C A;  3Q73 A;  4WND A;  4KVO A;  3B7U X;  4CRW A;  4XKB A;  4EZL A;  4JA7 A;  2BUG A;  3NAW A;  1VDY A;  4M3O A;  3RAU A;  3PNL B;  4HB5 A;  3CVW A;  1UN9 A;  3FUL A;  5BNW A;  1XNF A;  4F3V A;  1HH8 A;  3ZN3 A;  4C9B B;  3ZGQ A;  3ZKJ A;  4V3I A;  3LCA A;  2Y4T A;  5E75 A;  3KD7 A;  2HE0 A;  2XGS A;  4ILG A;  1NFI E;  5LOZ A;  2WXK A;  3HVE B;  3QOU A;  4WWP A;  4G11 A;  3GZS A;  4UWF A;  4U07 A;  3J5Q B;  4CGW A;  5FZR A;  4DX6 D;  5A7D B;  3HXC A;  4FAD A;  1SA4 A;  5ARG A;  4IN3 B;  4BT9 A;  2DZN A;  3V31 A;  4B8C B;  2WXJ A;  2KXP C;  2NC9 A;  4YDE A;  4LSZ E;  4PS8 A;  3GYZ A;  4QQI A;  3RKV A;  2VTB A;  3SI5 A;  3UI2 A;  1U3C A;  4N2S A;  3QKY A;  3CK8 A;  4GZ6 A;  3CIA A;  4NAC A;  3PZD A;  3IKO B;  4EZK A;  1H19 A;  5EYP F;  5FTP A;  3B7R L;  4K0R A;  3UPV A;  4DX5 D;  2J49 A;  3DBS A;  3E33 A;  4A3V A;  2H6I A;  3DEP A;  2GRM A;  2KCK A;  3LVQ E;  1JPL A;  1QQE A;  2R5S A;  3HXB A;  4Q94 A;  4UQX A;  4CT4 A;  2AXU A;  4GCN A;  3CV0 A;  5ENT D;  3FUD A;  3T5V A;  4QFV A;  4ANV A;  3DSX A;  1JCS A;  4W9R A;  4FJZ A;  3C5R A;  1MQS A;  2L9B A;  3FTV A;  3ZEF A;  3ABM E;  3I4R B;  4WNF A;  4ZHB A;  2KM4 A;  5CCL A;  2NSZ A;  3B13 A;  5KJM A;  4HLL A;  5FZS A;  3U66 A;  2R2L A;  1DCQ A;  5CCM A;  2VGX B;  5LCW J;  1H6K A;  4KT6 B;  5FQ8 A;  3CHM A;  1SVX A;  3FU3 A;  5AYW D;  1BU9 A;  2OV8 A;  2LUH A;  2IJG X;  2IF4 A;  3MYV A;  4FLH A;  1E8Z A;  1N4Q A;  4HOU A;  4Y6W A;  4WUY A;  1QBQ A;  1ZU2 A;  3CHQ A;  4B93 B;  3ZUV B;  1Q2Z A;  3C3Q A;  2WXG A;  4KZC A;  4JHJ A;  1Y8M A;  2LSV A;  4U04 A;  1FVF A;  3MJW A;  2EIJ E;  4JEU A;  4M7C A;  4DUI A;  2LAI A;  2GRR B;  1WDY A;  2EIL E;  4HFG A;  3UM1 A;  3CVU A;  2BKK B;  2QFC A;  3UM3 A;  3LVR E;  3LYA A;  3R9M A;  5EYL A;  2P9S G;  4OAU C;  3FU6 A;  4PH4 B;  2WXN A;  1FPP A;  4A1S A;  2EIM E;  4HOR A;  2A5E A;  3J5P A;  2XCC A;  1JCR A;  5ANR A;  3ASH A;  4HXI A;  2VGY A;  5EN5 D;  2MHK A;  3AU5 A;  1TNB A;  4CGV A;  4GTM A;  4DX2 A;  3FUH A;  1XGW A;  1E8Y A;  3FU5 A;  3AG1 E;  4YVQ C;  4U8H