1Y8NB

Crystal structure of the pdk3-l2 complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
102
structure length
97
Chain Sequence
b'SYPPHMQVLLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILVPEGTRDVPLGTPLCIIVEKEADISAFADYTDLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 3
publication title Crystal structure of pyruvate dehydrogenase kinase 3 bound to lipoyl domain 2 of human pyruvate dehydrogenase complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 14
structure length 97
sequence length 102
ec nomenclature ec 2.3.1.12: Dihydrolipoyllysine-residue acetyltransferase.
pdb deposition date 2004-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1y8nB00
1GJXA 1VDZA 3PUXA 4IQZA 1Y8PB 5JEAH 1H9MA 1H9KA 1GUTA 1OXXK 2D2CC 1CTMA 2CW0C 2A69C 2DN8A 3OW7A 3PUZA 2AUJD 1A6XA 3SDZA 1G291 4PV1C 2JEBI 1TKWB 1E2VA 3PUWA 1GHJA 3D4RA 1VCIA 2NN6I 5A35A 3I72A 2A69D 4H13C 3TZUA 2A6HD 1YNJC 4I7ZC 3PV0A 2NN6H 1K8OA 1GUGA 1Y8NB 1H9SB 4KMUC 4KKSA 1Y69U 2AUKA 3GQBA 4H44C 4GZYC 1Z6HA 2EJMA 2DNEA 4DNRB 5JEAG 3QG1A 1HPCA 1GHKA 3ND8A 2PCFB 3A8IE 1FR3A 3AB9A 1V43A 3FMCA 4OGQC 3BDOA 1IYUA 3BG3A 5C0XH 2KA7A 3GD7A 3PUYA 2EVBA 4LJZC 1OXVA 2D62A 2F1MA 3LWUA 4XIGS 3MFYA 3T53B 3A7LA 2JXMB 3OOCA 1TU2B 2B8GA 3WDNA 2BA1A 5KNBA 3VA7A 4IFDH 2BDOA 1O7LA 2PNRC 2NN6G 4KN4C 4OO1H 2EJGC 3CRLC 2O5JC 4G7ZC 3CRKC 2EJFC 2EDGA 1LABA 1Q1BA 4KKTA 2LMCB 1IYVA 3IFTA 5BN4A 3W3AA 2B8FA 1HTPA 1K8MA 3NE5B 4KHZA 5KNDA 3FPPA 5C0XG 1QJOA 5K36H 1V8QA 5KNCA 1OXTA 3U9SA 2L5TA 2E76C 1H9SA 4RCNA 4KI0A 4IFDG 3A7AB 1DCZA 1Q90A 4DNTB 2O5IC 1FYCA 2K7VA 5BN3A 1H9RA 5BN5A 4OO1G 3P20A 1Y8OB 4LK1C 3VR3A 1VF7A 1T5EA 2Q8IB 2E74C 2R6GA 4BA1I 3KLRA 3N6RA 1CFMA 1IW7C 2IT1A 4G7OC 1H9JA 3OPOA 3PUVA 1B9MA 3ND9A 2ZT9C 4KKUA 2BE5D 3VR4A 3LNNA 2PPBC 2K33A 4JK1C 5K36G 1GUOA 1LACA 1YNNC 3M85A 2JEAI 4H0LC 1ZKOA 1HCZA 1B9NA 1O78A 1ONLA 2BE5C 3QJYA 1HQMC 1EWHA 2BA0A 1PMRA 3IKJA 2D5DA 3T56B 3M7NA 3SE0A 3VR5A 2E75C 4KN7C 1Q1EA 4TKOB 1Z7TA 3M4YA 3QIAA 1E2ZA 2V4DA 3RLFA 3L7ZC 1GUNA 3D31A 1SMYC 3DXJC 1GUSA 1VF5C 4DK0A 3MXUA 4XTCS 1DXMA 1IW7D 1BDOA 2A6ED 3A8KE 3EQLC 3I73A 3T51B 3A8JE 4BA2I 3H94A 1OXUA 3I4LA 1I6VC 1ZYRC 2A6EC 2QF7A 3HGBA 1OXSC 2JE6I 3VR2A 1E2WA 4JBWA 4DK1A 2A6HC 4TQUS 4HR7B 2A68D 2KCCA 1CI3M 4G7HC 2DNCA 3VR6A 2YYZA 4L8JA 2K32A 1DD2A 1Q12A 2AWOA 2A68C
chains in the Genus database with same CATH superfamily
4G57A 4JI5L 5IODA 5E3FA 3TQYA 3DHQA 1MKHA 1I3QH 1H9KA 1GUTA 1IBLL 5H1SE 2G5DA 1E2VA 3I4MH 1SFOB 3OTOQ 2LKVA 1JICA 4I7AA 1HUNA 4LF8L 1D2BA 1K83H 2HQEA 3H09A 4H44C 1PH7A 2DNEA 1OTCA 1LM0A 5CV7A 3ND8A 2PCFB 4HSVA 2F0SA 1D1IA 3AYHB 3CP0A 4DV0Q 2UUAL 1IKLA 2NVXB 4C3HG 2JXMB 4LNQA 2G9DA 1SMXA 2N3SA 2K50A 3CRKC 3GV6A 1K73C 4P2CB 5BN4A 4DR5Q 4DAPA 1JWSD 4GKKQ 2B2WA 2Y0SB 3STBC 4QGUA 3HOZG 1EY7A 4EGVA 1X56A 4R1JA 2E76C 5GAEC 4MTNA 1PRTB 1NY4A 3J81i 5HY6A 2F0GA 1GM5A 1PH3A 2B2VA 4IUVA 1HZCA 4DPGA 5IP7H 3ULPA 2M9VA 1II3A 4A3CH 4HIDA 4RHRA 3KLRA 5M3MH 1IW7C 2N88A 1BNZA 3SK8A 3AFPA 4FXGC 3JAMi 1EIGA 1MIUA 1W6JA 1IL8A 1WCMG 4EQNA 4NP5A 1FJGQ 2JA7G 4H0LC 1ZKOA 4L63B 2K04A 4OXPA 2R7ZG 5ELDA 1TWFB 4PMBA 1XPOA 1BQQT 3AEVA 2EY6A 1GUSA 1A15A 1EOVA 3G48A 4JBJA 5D65A 4POGA 4IUQA 4F87A 3I2ZA 4QCLA 4RCOA 2EYMA 1AN8A 3E5SA 4A3EH 3S15H 1HNWQ 2JE6I 4A3FG 2UUBQ 1V1PA 3KYHC 4OIKA 2WACA 3GO5A 3NWTA 1HNXL 4KD3A 3HOWG 2AQ1B 2QDBA 3DLLA 4HMIA 3H91A 4IOCA 1Q46A 2AQ3B 3RZDB 5FLMH 2DN8A 5IT9L 3ICEA 4QL5A 4RGTA 1WTRA 2F0LA 1TKWB 3EN2A 3IAYA 3D4RA 5KRUA 2BOSA 5GQOA 4LFBQ 1Q86C 2OTLA 2A6HD 3M3YH 2F3VA 3TP8A 1GUGA 1H9SB 1FGUA 1JOQA 3H3VI 5JEAG 2JJQA 1U9RA 3I55A 3K5MA 3CCUA 3PUYA 4WJ3M 1LLRD 2L55A 2WB1E 4P75A 5GAGC 1G2SA 3K5OA 4AYBB 4KN4C 1F9RA 3VYSA 3F2UA 1B50A 5M5XB 4X62Q 4C2MB 2A1AA 2B2YA 1X6OA 2F0QA 2HHHQ 3CCVA 4FO2A 4JG2A 5M5YH 4JV5L 4LF9L 2ZTDA 1DM0B 1HTPA 5JOBA 3PO2B 3FKIG 5C0XG 2XRQD 2C9OA 1AH9A 5DM73 4F88A 2E2IH 2Z8LA 1PTOF 4NKLA 2Y0SE 1W6KA 4JI7L 5J3BA 1KLGD 2KBNA 1ENFA 1O7ZA 3I91A 3FP9A 3Q8DA 3P20A 2PI2E 1UE7A 5GROA 1EQVA 2K5NA 5EPLA 3HOVB 2Q8IB 5IGEA 1PZKD 4ZCKA 1XX8A 1LTLA 1R4PB 3J80c 1B3QA 2WP8J 1ICFB 3R2TA 1ONLA 1HZBA 2PMZB 3T56B 5FLXE 3K6OA 3BS1A 