A;  1LF8 A;  2ZIS A;  4LUN U;  4HQD A;  5JA4 D;  3V79 K;  5KJK A;  3EU9 A;  4F1S A;  1SW6 A;  1E7U A;  3LPZ A;  3ULE G;  4LNU D;  2L6J A;  1RZ4 A;  3IV0 A;  4I9C A;  2XS8 A;  4RG6 A;  2WB2 A;  3UMV A;  5AAO A;  1INZ A;  5KNH D;  4DRX E;  5JJ6 A;  3SFX A;  1MZC A;  1BI7 B;  3C3R A;  1IKN D;  1MJ0 A;  2C0L A;  4G8L A;  4K03 A;  3UX4 A;  4XE0 A;  3ZYK A;  1HS6 A;  2I1K A;  2KCV A;  3UT7 A;  1NP7 A;  2P9P G;  4BEP A;  4N5Q A;  2QY7 A;  1TNU A;  2BTD A;  3MZL B;  4HRL A;  1NA3 A;  4AXH A;  4XIF A;  3CVX A;  1KZO A;  4OVU A;  2GW1 A;  3ZW3 A;  4TUM A;  4O6F A;  3FY4 A;  4GYW A;  3Q75 A;  4GU5 A;  1E8X A;  3DXK G;  1N4P A;  4I17 A;  4JHK A;  1TN8 A;  3E30 A;  1BPO A;  2F8Y A;  1DNP A;  4GA0 A;  3CQC B;  5B1B E;  3GW4 A;  4AY5 A;  2RFM A;  2ZIR A;  3TWT A;  4A1G A;  5HS0 A;  5T8I A;  3FHE A;  3PEU B;  2NXP A;  5CER B;  2R03 A;  1TN6 A;  4L1B A;  1YYH A;  2XGM A;  4J8F A;  5EX3 A;  2P9U G;  2OCC E;  3DSV A;  1D9S A;  2IY0 C;  4YVO A;  3CKB A;  2L0T B;  4ABN A;  4GTT A;  1SQM A;  3TWV A;  2X3M A;  4U95 D;  3CGH A;  4FUL A;  4UUC A;  3DPY A;  4GZ3 A;  2WXL A;  2RFA A;  4WWO A;  2XHE A;  1Z5S C;  2GRN B;  5ENN A;  4APF A;  1N54 A;  4K5B A;  3D9H A;  4RLY A;  3ZYQ A;  3URZ A;  2P2C P;  3T8K A;  5AJL A;  4E85 A;  4G2V A;  5ENO D;  3FTS A;  1WY6 A;  3I3N A;  4AVX A;  3L6A A;  2Y69 E;  4DX1 A;  1S64 A;  2V0P A;  3UQ3 A;  2XEE A;  4B94 A;  4D10 C;  4MBG A;  3SF4 A;  3ZXP A;  2FO7 A;  4GMR A;  3S7J A;  4GTO A;  3QB2 A;  4JC8 A;  4DI3 A;  4G1T A;  4FU3 A;  2H6G A;  3Q15 A;  2J4B A;  4O60 A;  2Y4U A;  2HM8 A;  3BEE A;  3V30 A;  3P2B A;  2FF4 A;  1E8W A;  1HF8 A;  3CSF A;  2IFU A;  4EBA G;  4UWG A;  2DZO A;  4KMO A;  4TXQ A;  3NBN B;  3ZXS A;  4TRQ A;  2YIN A;  3ZNG A;  4NIK A;  4WNG A;  1S63 A;  4N3C A;  1SZA A;  3C72 A;  4CT0 A;  3L17 A;  4GCO A;  4JW1 A;  1JWG A;  2PL2 A;  5KNG A;  2I2O A;  1ZBP A;  4U0Z A;  2XCB A;  4RQI A;  1N52 A;  3GZ2 A;  2KBX A;  3ZYM A;  4GML A;  2BKG A;  3MCX A;  3ZHE A;  1WAO 1;  1OCC E;  4U96 D;  5J08 A;  1O1S A;  3BG1 B;  5ARF A;  3FUN