1SYDA 1VS0A 1Z7TA 2B63B 1QUQA 1VF5C 3RLNA 1NUCA 3A8KE 1ML0D 1K8AC 1KIXA 1TY0A 4E6IA 5EKKA 3NELA 4K8IA 2HQLA 2ZXPA 3OSOA 1J5EQ 2L11A 2O2LD 2RVLA 3B6YA 5IWAQ 4HIOA 2A68D 2KCCA 5D3IB 2NVXH 2QILA 4CHTB 2TMPA 1I94Q 1T5XD 3GTOB 3ZYYX 1TIID 4PMWA 4DXGA 4JI4L 1GJXA 4K6LA 5ELEA 1VQ5A 2FMMA 3BJUA 4JI3L 1JR0D 5FJ8H 4DV2L 2A69C 4L5TA 4DV6L 5LMNW 1RHPA 3K0XA 1N32Q 3GDEA 1Y1VG 1HR0Q 3A56A 1BCPF 3J81j 4DV7Q 5FK9C 4LFAQ 4IUPA 1EY4A 2HIVA 3J81E 4X65L 2K01A 4J6HA 1EQRA 4NDXA 5T1GA 4FP5D 2KECA 3E9HA 2D0OA 4DNRB 2M2LA 2XNAC 1S72A 4H02A 5K5PA 2J7ZA 4A93H 1TWCB 2IPKD 1DYQA 2EVBA 3AU7A 1TWAB 4Q0FA 3MTSA 5IYBH 1F2MA 1MD2D 3MHBA 3RN5A 4HIMA 4IUUA 5I2XA 1JB7A 4A3BH 2WFWA 3L9AX 1LABA 2CH4W 2K05A 4IN3A 4MIUA 2CCZA 3GTGB 4XXEA 1A3VA 1EYGA 5IGFA 3DUZA 2PW7A 2WAQG 1B8AA 3UDFA 1IL2A 4C3IB 2B29A 4DFAA 3S1RB 1YITA 1MSGA 5LHY1 2ZXOA 3MFGA 1LTSD 1BXTA 5BN5A 3NTKA 3OWFA 1EUJA 1T5EA 1CKMA 3PF4A 4QUCA 4HTHA 1CHPD 5IOCA 1NNXA 3KDFB 3RZDH 3VA5A 1E7ZA 4FDBA 3CPFA 1Q82C 2K33A 1WJJA 2A74C 1HA5A 1N36L 1SSOA 1PH4A 2LY7A 4JOIA 1GD7A 2E5LQ 3DEPA 3OMCA 3OW2A 4FF4A 2L0CA 3UE0A 3BDLA 2E75C 3HEJA 4KN7C 1HHVA 4DV5Q 1A6XA 2Q2HA 3CMEA 5EJWA 1VQAA 3QOLA 4BA2I 1B7YB 4JYAL 1S5DD 4ZQ3A 5D14A 1UEAB 4KK7A 3MEHA 1NCVA 2F0NA 1RIPA 4JI2Q 2ALYB 4ZUIA 2K14A 4HEDA 1JJ2A 1F2LA 1GOZA 2DNCA 1WTPA 2BCOA 3BZDB 1Q12A 3PUZA 2NVQB 1ZEQX 2IX0A 5M5XH 1VQ4A 1RCVD 1H95A 3EIVA 3OW7A 2AUJD 2CKZB 3Q24A 2UXDL 1BOSA 3RR5A 2ZTEA 3I70A 2VQEQ 2UU9Q 3PO2H 4JI6Q 1L0WA 5LMNL 1XTCD 2RDGA 3K5LA 2NN6H 4PQXA 1N33L 4N8FA 1KLUD 4IPCA 4RWSC 3QO2A 2MGSA 5DNFA 1HPCA 4X3UA 3NEMA 3HOVH 5IGDA 5IY0A 5NUCA 1IHZA 1SYCA 4OX9L 1F9SA 1LTRD 1STHA 4C1NI 1ET6A 4JI1L 4XT1B 3F2CA 1I4RA 3VA7A 2B2TA 4YHHQ 1XMOL 2PNRC 2H5XA 1V9PA 5FLXc 4BBRG 1EY9A 4GNXB 2R7FA 4DKAC 3CF5A 1Q81C 1HH2P 2RHSB 3STBD 2B63H 1CHQD 4NXMQ 3J81L 1C48A 1I4HA 1LTAD 1M4VA 3D3RA 3PO3B 3HS0C 3U9SA 4RFBA 1H9SA 1YNXA 4JPBW 1PA6A 1UE6A 1CQFA 1Q90A 3MEFA 5CYUA 1PXUA 3OIQA 1D1KA 3ERSX 3IFDA 4JI8Q 1QG7A 3UDIA 5BR8Q 3GTOH 3E0EA 3N6RA 5C4ZA 3PCOB 3HKZE 4BY1G 3HKSA 1KDAA 1SNDA 3ND9A 3J7A5 4KKUA 3VR4A 3CCRA 1UAPA 3J80i 3BVZA 4RG1A 2GN5A 2JA8G 2K4KA 1CUKA 1EWHA 3DM3A 1G2TA 3IKJA 5C4JB 3J7YW 3VR5A 2OQ0A 2UXCL 1CZWA 2F4VL 1E2ZA 4OWXB 1V1PB 4X3KA 2MO1A 2JA5G 4NMZA 4LAAA 2RCFA 3SVMA 3H0GG 5CGKA 1WFQA 5LMUL 1GO3E 2ICIA 1EQQA 1TWCH 5G3LF 2VQFQ 1RTOA 1C7YA 1VQGA 4HCEA 3H6MA 3CU7A 3FKIH 1PFNA 2KHIA 4G4KA 4B3SQ 2LFNA 4LFCQ 2B39A 4L5SA 4FF3A 4FNFA 3QR8A 3GTGH 4F8MA 3T1HQ 1E22A 4ZRZA 3MXNB 4PZ7A 4ZK9B 1HA6A 2HD3A 2KEEA 2AHOB 3S1RH 1QE6A 3SHLA 2NWGA 5JJIA 1RDPD 3QB3A 3DWAA 2EQSA 3A8IE 1V43A 2EZVA 3PQIA 4LF8Q 1AFPA 1A3UA 3G6JB 5EGTA 1O80A 5M9OA 3S9WA 2X69A 3CCSA 2JA6G 4J1MA 2X6LA 3AFQA 1MGSA 3CRLC 2EJFC 4YCUA 1B44D 1EYCA 1L2FA 3AQQA 4A3JB 3TZDA 4KKTA 4WRDA 3KF8B 2B3GA 3A54A 1XNQL 3LWEA 1Q3LA 1XPUA 2SOBA 2K03A 3J7AF 4GLAC 2KCMA 4A3EB 1QILA 3ULJA 1MJEA 3R8BA 1DCZA 4A3GB 4BY7G 1H9RA 1SE8A 4IJLA 2OCEA 5JEAJ 1IBKQ 4BBSB 5C3EG 3PSIA 2E2JH 4R4CA 2NVQH 1QWYA 4A3MB 4BWGB 3TDQA 3OHXC 4R4IA 2JYOA 3TS2A 3K57A 3C2PA 4DV4L 1SJHD 5IE8A 4X64Q 4OIJA 3V05A 2OEOA 4A3LG 4C1NK 4B3ML 2Z6KC 2F3WA 1ICWA 4K14A 2YTXA 1HZ9A 1U4PA 1BVSA 3CCLA 4JI0Q 1PFBA 3NSWA 2V4DA 3RLFA 1YJNA 3OWEB 3CPWA 3D0FA 2NB0A 5C0XJ 3T51B 2WB1G 2ZJRA 3M4OH 1DOMA 1IBML 1E2WA 4JBWA 1LO5D 4I65A 4G7HC 2F0MA 4B9WA 3NUCA 2A69D 3I4NB 4DU9A 3KDFA 4DR7L 4DUYQ 3KBGA 2R93B 1Y8PB 2Q2UA 1WOCA 1PRTF 4HIKA 1YEZA 3NXWA 3NHHA 1X32A 1LTID 2Y0SG 2IHFA 3I8ZA 2Q8TA 4DAYB 4DK6C 2I0QA 5M5YB 3TZUA 3PO3H 1RKNA 3OMGA 4ZKCB 1MI2A 2QGQA 3RMHA 3I7FA 3SK6A 5EPKA 1E24A 3DWQA 4LF4Q 4GLVB 5C3XA 4B3RL 4EQPA 3MA2B 2FJ2A 2EY5A 3A7LA 4RKBA 3J80E 2BA1A 2JA9A 4DF7A 5JVH3 5C4JH 5F2DA 5JPMC 4AH6A 1JMCA 5EQ0A 2PZUA 4QUFA 1F2ZA 1STGA 1CSQA 1LYLA 1QOHA 3J7AV 3CCMA 4JBKA 3CC7A 4O1NA 2F0KA 4DN4M 3SEBA 2Z1CA 3WOFA 3UDGA 1OXTA 1E1TA 2K28A 1WTOA 1JQYD 4JV5Q 4DNTB 3K80C 1Y8OB 2EXDA 2ENBA 2F3IA 2PZWA 3VR3A 3KF6A 1BO0A 1TR5A 3K7AH 4JI7Q 1G8ZD 5I2YA 2YU9B 3PUVA 4KHVA 1VQOA 2KJXA 2ZT9C 2ZM6Q 2K1BA 1Y1WG 1SE2A 2Q8RE 1QB5D 1HCZA 4YY3L 4LF7Q 4CJ0B 4F7XA 2X6GA 5ELBA 4GNXA 2D5DA 2JP1A 4KY7A 1BF4A 4XT3B 4TKOB 2QKIC 3DXJC 1SMYC 1A2UA 5IYCG 4J15A 2KCNA 5DLQE 