A;  3B7T A;  4UQZ A;  2R17 C;  4ACK A;  2YNQ A;  1N94 A;  3C3O A;  2I1J A;  3JUI A;  5A23 A;  3CLJ A;  3E4B A;  2WXF A;  4L23 A;  4EPZ A;  4G25 A;  4HRN A;  3FUI A;  2HO1 A;  3W9F A;  4I43 A;  4GA2 A;  3RIB A;  4EZJ A;  3C98 A;  3TL5 A;  5T4Y A;  4DK5 A;  3ZHE B;  4U7E B;  3D9N A;  4F53 A;  3ZVV A;  4DJA A;  3JUE A;  3UIO C;  1LD7 A;  4CZ2 D;  3BUA A;  3EDT B;  5D2M C;  4G24 A;  3SFY A;  3R7R A;  2PM6 A;  2HYZ A;  3SD5 A;  2KZT B;  1Y6I A;  4GTR A;  4GA1 A;  3E32 A;  3NOG D;  5FQ6 A;  3FUJ A;  3PS6 A;  1SZ9 A;  4CDN A;  1S70 B;  2VSY A;  3FTX A;  4GZD A;  3JXJ A;  3Q5M A;  3TG5 A;  3FUM A;  4BWR A;  4H7Y A;  4URK A;  3FUF A;  3FH5 A;  2FBN A;  5FJY A;  2HR2 A;  4UWK A;  2FUL A;  5BT1 A;  4GZ5 A;  3ULQ A;  4CEM A;  1X5B A;  4DLO A;  5LFA A;  3APC A;  1OWN A;  5HKP A;  3PE3 A;  3PUK A;  1V55 E;  3D9L A;  4N3B A;  2XEH A;  3OTN A;  4APO A;  3PZ4 A;  1B89 A;  4EQF A;  4DPR A;  5G04 J;  3NOC D;  3VTX A;  3ZPJ A;  3PZ1 A;  4BTB A;  1TYQ G;  4U0U A;  4G23 A;  2IO2 C;  2X6F A;  2R59 A;  1YMP A;  3UIP C;  3SBS A;  3FTU A;  4BT8 A;  3AS8 A;  4AEZ C;  3S7F A;  3VLF A;  1WG0 A;  3Q9N C;  2GRQ B;  3CVP A;  2ZGD A;  3ASN E;  4MKT A;  3B7S A;  2KC7 A;  4KBQ A;  5C2Y A;  2WQ7 A;  2RKK A;  3F6Q A;  3ASD A;  2VTB B;  5C1D A;  2B6C A;  4JA9 A;  3EHM A;  2JAB A;  3HRA A;  3L22 A;  3SHF A;  4U8Y D;  5A6C A;  1IQU A;  5EID A;  1YCS B;  3SZ7 A;  3EHQ A;  3QWP A;  3UTM A;  4X8Q A; 
#chains in the Genus database with same CATH homology
 2AVP A;  3LPZ A;  3APF A;  2WMO A;  2L6J A;  3FWV A;  3IV0 A;  4I9C A;  2XPI A;  4RG6 A;  2WB2 A;  3UMV A;  1INZ A;  4OYS A;  2IU1 A;  2ZU6 B;  3I4G A;  3ENE A;  4MRU A;  4UWL A;  2VSN A;  5JJ6 A;  3CKC A;  1TEZ A;  1KLX A;  4BSX A;  2E2E A;  4EEC A;  2C0L A;  3UX4 A;  4K03 A;  4XE0 A;  4RSY A;  4NUR A;  1TJC A;  3ASF A;  3ZYK A;  3ZYL A;  3O48 A;  1HS6 A;  2XQ0 A;  2I1K A;  2X38 A;  3HYM B;  4UI9 J;  4B89 A;  4BFR A;  2KCV A;  3LY7 A;  3MKQ B;  3UT7 A;  1NP7 A;  3D9O A;  2CHW A;  1PAQ A;  2J07 A;  3FP3 A;  3CVV A;  3WXX A;  2QY7 A;  4MS6 