3I4LA 1VQNA 4YCVA 4ABNA 4A93B 2XWJB 3K5NA 2F0HA 4DK1A 4K8JA 1HNZL 1D5XC 2SNMA 3CCQA 5IIFA 3HOYH 2VUMG 4A3JH 4A3BB 1JE4A 2E2DC 2PQAA 2CQAA 4A3IB 5HGQA 2QEJC 4FF2A 1KDCA 4ALPA 4UP9A 2ZXRA 1KABA 4JI4Q 3BZKA 2EYOA 2G9HD 2K5WA 2M00A 4JI3Q 3HOXB 1C4QA 4CDFC 4KHPL 3GTQH 1EY5A 1KRTA 4BY1H 4A3GH 4IUTA 3CC2A 1PH8A 2A5HA 3R3OA 4BBSH 1PYSB 4ZAIA 3M7GA 1CK1A 2L1BA 1QVGA 1JWMD 1U4MA 2A73B 3F1ZA 4A3MH 5EAYA 1TQOA 1BBUA 3S14H 2UUCQ 3GD7A 4UY8C 4LJZC 5IYDH 4OO1I 1XNRL 2GVAA 4LUVA 1FVIA 1MBYA 4XQQA 4GN3B 5KYIA 1WTXA 1P16A 1NR2A 1UE5A 2F0IA 5M3FG 4B3TL 4DR4Q 1NE3A 3GTPB 3MXNA 3W3AA 3X3MA 2JSOA 4C3HB 3T16A 1EY8A 1F9QA 2FMCA 4A3DG 1PRTC 4KI0A 1EWCA 4OWTB 1EYAA 2K7VA 3MXGA 3P75A 4OO1G 3TS0A 4K2LA 3I4NH 3NBIA 4LUZA 1QVCA 2R93H 3J80L 1C0AA 2B2UC 5FKAC 2L12A 5L37A 3HOZB 3WWVA 1VQPA 2NUCA 4UP8A 2NVTB 3CC4A 2CHBD 3M7NA 1YBYA 2DJFC 1TVXA 5TSSA 1SNOA 3NK9A 5C5LA 1PH1A 3KF8A 2C5CA 1O7YA 1J8IA 3NP8A 1NTGA 3LX0A 1WCMB 3A8JE 4CDCC 2JA7B 4L5QA 1S3OA 2A6EC 3HGBA 1IZ6A 4K5XA 1XXGA 3S2HH 4UPAA 4DV0L 1VQEA 1TS3A 1T9HA 4WFN3 1L0XB 1A62A 5AFWA 5IP9G 1YVCA 1VQJA 1VDZA 1MJCA 2XGTA 1LUZA 4DGZA 1H9MA 1B2TA 3GTLB 2UXBQ 2VB2X 3BVGA 4IPGA 1SNMA 4A3FB 4K5WA 2JEBI 1K9MC 3H15A 4DR5L 1XMQQ 4GKKL 3K58A 3HOWB 3NWSA 4AQYL 2IWHA 1LTTD 1JC7A 3TSSA 5J1ZA 2PYKA 3HKZG 2A19A 2KEDA 1Z6HA 5C44G 5LMNQ 3ONAB 5I4DA 2K5QA 3L3OC 3GTKB 3S1MH 3BYYB 4S3SA 1PH2A 3CW2C 2YU9H 1L1OC 4IFDI 5EBDA 3LWUA 4B08A 2NZOA 4LUOA 2H4OA 3HP3A 4DR2L 1QNKA 2BDOA 1KAAA 4K0KL 4JI1Q 2WV6D 4YWKA 4C56C 1UNSA 2IL8A 4DAYA 4WJWA 4KY5A 3UE1A 3NQTA 5JPNC 4C3JG 3RLOA 1SROA 1HNWL 4WORA 2UUBL 4IFDG 2QDLA 4EVOA 1CA5A 1VQBA 3U9OA 2KVMA 4L6TB 3RZOH 3SGIA 5FO8B 5ELNA 3VYTA 2O4XA 1YJ9A 2N8NA 3FKIB 4AYBE 4N9TA 4XQNA 1HZAA 4A3IH 1EWIA 5K36G 4XQJA 1GUOA 1EU3A 3G4SA 2AWNA 1NMGA 1YHAA 2I5HA 5J22A 1IKMA 3GP7A 1M90C 4LFBL 1GKHA 5HGTA 4ID6A 2HUGA 3HOXH 1J9OA 1PHJA 1SJED 5E4XA 2Z9HA 5CR3A 2EY1A 3T1YQ 1UUPA 3A0JA 3U4ZA 4HJ5A 3KLSA 2UXCQ 2ES2A 3URYA 2F4VQ 2RHQB 2RA4A 1LT3D 2WIIB 1V1OA 5EBCA 3HOUG 1YNND 1PYWD 4HCSA 4QIWB 1C8CA 1F9PA 1FGBD 5LMUQ 2JQOA 4A3KG 2K32A 1KXLA 4A4IA 1KQSA 2CFMA 1EQTA 3Q22A 2PMZE 5JJKA 1OXXK 2XWBB 5CBEE 3GTPH 2HHHL 4YWMA 1DJRD 2SDFA 3RD4A 1IYJB 1JE5A 4C3HH 3NPPA 4JW0A 4OL7A 2TSSA 4B9XA 1JJGA 3IRBA 3H3VC 2BH8A 2XIWA 1SDFA 4A76A 1JT8A 4MHEA 3ER0A 1Y1VB 4MTKA 4RMFA 1PH6A 2E2JB 2F0DA 1FR3A 4KD4A 3T13A 2EOTA 3PIPA 1TWGB 1PTOC 1AZPA 5I9PA 3HOZH 4LW1A 1TWHB 4HJ8A 2QEXA 3I4MG 1TS4A 3G7LA 5FLXL 2B8GA 1JOOA 3BU2A 5IYCH 2NVTH 3FEWX 2P5ZX 1HTLD 1NBWA 4G7ZC 1VMPA 3D6WA 1IXRA 2YTYA 2MFIA 3ERQA 1VQMA 4PZ8A 1WCMH 2JA7H 3KF6B 4IJHA 2F0EA 1Z9FA 2VB3X 3M4OB 1N8RC 1VQKA 2R7ZH 1SE4A 2AQ2B 4DR3L 4R9WA 1FYCA 1WTHA 5C3WA 1X9NA 3UI2A 3PIOA 3HFZB 2CWAA 1WYDA 1I94L 3ULLA 4BA1I 2WAQB 1Z47A 3GTLH 1TY2A 1SBBB 5D3DA 2PZTA 3BVMA 4A3FH 4LF5L 2E2HB 5C4XG 1LACA 3HZXA 2JEAI 4NB3A 3F8TA 3DEOA 1RODA 3A5UA 4DK3C 4DV7L 3HOWH 4GOPC 3SXHA 3R93A 1SAPA 3QIAA 1PLFA 4GKJQ 1SYGA 5IP7G 1X55A 1VQ6A 5M3MG 1IW7D 3WOEA 2IW3A 3GTKH 1BCPC 5E1FA 3H94A 3MXPA 2J4XA 4DUZL 1B70B 2A6HC 4GLXA 4XYQA 1WI5A 3J7ZC 2RCNA 2PQAB 2CH4A 5LL6S 1AEXA 2AWOA 5CV8A 2R92G 5JEAH 4P73A 1I4QA 1LT5D 4POFA 1HFGA 1NSNS 1ILQA 2WKDA 1VCIA 3I72A 2HCCA 4LF6L 1S5CD 4DR6Q 2CVRA 5I6WA 4OHJA 2AUKA 3X3NA 1STYA 3K7AB 5FLMG 1I6HB 1ENAA 2D0PA 4N9PA 3A74A 3EJIA 5C0XH 1AW7A 4U68A 2Q2TA 1HJPA 2DY8A 5C4HA 1RL2A 1VQCA 4DV3Q 2VNUD 3HRZC 5FOBB 4JI5Q 4Y7NH 5A2QE 2E5LL 1IBLQ 2B2WC 4HJ7A 4B3RQ 1X3QA 2LMCB 3GV3A 4DV5L 4JC0A 3N52A 2B8FA 2BH2A 1ASYA 1QJOA 1TT2A 4IZ8A 1PYBA 2ID0A 2B2VC 2NBFA 5I9OA 3MAQA 2F03A 2ASBA 5IP9H 2K5VA 2L5TA 2PQEA 4P74A 1W3SA 3CCEA 4BBRB 4JI2L 2O5IC 2VW9A 2NTTA 3OIPA 1VF7A 1XTDA 1CKNB 1CFMA 1M8AA 2IT1A 4GS3A 3HOYB 3OPOA 2UUAQ 1ESRA 1Q8KA 2RDFA 2F0FA 2KCTA 1UWVA 2RBMA 1O78A 2BE5C 3QJYA 2VQEL 5C44H 5ISRA 1QVFA 1HXYD 3G71A 5EKLA 4XYOA 3GTQB 4RKLA 5GAHC 2HT1A 1KRSA 4YY3Q 3MXUA 4BY1B 2A6ED 4R4QA 1VQFA 3I73A 4CJ1B 1Y1VH 5ELFA 3U50C 3HG9A 1TWGH 3VR2A 3S14B 3W5OA 1TWHH 1PV4A 1VQDA 1PH9A 5KIXA 3L2PA 5EPJA 3TP7A 3Q0AA 2JA5B 2OXPA 2D9UA 4NPSA 5C6AA 3H0GB 2N78A 2L4NA 4R8IA 3OYYA 5CV6A 4EX5A 1ASZA 1UE1A 4YIJA 3PUWA 3F2BA 4NXML 3NBHB 3PIO3 3EROA 1YNJC 1ET9A 