A;  4A3T A;  4AJW A;  4DLQ A;  2BTD A;  2X6I A;  3MZL B;  4I1M A;  4AV7 A;  3K9I A;  1NZN A;  4J8D A;  1NA3 A;  2X6H A;  3FDH A;  2UWJ G;  4UI9 C;  4AXH A;  4U0S A;  3EHN A;  3LJ3 A;  3MGB A;  4XIF A;  3LKU A;  3FTY A;  4NQ0 A;  3U4T A;  3CVX A;  4HLE A;  3CVY A;  3FUK A;  4OVU A;  5JJT A;  2GW1 A;  5G05 C;  2V8S E;  5KJN A;  4I6G A;  3ZW3 A;  3PH0 C;  3RRM B;  4O6F A;  3FY4 A;  2I6H A;  3D9I A;  3CST A;  4GYW A;  1JUQ A;  4GU5 A;  1HXI A;  3U3W A;  1NA0 A;  1E8X A;  3VLE A;  2IOL A;  4FC8 A;  1TJF A;  4N2Q A;  3MKR A;  3ONL A;  2WXH A;  3PNT B;  4CCA A;  3PRZ A;  4I17 A;  2A4Z A;  4JHK A;  4RG9 A;  2XGO A;  2L0I A;  3LEW A;  1BPO A;  4N3A A;  3MV3 B;  1MHQ A;  3EIJ A;  4U63 A;  3CHO A;  1DNP A;  1FVH A;  4GA0 A;  2VYI A;  2J4D A;  4XKC A;  3CQC B;  4ANX A;  2J9Q A;  3U64 A;  3GW4 A;  4WWN A;  2C2L A;  4OVV A;  4AY5 A;  4PS3 A;  4IYP A;  5HI7 A;  1EPU A;  3Q47 B;  4XZ4 A;  3HIZ A;  3TAX A;  4A1G A;  5T8I A;  2UY1 B;  3FHE A;  3PEU B;  2DCP A;  4FHK A;  2NXP A;  2ILR A;  1S0P A;  1U3D A;  3CVL A;  3ZRH A;  4ANU A;  3QWV A;  3MA5 A;  3G2S A;  4I9E A;  4UQY A;  4L1B A;  4FA6 A;  5BW8 C;  2J09 A;  3QNK A;  3R9A B;  2RG8 A;  4LRZ A;  2GRL A;  4BTA A;  2AW6 A;  2XGM A;  3PUJ A;  4Q69 A;  2C0M A;  3IHY A;  2VSO E;  3SNX A;  5JHB A;  3T8M A;  4IUL A;  5M72 A;  4J8F A;  1H0A A;  3QC1 A;  5EX3 A;  5ANL A;  3QDN A;  1E7U A;  3Q4A B;  1QZ2 A;  2KAT A;  2XPZ A;  2LAH A;  4YVO A;  4B8A A;  1UN8 A;  4ILI A;  3TG4 A;  3ASG A;  3CKB A;  2AXZ A;  3JCK C;  2VQ2 A;  3IBE A;  4HS2 A;  3SFZ A;  3LS8 A;  4XI0 A;  4L2L A;  1YA0 A;  2L0T B;  4N5C A;  4ABN A;  4RVB A;  4EBA A;  1SQM A;  3PRE A;  2ION A;  3N71 A;  2CG2 A;  2WPV A;  1ELR A;  2X3M A;  2WXM A;  4J8S A;  3RO3 A;  3CGH A;  4FUL A;  2AXV A;  2AWI A;  5J90 A;  4GZ3 A;  1HX8 A;  3ZFW A;  3RK6 A;  2WXL A;  4B0Z A;  4LEU A;  3OXG A;  4WWO A;  2XHE A;  2KZT A;  5ENN A;  1UW4 B;  5HQ8 A;  1E90 A;  4APF A;  4E6H A;  1N54 A;  2OND A;  2YHE A;  2VGX A;  2OVF A;  3PVL A;  4I6E A;  3ZYQ A;  2M63 A;  3URZ A;  2A5U A;  3LXU