1E1OA 2VL6A 1SYBA 1A63A 2Z0SA 3P7JA 4KKSA 3GQBA 1EFWA 4FXKC 4CKBA 4GZYC 1G6ZA 5CORA 1FNVA 3I90A 3VDYA 5BR8L 5FJ8G 2HDMA 4FXDA 4ME3A 2CWPA 1CQVA 2MHVA 1IYUA 3FMCA 2F1MA 1BR9A 4ODGA 3EBEA 1HNXQ 5JAVA 2B2YC 1EOTA 3T53B 2E2HH 4P72A 1SYFA 2EDGA 2A8VA 2L9HA 3TMEA 3S1NB 3DMUA 5CMDA 4X3SA 3RN2A 5IT9E 4A93G 1KDBA 1WD0A 1RJTA 2KQ3A 4NXNL 3KJPA 5KNCA 1WVLA 2ZJQA 2JA6B 4N8X1 5IYBG 2VQFL 4M1UB 5IGGA 5DEHA 1CM9A 1ENCA 2R61A 2MJ8A 4Y52H 1TS2A 1AE2A 3S2HB 2NVYB 4A3BG 1KAWA 1HRJA 1NJIC 4X66L 3U4VA 1WTWA 2ZTCA 5JJZA 4B3SL 3RNUA 1B9MA 2EYJA 5A2QL 2I46A 1KL9A 3M85A 3T1HL 1AZQA 5ELCA 2K75A 2Z4IA 2KHJA 4BY7B 3CXCA 4DV1L 3TEHB 1STEA 5C3EB 1D6EC 1JJCB 3PGZA 1FNWA 4V0BA 4LMQD 1KHIA 1K8GA 3D31A 4LF9Q 5JJLA 1JB3A 3EQLC 1BDOA 2AKWB 1QCBD 4XDXA 1MSHA 3CQZB 4H7BA 1OXUA 3S1MB 1I6HH 1ZXTA 2MNAA 1U5KA 2QF7A 4IFDJ 4KY6A 3UDXA 1CI3M 2IY5B 1EIYB 3KLWA 1KNEA 5EKIA 1RD9D 1I4GA 2WKCA 2CW0C 2D2CC 2WB1B 1CTMA 1D5ZC 2K5DA 5J39A 4QMGA 3SDZA 4HJ9A 2NN6I 1LV9A 3C1FA 1KTKA 1RTNA 3S1QB 1X3EA 1GXDC 1WTVA 2RSNA 4GN4B 4BBRH 5CV4A 4AYBG 1N34L 2V1CC 4DAMA 1PTOD 5C4XH 3QG1A 3CKIB 1IBKL 3RZOB 1GHKA 4AQYQ 3AB9A 1EEFD 2D62A 2QA4A 4XIGS 3PO2G 2RF4A 3M4PA 4X64L 1YJWA 1EZ8A 3KLSX 1DOKA 2NTSA 1CA6A 2NN6G 4DNIA 2LS01 2EJGC 3W1GA 3CCJA 4DV2Q 3A5ZB 4DV6Q 4DR2Q 1KNAA 1Y14B 4IO9A 3BYTB 4JI0L 3HOVG 2L15A 4K0KQ 3NE5B 1SLJA 3SK4A 3FPPA 4QQBX 1DZ1A 2XTIA 1O7IA 2VS1A 3TRZA 1D5MC 4RHSA 4X65Q 5LL6X 2JA8H 2R92H 1SNCA 1R4QB 5T1IA 2MQHA 5IGBA 5ELOA 4JOIC 4DR1L 2JA5H 4DUYL 1H9JA 2B63G 3H0GH 2EXZA 4OEMB 3ZJYC 2I5MX 1YZ6A 4BXXG 4DXFA 4R4TA 1A3TA 2N49A 1HQMC 4UAIA 2F0OA 4FVMA 3D4DA 4EQOA 3V96A 4L5RC 1X3PA 5DAUA 3SR1A 1YIJA 1EL0A 1PFSA 5AJ3L 2HDLA 1BCPD 3BZCA 4QB4A 4CKCA 4O2DA 1PZID 1VQIA 2Z6KA 2RKSA 4NW2A 1Y1WB 3KBXA 2NZHA 4LF4L 1ZYRC 2H1EA 3D8GA 1OXSC 3O13A 1STNA 3NTHA 3GTMB 1Q7YC 5C0XI 1NR4A 4ILWA 1CKNA 4YWLA 3GTJB 1LT4D 2DUDA 2LSSA 3PUXA 2EYHA 5KGUA 3E3XA 1L1OB 2F0UA 4DAVA 3OTOL 4CBVA 1FNUA 1G291 1N36Q 4PV1C 1EEID 1X54A 3S1NH 5IT9c 4CKEA 5A35A 1SE3A 4JBMA 3MWYW 4H13C 3QOJA 2FXQA 2SEBD 4R4OA 2K52A 2JA6H 2VUMB 2R7ZB 1CZGA 1EZ6A 2EY2A 4JYAQ 1UEBA 4WJ4A 2NVYH 1VQHA 4IPHA 4O42A 2B2TC 4LWCA 3W2DA 3BG3A 4HN7A 4M8AA 3I56A 1OXVA 3S24A 2YTVA 4HMJA 4C3IG 2ZM6L 1STAA 1QZHA 2FHTA 3WDNA 1JOKA 4BY7H 2JN4A 4LF7L 1STBA 3FDTA 5C3EH 1G91A 2QCPX 3CMAA 2UXDQ 1IYVA 1S5ED 1K0SA 1VQLA 3NBHA 4UDUC 5KNDA 3F2DA 3CQZH 4A3LH 1SFOH 1B3AA 1U0LA 1LTBD 1N33Q 2F0VA 1SRUA 2SNSA 2R3ZA 5M3FB 4AIMA 1CSPA 4LK1C 1LT6D 1Q8IA 2ICEC 1FJGL 2E74C 1PZJD 2R6GA 3D4WA 1X3FA 4OX9Q 4DR3Q 4P71A 1B4OA 2BE5D 4A3DB 3LNNA 3Q6SA 3EFXD 3NQIA 4OONA 1XMOQ 2RQXA 3K81C 1QZGA 1B9NA 4K6DA 3S2DB 2EYPA 4RAUC 3S1QH 2NYZD 1WD1A 3SE0A 2R7DA 3KFUA 4LF5Q 1BKBA 1R9TB 1I50B 3CAMA 1OO9B 2EE1A 1FD7D 2IX3A 1M1KC 2IX1A 4TVAB 1PDQA 1I6VC 4X6AH 3I3CA 1HR0W 2UUCL 1K0RA 1C9OA 2HIXA 4HR7B 1JCKB 5KEEA 2YYZA 5FO7B 3VYRA 3JAME 4DUZQ 1DD2A 3PF5A 1S40A 4Y7NB 3M4QA 1PTOB 1TS5A 1PFMA 2NZ1D 2GA4B 5E7NA 4DR4L 4MZ9A 4KJOA 1YNJD 4Z9CB 1GHJA 4RGMA 1F77A 1YHBA 3E0JA 4ULLA 1TWFH 4I7ZC 4PZ6A 1U4LA 2CQOA 1K8OA 3QWNA 3EA6A 4EQ5A 4KMUC 4LF6Q 1XWEA 4RGNA 4CDDC 3FVQA 4OGQC 1F2YA 1SXTA 1P8LA 3KK7A 2KHSA 4X62L 2FINB 2F0JA 3PO3G 3OOCA 2OTJA 3HKZB 1PVOA 1BBWA 5C44B 4K2KA 2HCIA 1Q1BA 2OT2A 1TXYA 2EPBA 2F0PA 4BS9A 1YI2A 1KD1C 3D6CA 2DY7A 1EU4A 2GVBA 4HAEA 2LXJA 1Y1WH 1SN8A 1V8QA 3K59A 1X3GA 4GOPB 3FPUB 2F4IA 4RCNA 4IUNA 3U58A 1X65A 3GTMH 3S17B 2F0TA 3E6ZX 2MUYA 1BCPB 5G3LD 3GTJH 1VMCA 2K5HA 3IL8A 1EIFA 1XJVA 4O0AA 4MNOA 5KYLA 4G7OC 4C3JB 2OF1A 2PI2A 1SYEA 2UXBL 2IHEA 2K6AA 2PPBC 5IGCA 2IJ0A 4ZUJA 1S4ZA 2YV5A 4UHVA 3BDCA 4CGYB 2B2UA 1GVPA 1XMQL 2XN9C 2E8GA 4C2MH 4A75A 3EVQA 1Q1EA 2VUMH 3L0OA 1J5EL 1VQ9A 1XNQQ 5E4WC 5IWAL 1EY6A 4TRDA 5C5MA 4PNYA 4KV6A 1XPRA 2JK8A 4KTAA 5CV5A 4X3TA 1D7QA 1EIHA 5M5WB 3DM1A 2EIFA 2ATWA 2CW0D 1N32L 2XVSA 3MZ5A 1HR0L 1GUWA 4IQZA 4RGOS 3LGJA 4DV4Q 4LFAL 1SMYD 3C1EA 4FYDA 3CD6A 1FL0A 2FFKB 1ILPA 4ZLTF 3HOUB 4PMCA 4CJ2C 4B3MQ 2VY3A 4A3CG 1A0IA 1SNPA 4JCVE 5CV9A 3I4OA 4A3KB 1E3PA 4HJAA 2OQKA 4UP7A 2MPMA 5COYA 5M3FH 1Y69U 3HOYG 2F52A 4KJNA 4A3JG 4BXXH 3KOJA 4QIWE 1AE3A 1IBMQ 1SEBD 3S16B 3BDOA 3AMUA 2KA7A 2KENA 1I4XA 3A55A 1B53A 