X;  5AJL A;  4I2W A;  3RRU A;  2OOE A;  3UUX A;  1JWF A;  4E85 A;  4G2V A;  1OWL A;  3HVE A;  4FJY A;  4L7T A;  3FTS A;  1WY6 A;  2FI7 A;  1WM5 A;  3I3N A;  3NZU A;  4AP2 A;  4AVX A;  2PZI A;  3L6A A;  4BX8 A;  4FLB A;  3CHS A;  4I2Z A;  2V0P A;  3ZIM A;  4ANW A;  5BUZ A;  5LP0 A;  4H7X A;  3UQ3 A;  3MV2 B;  3CHP A;  1Z3Y A;  4B94 A;  3TXN A;  4D10 C;  3CQG B;  4AY6 A;  3SF4 A;  3CK7 A;  3NF1 A;  4I1A A;  1EYH A;  4WND A;  2Q7F A;  2FO7 A;  4KVO A;  3B7U X;  4CRW A;  4XKB A;  5FZQ A;  4EZL A;  2XRY A;  3S7J A;  4JA7 A;  2BUG A;  2YHC A;  3TGO A;  3QB2 A;  1VDY A;  4JC8 A;  1A17 A;  4M3O A;  4DI3 A;  3GZ1 A;  3RU0 A;  4G1T A;  4FU3 A;  3PNL B;  3OAW A;  3Q15 A;  4KVM A;  3CVW A;  1UN9 A;  3FUL A;  4ATG A;  1XNF A;  4F3V A;  3FH7 A;  5BNW A;  3PDN A;  2J4B A;  1HH8 A;  4KZ0 A;  3ZN3 A;  4C9B B;  5LX8 A;  2Y4U A;  5G05 J;  3ZGQ A;  2WXQ A;  1PC2 A;  2HM8 A;  3BEE A;  3VLD A;  4V3I A;  3G2V A;  2XEV A;  3P2B A;  2FF4 A;  1E8W A;  1HF8 A;  3LCA A;  3CSF A;  2IFU A;  4EBA G;  2WQ6 A;  2Y4T A;  4TUU A;  4UWG A;  4KMO A;  5E75 A;  3KD7 A;  2WVI A;  4JXT A;  2XGS A;  3D9K A;  4ILG A;  3ZXS A;  5LOZ A;  4TRQ A;  2YIN A;  2WXK A;  3HVE B;  5AJD A;  3ONK A;  3QOU A;  4WWP A;  4G11 A;  4WNG A;  3GZS A;  4C0E A;  1OWP A;  2CFZ A;  3FFL A;  4CDM A;  4UWF A;  3Q49 B;  3IEG A;  4N3C A;  2X6K A;  1SZA A;  3S7B A;  4U07 A;  4CT0 A;  3AU4 A;  4CGW A;  3I5P A;  5FZR A;  5A7D B;  3IHV A;  3L17 A;  4FAD A;  5ARG A;  4GCO A;  4IN3 B;  2LSU A;  4JW1 A;  1JWG A;  2PL2 A;  4BT9 A;  5EDS A;  4N39 A;  4B8C B;  2KCL A;  4Q96 A;  2I2O A;  1ZBP A;  2WXJ A;  5FWQ A;  4U0Z A;  3QAR A;  5T3R A;  3RO2 A;  2EQX A;  2NC9 A;  2IQC A;  1P5Q A;  2XCB A;  3G2T A;  1Z3X A;  3BG0 B;  1N52 A;  3GZ2 A;  4WAF A;  4PS8 A;  3JQ1 A;  3S2A A;  3GYZ A;  3RKV A;  4PS7 A;  2VTB A;  3P1U A;  4JEH A;  4LER A;  4GML A;  3ZYM A;  3SI5 A;  4BY6 A;  2CHX A;  2CG3 A;  4BX9 A;  2XRZ A;  1U3C A;  3MCX A;  2XPY A;  4N2S A;  3QKY A;  5DIZ A;  3CEQ A;  1HU3 A;  3D9P A;  3CK8 A;  3O4Z A;  4I1O B;  1WAO 1;  4GZ6 