3JAML 1EFID 4A3DH 1HUMA 1JORA 2DGYA 5CC4A 5KNBA 1DGSA 4A3EG 4DR7Q 3S2DH 4OO1H 1L1OA 4A3GG 2PNHA 1I3QB 1SR3A 1R9TH 1I50H 4BBSG 2AMCB 4HSPA 3T1YL 4JVZA 4A3MG 4MN3A 3K8AA 5I6YA 3I4MB 5IYDG 3J81c 1XYIA 4IURA 4QF4A 1BBXC 1K3RA 4DA2A 3H3VH 3A7AB 1U4RA 3C46A 3TREA 1K83B 1ESFA 4NXNQ 4QJFA 3JAMc 3FRPB 4ZKBB 4APVA 1G6PA 1PTOH 2VZAA 4GNXC 1TWAH 1NAPA 3NENA 5CBAE 4JK1C 1D8LA 4X66Q 2KUMA 1YHQA 1PRTD 2BA0A 1PMRA 2RDHA 1NMFA 2OWOA 1GUNA 4DK0A 3R2IA 3I4NG 4DV1Q 1ZYRD 2R93G 4C3IH 4R8NA 5C4XB 1HQRD 1N9WA 2PO4A 4PG3A 3ITPA 3DWPA 2EYFA 2PW5A 3KJOA 3TBIB 2WAQE 1PH5A 1W2BA 2EYLA 1RF2D 3VR6A 3Q23A 2I07B 2MO0A 2A68C 5M3MB 2UU9L 4JI6L 5HURA 1DOLA 5JVG3 3P1HA 4Q5VA 3PMFA 3PIP3 1CKOA 2KOLA 1LTGD 4K5VA 3RUZA 3PV0A 2J0TD 1A2TA 4IALA 2I5LX 3T4AC 4FF1A 1JWUD 2Z6BA 1Y8NB 4IPDA 2JA8B 2R92B 4TSSA 3CHBD 3S17H 2XRSD 1DONA 2EJMA 4QY7A 1A8VA 2Q2IA 4RH6A 4YHHL 3S15B 4C3JH 1HNZQ 2QW7A 1N34Q 3MFYA 1VQ7A 3K0YA 1TU2B 4IFDH 1HFNA 1E0BA 1O7LA 4ME5A 1WTQA 2N55A 4GN5A 2O5JC 2WINB 3TN2A 2DJGC 1EYDA 3IFTA 1SNQA 2RSOA 4GKJL 1KC8C 3NTIA 1QUQB 4CDEC 4OWWB 1K8MA 3FHWA 1L0YB 5K36H 3G6EA 1B1ZA 4V190 4JI8L 4KHPQ 3M9BA 3M3YB 1I4PA 2Z4HA 3E9IA 4KLKA 4RA8A 1BUVT 1EY0A 2LXKA 2MP1A 4YCWA 5BN3A 5M5WH 2C35B 3VYUA 2BDNA 3JC66 3KUPA 1CT1D 3V2TA 3MC0B 1XNRQ 4U673 2XSCA 1S5FD 1S5BD 1J6QA 3HOUH 1YNNC 2ZJPA 4DR1Q 5DM63 1K3BC 1G51A 4B3TQ 4A3KH 2VXWA 4DR6L 4ZYSA 1I5FA 1MHWC 3MVVA 3M4YA 2F0WA 4IOAA 3L7ZC 4XTCS 1DXMA 1AP0A 3TP6A 3K7UC 5GADC 1V1QA 4OELB 4J8QA 4GOPA 2E2IB 5AJ3Q 3S16H 3SK5A 4A3IG 3W1BA 3C3LA 4TQUS 4LFCL 3TP5A 1QNUA 1K28A 3HOXG 1VQ8A 4L8JA 5FO9B 4KHZA 4DV3L
chains in the Genus database with same CATH topology
4G57A 5IODA 5E3FA 3DHQA 1H9KA 1GUTA 1E2VA 1SFOB 2LKVA 1JICA 1HUNA 1D2BA 2HQEA 3H09A 4H44C 2DNEA 5CV7A 3ND8A 2PCFB 4HSVA 2F0SA 1D1IA 2NVXB 1IKLA 4C3HG 2JXMB 2G9DA 3CRKC 3GV6A 4P2CB 5BN4A 4DAPA 1JWSD 2B2WA 2Y0SB 1EY7A 4EGVA 2E76C 1PRTB 2F0GA 2B2VA 4IUVA 2M9VA 1II3A 4RHRA 3KLRA 1IW7C 2N88A 1BNZA 3SK8A 4FXGC 1EIGA 1W6JA 1IL8A 4EQNA 4NP5A 4H0LC 1ZKOA 4L63B 2K04A 5ELDA 1TWFB 4PMBA 1BQQT 2EY6A 1GUSA 1A15A 5D65A 4IUQA 4F87A 4QCLA 4RCOA 2EYMA 1AN8A 3E5SA 2JE6I 1V1PA 4OIKA 2WACA 3GO5A 3NWTA 4KD3A 2AQ1B 2QDBA 4HMIA 3H91A 2AQ3B 3RZDB 2DN8A 5IT9L 4RGTA 1WTRA 2F0LA 1TKWB 3IAYA 3D4RA 5KRUA 2BOSA 2A6HD 2F3VA 3TP8A 1GUGA 1H9SB 1JOQA 5JEAG 1U9RA 3K5MA 3PUYA 1LLRD 2L55A 1G2SA 3K5OA 4AYBB 4KN4C 1F9RA 3VYSA 3F2UA 1B50A 5M5XB 4C2MB 2B2YA 2F0QA 4FO2A 1DM0B 1HTPA 5JOBA 3PO2B 5C0XG 2XRQD 2C9OA 5DM73 4F88A 2Z8LA 1PTOF 4NKLA 1W6KA 1KLGD 1ENFA 1O7ZA 3I91A 3P20A 1EQVA 5EPLA 3HOVB 2Q8IB 5IGEA 1PZKD 1XX8A 1R4PB 2WP8J 3R2TA 1ONLA 2PMZB 3T56B 5FLXE 3K6OA 3BS1A 1SYDA 1Z7TA 2B63B 1VF5C 1NUCA 3A8KE 1ML0D 1TY0A 4E6IA 5EKKA 4K8IA 2ZXPA 3OSOA 2L11A 2O2LD 2RVLA 2A68D 2KCCA 5D3IB 2QILA 4CHTB 2TMPA 1T5XD 3GTOB 3ZYYX 1TIID 4PMWA 4DXGA 1GJXA 4K6LA 5ELEA 2FMMA 1JR0D 2A69C 1RHPA 3A56A 1BCPF 5FK9C 4IUPA 1EY4A 3J81E 2K01A 4J6HA 4NDXA 5T1GA 4FP5D 2KECA 4DNRB 2M2LA 2XNAC 5K5PA 2J7ZA 1TWCB 2IPKD 1DYQA 2EVBA 3AU7A 1TWAB 4Q0FA 3MTSA 1F2MA 1MD2D 3MHBA 4IUUA 5I2XA 3L9AX 1LABA 2K05A 4IN3A 4MIUA 3GTGB 4XXEA 1A3VA 5IGFA 3DUZA 2PW7A 4C3IB 4DFAA 3S1RB 1MSGA 5LHY1 2ZXOA 3MFGA 1LTSD 1BXTA 5BN5A 3NTKA 3OWFA 1T5EA 4QUCA 4HTHA 1CHPD 5IOCA 3VA5A 2K33A 2A74C 1HA5A 1SSOA 2LY7A 3DEPA 3OMCA 4FF4A 2L0CA 3BDLA 2E75C 3HEJA 4KN7C 1HHVA 1A6XA 5EJWA 3QOLA 4BA2I 1S5DD 4ZQ3A 5D14A 1UEAB 4KK7A 3MEHA 1NCVA 2F0NA 4ZUIA 4HEDA 1F2LA 1GOZA 2DNCA 1WTPA 2BCOA 3BZDB 1Q12A 3PUZA 2NVQB 1ZEQX 2IX0A 1RCVD 3OW7A 2AUJD 3Q24A 1BOSA 3I70A 1XTCD 2RDGA 3K5LA 2NN6H 4PQXA 1KLUD 4RWSC 3QO2A 2MGSA 5DNFA 1HPCA 4X3UA 5IGDA 5NUCA 1IHZA 1SYCA 4C1NI 1F9SA 1LTRD 1STHA 1ET6A 4XT1B 1I4RA 3VA7A 2B2TA 2PNRC 1EY9A 1CHQD 3J81L 1C48A 1I4HA 1LTAD 1M4VA 3D3RA 3PO3B 3HS0C 3U9SA 4RFBA 1H9SA 1CQFA 1Q90A 5CYUA 1PXUA 3OIQA 1D1KA 3IFDA 1QG7A 3N6RA 5C4ZA 1KDAA 1SNDA 3ND9A 4KKUA 3VR4A 1UAPA 3BVZA 1EWHA 1G2TA 3IKJA 5C4JB 3J7YW 3VR5A 1CZWA 1E2ZA 1V1PB 4X3KA 4NMZA 4LAAA 3SVMA 5CGKA 2ICIA 5G3LF 1RTOA 4HCEA 3H6MA 3CU7A 1PFNA 4G4KA 2LFNA 2B39A 4FF3A 4FNFA 4F8MA 4ZRZA 4ZK9B 1HA6A 2KEEA 1QE6A 3SHLA 2NWGA 1RDPD 3QB3A 3DWAA 3A8IE 1V43A 2EZVA 1AFPA 1A3UA 3G6JB 5EGTA 1O80A 5M9OA 3S9WA 2X69A 4J1MA 2X6LA 1MGSA 3CRLC 2EJFC 1B44D 1EYCA 4A3JB 3TZDA 4KKTA 4WRDA 3A54A 3LWEA 1Q3LA 2SOBA 2K03A 3J7AF 4A3EB 1QILA 3R8BA 1DCZA 4A3GB 1H9RA 5JEAJ 4BBSB 1QWYA 4A3MB 4BWGB 3TDQA 3OHXC 2JYOA 3K57A 3C2PA 1SJHD 4OIJA 3V05A 2OEOA 4C1NK 2F3WA 1ICWA 4K14A 1U4PA 3RLFA 1PFBA 2V4DA 3NSWA 3OWEB 2NB0A 5C0XJ 3T51B 1DOMA 1E2WA 4JBWA 1LO5D 4I65A 4G7HC 2F0MA 4B9WA 3NUCA 2A69D 3I4NB 4DU9A 3KBGA 2R93B 1Y8PB 1PRTF 3NXWA 3NHHA 1X32A 1LTID 3I8ZA 2Q8TA 5M5YB 3TZUA 1RKNA 3OMGA 4ZKCB 1MI2A 3RMHA 3SK6A 5EPKA 3DWQA 5C3XA 4EQPA 3MA2B 2FJ2A 2EY5A 3A7LA 4RKBA 3J80E 2BA1A 4DF7A 5JVH3 5F2DA 5JPMC 5EQ0A 2PZUA 4QUFA 1F2ZA 1STGA 1QOHA 3J7AV 4O1NA 2F0KA 4DN4M 3SEBA 2Z1CA 3WOFA 1OXTA 2K28A 1WTOA 1JQYD 4DNTB 1Y8OB 3VR3A 2ENBA 2PZWA 1BO0A 1TR5A 1G8ZD 5I2YA 2YU9B 3PUVA 4KHVA 2KJXA 2ZT9C 2K1BA 1SE2A 2Q8RE 1QB5D 1HCZA 4CJ0B 4F7XA 2X6GA 5ELBA 2D5DA 2JP1A 4KY7A 1BF4A 4XT3B 4TKOB 2QKIC 3DXJC 1SMYC 1A2UA 2KCNA 3I4LA 4ABNA 4A93B 2XWJB 3K5NA 2F0HA 4DK1A 4K8JA 1D5XC 2SNMA 5IIFA 4A3BB 1JE4A 2E2DC 2CQAA 4A3IB 2QEJC 4FF2A 1KDCA 2ZXRA 1KABA 2EYOA 2G9HD 2K5WA 2M00A 3HOXB 1C4QA 1EY5A 4IUTA 2A5HA 3R3OA 4ZAIA 3M7GA 1CK1A 2L1BA 1JWMD 1U4MA 2A73B 1TQOA 3GD7A 4LJZC 4OO1I 1MBYA 4XQQA 5KYIA 1WTXA 2F0IA 1NR2A 3GTPB 3MXNA 3W3AA 3X3MA 2JSOA 4C3HB 3T16A 1EY8A 1F9QA 2FMCA 1PRTC 4KI0A 1EWCA 1EYAA 2K7VA 3MXGA 3P75A 4OO1G 4K2LA 3NBIA 3J80L 2B2UC 5FKAC 2L12A 3HOZB 2NUCA 2NVTB 2CHBD 3M7NA 1TVXA 5TSSA 1SNOA 3NK9A 5C5LA 3KF8A 2C5CA 1O7YA 1J8IA 3NP8A 3LX0A 1WCMB 3A8JE 2JA7B 2A6EC 3HGBA 4K5XA 1XXGA 1TS3A 4WFN3 1L0XB 5AFWA 1VDZA 4DGZA 1H9MA 1B2TA 3GTLB 2VB2X 3BVGA 1SNMA 4A3FB 4K5WA 2JEBI 3K58A 3HOWB 3NWSA 2IWHA 1LTTD 1JC7A 3TSSA 5J1ZA 2PYKA 2KEDA 1Z6HA 3GTKB 3ONAB 5I4DA 2K5QA 3L3OC 3BYYB 4S3SA 4IFDI 5EBDA 3LWUA 4B08A 2H4OA 3HP3A 1QNKA 2BDOA 1KAAA 2WV6D 4C56C 1UNSA 2IL8A 4DAYA 4WJWA 4KY5A 3NQTA 5JPNC 4C3JG 4WORA 4IFDG 4EVOA 1CA5A 3U9OA 2KVMA 4L6TB 5FO8B 3VYTA 2O4XA 3FKIB 4N9TA 4XQNA 5K36G 4XQJA 1GUOA 1EU3A 2AWNA 1IKMA 5J22A 3GP7A 5HGTA 4ID6A 2HUGA 1J9OA 1SJED 5E4XA 5CR3A 2EY1A 1UUPA 3KLSA 3URYA 2RA4A 1LT3D 2WIIB 1V1OA 5EBCA 1YNND 1PYWD 4HCSA 4QIWB 1C8CA 1F9PA 1FGBD 2K32A 1EQTA 3Q22A 1OXXK 2XWBB 5CBEE 1DJRD 2SDFA 3RD4A 3NPPA 4OL7A 2TSSA 4B9XA 3H3VC 2XIWA 1SDFA 4MHEA 1Y1VB 2E2JB 2F0DA 1FR3A 4KD4A 3T13A 2EOTA 1TWGB 1PTOC 1AZPA 5I9PA 1TWHB 1TS4A 3G7LA 5FLXL 2B8GA 1JOOA 3FEWX 1HTLD 4G7ZC 1VMPA 3D6WA 3ERQA 2F0EA 2VB3X 3M4OB 1SE4A 2AQ2B 4R9WA 1FYCA 5C3WA 3UI2A 4BA1I 2WAQB 1Z47A 1TY2A 1SBBB 5D3DA 2PZTA 3BVMA 2E2HB 1LACA 3HZXA 2JEAI 3DEOA 1RODA 3SXHA 3R93A 1SAPA 3QIAA 1PLFA 1SYGA 1IW7D 3WOEA 2IW3A 1BCPC 5E1FA 3H94A 3MXPA 2J4XA 2A6HC 4XYQA 5LL6S 1AEXA 2AWOA 5CV8A 5JEAH 1I4QA 1LT5D 1HFGA 1NSNS 1ILQA 2WKDA 1VCIA 3I72A 2HCCA 1S5CD 2CVRA 5I6WA 4OHJA 2AUKA 3X3NA 1STYA 3K7AB 1I6HB 1ENAA 4N9PA 3EJIA 5C0XH 1AW7A 4U68A 2DY8A 5C4HA 2VNUD 3HRZC 5FOBB 5A2QE 2B2WC 1X3QA 2LMCB 3GV3A 3N52A 2B8FA 1QJOA 1TT2A 4IZ8A 5I9OA 2ID0A 2B2VC 2NBFA 3MAQA 2F03A 2L5TA 2PQEA 4BBRB 2O5IC 2NTTA 3OIPA 1VF7A 1CFMA 1M8AA 2IT1A 3HOYB 3OPOA 1ESRA 2RDFA 2F0FA 2RBMA 1O78A 2BE5C 3QJYA 5ISRA 1HXYD 5EKLA 4XYOA 3GTQB 4RKLA 4BY1B 3MXUA 2A6ED 3I73A 4CJ1B 5ELFA 3HG9A 3VR2A 3S14B 5KIXA 5EPJA 3TP7A 3Q0AA 2JA5B 2OXPA 2D9UA 5C6AA 3H0GB 2L4NA 4R8IA 5CV6A 4YIJA 3PUWA 3PIO3 3EROA 1YNJC 1ET9A 1SYBA 3P7JA 4KKSA 3GQBA 4FXKC 4CKBA 4GZYC 1G6ZA 5CORA 1FNVA 3I90A 2HDMA 4FXDA 3FMCA 1CQVA 2MHVA 1IYUA 2F1MA 1BR9A 4ODGA 5JAVA 2B2YC 1EOTA 3T53B 1SYFA 2EDGA 2L9HA 3TMEA 3S1NB 3DMUA 5CMDA 4X3SA 5IT9E 1KDBA 1WD0A 1RJTA 2KQ3A 5KNCA 1WVLA 2JA6B 4M1UB 5IGGA 5DEHA 1CM9A 1ENCA 2R61A 2MJ8A 1TS2A 3S2HB 2NVYB 1HRJA 1WTWA 5JJZA 1B9MA 2EYJA 5A2QL 2I46A 3M85A 1AZQA 5ELCA 2Z4IA 4BY7B 1STEA 5C3EB 1D6EC 1FNWA 4V0BA 4LMQD 3D31A 1JB3A 3EQLC 1BDOA 1QCBD 4XDXA 1MSHA 3CQZB 4H7BA 1OXUA 3S1MB 1ZXTA 2QF7A 4IFDJ 4KY6A 1CI3M 1KNEA 5EKIA 1RD9D 1I4GA 2WKCA 2CW0C 2D2CC 2WB1B 1CTMA 1D5ZC 2K5DA 5J39A 4QMGA 3SDZA 2NN6I 1LV9A 3C1FA 1KTKA 1RTNA 3S1QB 1GXDC 1WTVA 2RSNA 5CV4A 1PTOD 3QG1A 3CKIB 1GHKA 3RZOB 3AB9A 1EEFD 2D62A 4XIGS 1EZ8A 3KLSX 1DOKA 2NTSA 1CA6A 2NN6G 2LS01 2EJGC 1KNAA 3BYTB 3NE5B 3SK4A 3FPPA 1DZ1A 1D5MC 4RHSA 