A;  3ZHE A;  2LO6 A;  4FHJ A;  3CIA A;  4NAC A;  3PZD A;  5J08 A;  2PQR A;  1KT1 A;  3IKO B;  4EZK A;  3BG1 B;  4XI9 A;  1H19 A;  5ARF A;  2I9C A;  3FUN A;  4GAA A;  3T5X A;  3KS2 A;  3B7T A;  3CR3 A;  4XX5 A;  5FTP A;  1OUV A;  4UQZ A;  2P58 C;  2R17 C;  4ACK A;  2RD0 A;  1E96 B;  2YNQ A;  3B7R L;  5G04 C;  4K0R A;  4ACL A;  1KT0 A;  3CK9 A;  3TJP A;  4KYO B;  3UPV A;  2J49 A;  4AOF A;  3DBS A;  1W3B A;  5G2N A;  2JLB A;  1UJJ A;  2I1J A;  3D9J A;  3R7Q A;  3JUI A;  4A3V A;  3JQ0 A;  4GB9 A;  5A23 A;  3CLJ A;  3E4B A;  3FH8 A;  3D9M A;  1EDU A;  2WXF A;  3FU0 A;  2GRM A;  2KCK A;  4L23 A;  3LVQ E;  1JPL A;  1QQE A;  4ME2 A;  2R5S A;  4CDR A;  4EPZ A;  5D0O D;  4Q94 A;  4G25 A;  4UQX A;  3SBT B;  4CT4 A;  2VJ8 A;  2WXI A;  2AXU A;  4GCN A;  3CV0 A;  1IQR A;  1HG5 A;  2LNI A;  5DBK A;  3NQP A;  3FUD A;  5D0Q D;  3FUI A;  3T5V A;  2HO1 A;  1HO8 A;  4QFV A;  4ANV A;  4I43 A;  4GA2 A;  3MKQ A;  3RIB A;  3FTW A;  4EZJ A;  4W9R A;  2GGF A;  3C98 A;  1HFA A;  4FJZ A;  4JL0 A;  5T4Y A;  3TL5 A;  1EF1 C;  4DK5 A;  5JHA A;  4GPK A;  1MQS A;  2L9B A;  3ZHE B;  3RJV A;  1FCH A;  5FQ7 A;  3FTV A;  5AEN A;  4HOS A;  3LDZ A;  4LCT A;  3ZEF A;  3NZS A;  3D9N A;  4F53 A;  3QK0 A;  3I4R B;  2WXR A;  4WNF A;  3S7D A;  4GYO A;  3ZVV A;  4DJA A;  2CHZ A;  3VTY A;  2DIW A;  2KM4 A;  3G2W A;  3QWW A;  3PE4 A;  5EKQ D;  5CCL A;  3CVN A;  4JPS A;  3DPD A;  2NSZ A;  3EDT B;  3B13 A;  5FT9 A;  4NRH B;  4G24 A;  5KJM A;  3APD A;  1ELW A;  5FZS A;  3U66 A;  3ESL A;  3L16 A;  3R7R A;  1Z6T A;  2PM6 A;  1IHG A;  3MEK A;  2HYZ A;  3SD5 A;  3MX3 A;  2KZT B;  2WQH A;  3FEX A;  1Y6I A;  4GA1 A;  4JHR A;  4IRU A;  5CCM A;  3JYS A;  3KEZ A;  4Y6C A;  2VGX B;  3UT4 A;  5LCW J;  1H2V C;  1H6K A;  2MRI A;  5FQ6 A;  4KT6 B;  2PQN A;  4KXK B;  5FQ8 A;  3HDX A;  3FUJ A;  4PUC A;  3CHM A;  1SZ9 A;  3PS6 A;  4CDN A;  3FEY A;  5KCM A;  3CVQ A;  2VSY A;  3FTX A;  4GZD A;  4TV3 A;  1E7V A;  3FU3 A;  3Q5M A;  5BPP A;  2PM7 A;  3LY8 A;  3TG5 A;  2WM9 A;  1H2T C;  5AYW D;  4AIF A;  5LCW C;  2UY1 