5LL6X 1SNCA 1R4QB 5T1IA 5IGBA 1H9JA 2EXZA 4DXFA 1A3TA 1HQMC 4UAIA 2F0OA 4FVMA 3D4DA 4EQOA 3V96A 1X3PA 5DAUA 3SR1A 1EL0A 2HDLA 1BCPD 4CKCA 4QB4A 1PZID 2RKSA 4NW2A 1Y1WB 3KBXA 1ZYRC 2H1EA 3D8GA 1OXSC 3O13A 1STNA 3NTHA 3GTMB 5C0XI 1NR4A 4ILWA 3GTJB 1LT4D 5KGUA 3PUXA 2EYHA 2F0UA 4DAVA 4CBVA 1FNUA 1G291 4PV1C 1EEID 4CKEA 5A35A 1SE3A 3MWYW 4H13C 3QOJA 2SEBD 2VUMB 2R7ZB 1CZGA 1EZ6A 2EY2A 4O42A 2B2TC 3W2DA 3BG3A 4HN7A 4M8AA 1OXVA 4HMJA 4C3IG 1STAA 2FHTA 3WDNA 1JOKA 1STBA 3FDTA 1G91A 2QCPX 1IYVA 1S5ED 3NBHA 4UDUC 5KNDA 1B3AA 1LTBD 2F0VA 2SNSA 2R3ZA 5M3FB 4LK1C 1LT6D 1Q8IA 2ICEC 2E74C 1PZJD 2R6GA 3D4WA 1B4OA 2BE5D 4A3DB 3LNNA 3Q6SA 3EFXD 3NQIA 2RQXA 1B9NA 4K6DA 3S2DB 2EYPA 4RAUC 2NYZD 1WD1A 3SE0A 1R9TB 1I50B 1OO9B 2EE1A 1FD7D 2IX3A 2IX1A 1PDQA 1I6VC 3I3CA 4HR7B 1JCKB 5KEEA 2YYZA 5FO7B 3VYRA 3JAME 1DD2A 4Y7NB 1PTOB 1TS5A 1PFMA 2NZ1D 2GA4B 4KJOA 1YNJD 4Z9CB 1GHJA 4RGMA 1F77A 3E0JA 4ULLA 4I7ZC 1U4LA 1K8OA 3QWNA 3EA6A 4KMUC 1XWEA 4RGNA 3FVQA 4OGQC 1F2YA 1SXTA 3KK7A 2KHSA 2FINB 2F0JA 3OOCA 3HKZB 5C44B 4K2KA 2HCIA 1Q1BA 2OT2A 2EPBA 2F0PA 4BS9A 3D6CA 2DY7A 1EU4A 4HAEA 1V8QA 3K59A 3FPUB 2F4IA 4RCNA 4IUNA 3S17B 2F0TA 3E6ZX 2MUYA 1BCPB 5G3LD 1VMCA 3IL8A 5KYLA 4G7OC 4C3JB 2OF1A 1SYEA 2K6AA 2PPBC 5IGCA 2IJ0A 4ZUJA 1S4ZA 3BDCA 4CGYB 2B2UA 2XN9C 3EVQA 1Q1EA 5E4WC 1EY6A 4TRDA 5C5MA 4PNYA 4KV6A 4KTAA 5CV5A 4X3TA 1EIHA 5M5WB 3DM1A 2CW0D 2XVSA 3MZ5A 1GUWA 4IQZA 4RGOS 1SMYD 3C1EA 4FYDA 2FFKB 1ILPA 4ZLTF 3HOUB 4PMCA 4CJ2C 1SNPA 5CV9A 4A3KB 2MPMA 5COYA 1Y69U 4KJNA 1SEBD 3S16B 3BDOA 3AMUA 2KA7A 3A55A 1I4XA 1B53A 3JAML 1EFID 1HUMA 1JORA 5KNBA 5CC4A 4OO1H 1I3QB 4HSPA 4MN3A 5I6YA 3I4MB 1XYIA 4IURA 4QF4A 1BBXC 4DA2A 3A7AB 1U4RA 3C46A 1K83B 1ESFA 3FRPB 4ZKBB 1PTOH 1NAPA 5CBAE 4JK1C 2KUMA 1PRTD 2BA0A 1PMRA 2RDHA 1GUNA 4DK0A 3R2IA 1ZYRD 4R8NA 5C4XB 1HQRD 2PO4A 3ITPA 3DWPA 2EYFA 2PW5A 3TBIB 2EYLA 1RF2D 3VR6A 3Q23A 2I07B 2A68C 5M3MB 5HURA 1DOLA 5JVG3 3P1HA 4Q5VA 3PMFA 3PIP3 2KOLA 1LTGD 4K5VA 3RUZA 3PV0A 2J0TD 1A2TA 4IALA 3T4AC 4FF1A 1JWUD 2JA8B 1Y8NB 2R92B 4TSSA 3CHBD 2XRSD 1DONA 2EJMA 4RH6A 3S15B 3MFYA 3K0YA 1TU2B 4IFDH 1HFNA 1E0BA 1O7LA 4ME5A 1WTQA 2N55A 2O5JC 2WINB 3TN2A 1EYDA 3IFTA 1SNQA 2RSOA 3NTIA 1K8MA 1L0YB 5K36H 1B1ZA 4V190 3M3YB 1I4PA 2Z4HA 4RA8A 1BUVT 1EY0A 2MP1A 5BN3A 3VYUA 2BDNA 3KUPA 1CT1D 3V2TA 3MC0B 4U673 2XSCA 1S5FD 1S5BD 1YNNC 5DM63 2VXWA 4ZYSA 3MVVA 3M4YA 2F0WA 3L7ZC 4XTCS 1DXMA 1AP0A 3TP6A 4J8QA 2E2IB 3SK5A 3C3LA 4TQUS 3TP5A 1QNUA 4L8JA 5FO9B 4KHZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GJX A;  1VDZ A;  3PUX A;  4IQZ A;  1Y8P B;  5JEA H;  1H9M A;  1H9K A;  1GUT A;  1OXX K;  2D2C C;  1CTM A;  2CW0 C;  2A69 C;  2DN8 A;  3OW7 A;  3PUZ A;  2AUJ D;  1A6X A;  3SDZ A;  1G29 1;  4PV1 C;  2JEB I;  1TKW B;  1E2V A;  3PUW A;  1GHJ A;  3D4R A;  1VCI A;  2NN6 I;  5A35 A;  3I72 A;  2A69 D;  4H13 C;  3TZU A;  2A6H D;  1YNJ C;  4I7Z C;  3PV0 A;  2NN6 H;  1K8O A;  1GUG A;  1Y8N B;  1H9S B;  4KMU C;  4KKS A;  1Y69 U;  2AUK A;  3GQB A;  4H44 C;  4GZY C;  1Z6H A;  2EJM A;  2DNE A;  4DNR B;  5JEA G;  3QG1 A;  1HPC A;  1GHK A;  3ND8 A;  2PCF B;  3A8I E;  1FR3 A;  3AB9 A;  1V43 A;  3FMC A;  4OGQ C;  3BDO A;  1IYU A;  3BG3 A;  5C0X H;  2KA7 A;  3GD7 A;  3PUY A;  2EVB A;  4LJZ C;  1OXV A;  2D62 A;  2F1M A;  3LWU A;  4XIG S;  3MFY A;  3T53 B;  3A7L A;  2JXM B;  3OOC A;  1TU2 B;  2B8G A;  3WDN A;  2BA1 A;  5KNB A;  3VA7 A;  4IFD H;  2BDO A;  1O7L A;  2PNR C;  2NN6 G;  4KN4 C;  4OO1 H;  2EJG C;  3CRL C;  2O5J C;  4G7Z C;  3CRK C;  2EJF C;  2EDG A;  1LAB A;  1Q1B A;  4KKT A;  2LMC B;  1IYV A;  3IFT A;  5BN4 A;  3W3A A;  2B8F A;  1HTP A;  1K8M A;  3NE5 B;  4KHZ A;  5KND A;  3FPP A;  5C0X G;  1QJO A;  5K36 H;  1V8Q A;  5KNC A;  1OXT A;  3U9S A;  2L5T A;  2E76 C;  1H9S A;  4RCN A;  4KI0 A;  4IFD G;  3A7A B;  1DCZ A;  1Q90 A;  4DNT B;  2O5I C;  1FYC A;  2K7V A;  5BN3 A;  1H9R A;  5BN5 A;  4OO1 G;  3P20 A;  1Y8O B;  4LK1 C;  3VR3 A;  1VF7 A;  1T5E A;  2Q8I B;  2E74 C;  2R6G A;  4BA1 I;  3KLR A;  3N6R A;  1CFM A;  1IW7 C;  2IT1 A;  4G7O C;  1H9J A;  3OPO A;  3PUV A;  1B9M A;  3ND9 A;  2ZT9 C;  4KKU A;  2BE5 D;  