A;  3FUM A;  4PDX A;  4H7Y A;  4BWR A;  4URK A;  3FUF A;  3OXF A;  4YND A;  1HZ4 A;  2OV8 A;  3FH5 A;  4HVB A;  3FTZ A;  1PY1 A;  2BF0 X;  2FBN A;  5FJY A;  2HR2 A;  3G2U A;  3QAQ A;  4UWK A;  2FUL A;  2IJG X;  3ML9 A;  5KJL A;  2IF4 A;  3MYV A;  5BT1 A;  4FLH A;  4GZ5 A;  1E8Z A;  3ULQ A;  4CEM A;  4HOU A;  5CMW A;  1X5B A;  3EIQ C;  3U9W A;  4DLO A;  3AS4 A;  4Y6W A;  5LFA A;  4WUY A;  3APC A;  4JZY A;  4I6J A;  1ZU2 A;  3CHQ A;  1OWN A;  2WXG A;  4KZC A;  4JHJ A;  1GW6 A;  2DBA A;  1Y8M A;  3CHR A;  3PE3 A;  2LSV A;  4GZC A;  4U04 A;  3PUK A;  3EJN A;  2WMN A;  3D9L A;  1FVF A;  3MJW A;  5E76 A;  4N3B A;  2J08 A;  4JEU A;  3FUE A;  4HOT A;  1HE8 A;  2FEZ A;  2V4L A;  3AS5 A;  1OWM A;  2LAI A;  2WXO A;  2CFU A;  4R7L A;  3OTN A;  4APO A;  4HFG A;  4G26 A;  3TXM A;  1B89 A;  5EX0 A;  3CVU A;  2E0I A;  4EQF A;  4AM9 A;  3KAE A;  4DPR A;  3LY9 A;  2QFC A;  4FP7 A;  3LVR E;  4J6I A;  5G04 J;  3VTX A;  1H2U A;  3LYA A;  3ZPJ A;  1L5J A;  4DI4 A;  4BTB A;  3OXL A;  2JEK A;  4U0U A;  4G23 A;  2YQ8 A;  3FU6 A;  2X6F A;  2R59 A;  4BT8 A;  5G55 A;  3FTU A;  3SBS A;  4PH4 B;  5FQ4 A;  3RRN B;  5BV1 A;  2WXN A;  3AS8 A;  4AEZ C;  3S7F A;  5CHE E;  3VLF A;  4A1S A;  4J0U A;  3CVP A;  4UI9 K;  3ML8 A;  4HOR A;  4A55 A;  1ELK A;  1QNF A;  3D3M A;  4MKT A;  3UT8 A;  3B7S A;  4C0M A;  2XCC A;  2KC7 A;  1UG3 A;  4KBQ A;  5C2Y A;  5JJ7 A;  5ANR A;  3ASH A;  2OVB A;  3L13 A;  4HXI A;  4MLP A;  2WQ7 A;  3ASD A;  1UJK A;  2VGY A;  3PEV B;  2MHK A;  3ESK A;  4GYY A;  4P29 A;  2VTB B;  3AU5 A;  5C1D A;  2V5F A;  2Y3A A;  4JA9 A;  3EHM A;  4WNE A;  1IYG A;  3L22 A;  4CGV A;  4HOQ A;  4ILH B;  3HHM A;  4L2Y A;  3L54 A;  3FUH A;  3SHF A;  3QJZ A;  2WXP A;  5A6C A;  1XGW A;  1E8Y A;  4UWH A;  1IQU A;  3FU5 A;  4F7A A;  2MOW A;  4YVQ C;  5BV0 A;  4U8H A;  1OWO A;  3SGH A;  5CMY A;  5AIJ A;  2VSX E;  1LF8 A;  3L08 A;  2X6J A;  1DVP A;  3SZ7 A;  4LUN U;  4JVS A;  1HG2 A;  3QWP A;  5KJK A;  4J8E A;  4F1S A;  4GMJ A;  2IOS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...