3VR4 A;  3LNN A;  2PPB C;  2K33 A;  4JK1 C;  5K36 G;  1GUO A;  1LAC A;  1YNN C;  3M85 A;  2JEA I;  4H0L C;  1ZKO A;  1HCZ A;  1B9N A;  1O78 A;  1ONL A;  2BE5 C;  3QJY A;  1HQM C;  1EWH A;  2BA0 A;  1PMR A;  3IKJ A;  2D5D A;  3T56 B;  3M7N A;  3SE0 A;  3VR5 A;  2E75 C;  4KN7 C;  1Q1E A;  4TKO B;  1Z7T A;  3M4Y A;  3QIA A;  1E2Z A;  2V4D A;  3RLF A;  3L7Z C;  1GUN A;  3D31 A;  1SMY C;  3DXJ C;  1GUS A;  1VF5 C;  4DK0 A;  3MXU A;  4XTC S;  1DXM A;  1IW7 D;  1BDO A;  2A6E D;  3A8K E;  3EQL C;  3I73 A;  3T51 B;  3A8J E;  4BA2 I;  3H94 A;  1OXU A;  3I4L A;  1I6V C;  1ZYR C;  2A6E C;  2QF7 A;  3HGB A;  1OXS C;  2JE6 I;  3VR2 A;  1E2W A;  4JBW A;  4DK1 A;  2A6H C;  4TQU S;  4HR7 B;  2A68 D;  2KCC A;  1CI3 M;  4G7H C;  2DNC A;  3VR6 A;  2YYZ A;  4L8J A;  2K32 A;  1DD2 A;  1Q12 A;  2AWO A;  2A68 C; 
#chains in the Genus database with same CATH topology
 4G57 A;  4JI5 L;  5IOD A;  5E3F A;  3TQY A;  3DHQ A;  1MKH A;  1I3Q H;  1H9K A;  1GUT A;  1IBL L;  5H1S E;  2G5D A;  1E2V A;  3I4M H;  1SFO B;  3OTO Q;  2LKV A;  1JIC A;  4I7A A;  1HUN A;  4LF8 L;  1D2B A;  1K83 H;  2HQE A;  3H09 A;  4H44 C;  1PH7 A;  2DNE A;  1OTC A;  1LM0 A;  5CV7 A;  3ND8 A;  2PCF B;  4HSV A;  2F0S A;  1D1I A;  3AYH B;  3CP0 A;  4DV0 Q;  2UUA L;  1IKL A;  2NVX B;  4C3H G;  2JXM B;  4LNQ A;  2G9D A;  1SMX A;  2N3S A;  2K50 A;  3CRK C;  3GV6 A;  1K73 C;  4P2C B;  5BN4 A;  4DR5 Q;  4DAP A;  1JWS D;  4GKK Q;  2B2W A;  2Y0S B;  3STB C;  4QGU A;  3HOZ G;  1EY7 A;  4EGV A;  1X56 A;  4R1J A;  2E76 C;  5GAE C;  4MTN A;  1PRT B;  1NY4 A;  3J81 i;  5HY6 A;  2F0G A;  1GM5 A;  1PH3 A;  2B2V A;  4IUV A;  1HZC A;  4DPG A;  5IP7 H;  3ULP A;  2M9V A;  1II3 A;  4A3C H;  4HID A;  4RHR A;  3KLR A;  5M3M H;  1IW7 C;  2N88 A;  1BNZ A;  3SK8 A;  3AFP A;  4FXG C;  3JAM i;  1EIG A;  1MIU A;  1W6J A;  1IL8 A;  1WCM G;  4EQN A;  4NP5 A;  1FJG Q;  2JA7 G;  4H0L C;  1ZKO A;  4L63 B;  2K04 A;  4OXP A;  2R7Z G;  5ELD A;  1TWF B;  4PMB A;  1XPO A;  1BQQ T;  3AEV A;  2EY6 A;  1GUS A;  1A15 A;  1EOV A;  3G48 A;  4JBJ A;  5D65 A;  4POG A;  4IUQ A;  4F87 A;  3I2Z A;  4QCL A;  4RCO A;  2EYM A;  1AN8 A;  3E5S A;  4A3E H;  3S15 H;  1HNW Q;  2JE6 I;  4A3F G;  2UUB Q;  1V1P A;  3KYH C;  4OIK A;  2WAC A;  3GO5 A;  3NWT A;  1HNX L;  4KD3 A;  3HOW G;  2AQ1 B;  2QDB A;  3DLL A;  4HMI A;  3H91 A;  4IOC A;  1Q46 A;  2AQ3 B;  3RZD B;  5FLM H;  2DN8 A;  5IT9 L;  3ICE A;  4QL5 A;  4RGT A;  1WTR A;  2F0L A;  1TKW B;  3EN2 A;  3IAY A;  3D4R A;  5KRU A;  2BOS A;  5GQO A;  4LFB Q;  1Q86 C;  2OTL A;  2A6H D;  3M3Y H;  2F3V A;  3TP8 A;  1GUG A;  1H9S B;  1FGU A;  1JOQ A;  3H3V I;  5JEA G;  2JJQ A;  1U9R A;  3I55 A;  3K5M A;  3CCU A;  3PUY A;  4WJ3 M;  1LLR D;  2L55 A;  2WB1 E;  4P75 A;  5GAG C;  1G2S A;  3K5O A;  4AYB B;  4KN4 C;  1F9R A;  3VYS A;  3F2U A;  1B50 A;  5M5X B;  4X62 Q;  4C2M B;  2A1A A;  2B2Y A;  1X6O A;  2F0Q A;  2HHH Q;  3CCV A;  4FO2 A;  4JG2 A;  5M5Y H;  4JV5 L;  4LF9 L;  2ZTD A;  1DM0 B;  1HTP A;  5JOB A;  3PO2 B;  3FKI G;  5C0X G;  2XRQ D;  2C9O A;  1AH9 A;  5DM7 3;  4F88 A;  2E2I H;  2Z8L A;  1PTO F;  4NKL A;  2Y0S E;  1W6K A;  4JI7 L;  5J3B A;  1KLG D;  2KBN A;  1ENF A;  1O7Z A;  3I91 A;  3FP9 A;  3Q8D A;  3P20 A;  2PI2 E;  1UE7 A;  5GRO A;  1EQV A;  2K5N A;  5EPL A;  3HOV B;  2Q8I B;  5IGE A;  1PZK D;  4ZCK A;  1XX8 A;  1LTL A;  1R4P B;  3J80 c;  1B3Q A;  2WP8 J;  1ICF B;  3R2T A;  1ONL A;  1HZB A;  2PMZ B;  3T56 B;  5FLX E;  3K6O A;  3BS1 A;  1SYD A;  1VS0 A;  1Z7T A;  2B63 B;  1QUQ A;  1VF5 C;  3RLN A;  1NUC A;  3A8K E;  1ML0 D;  1K8A C;  1KIX A;  1TY0 A;  4E6I A;  5EKK A;  3NEL A;  4K8I A;  2HQL A;  2ZXP A;  3OSO A;  1J5E Q;  2L11 A;  2O2L D;  2RVL A;  3B6Y A;  5IWA Q;  4HIO A;  2A68 D;  2KCC A;  5D3I B;  2NVX H;  2QIL A;  4CHT B;  2TMP A;  1I94 Q;  1T5X D;  3GTO B;  3ZYY X;  1TII D;  4PMW A;  4DXG A;  4JI4 L;  1GJX A;  4K6L A;  5ELE A;  1VQ5 A;  2FMM A;  3BJU A;  4JI3 L;  1JR0 D;  5FJ8 H;  4DV2 L;  2A69 C;  4L5T A;  4DV6 L;  5LMN W;  1RHP A;  3K0X A;  1N32 Q;  3GDE A;  1Y1V G;  1HR0 Q;  3A56 A;  1BCP F;  3J81 j;  4DV7 Q;  5FK9 C;  4LFA Q;  4IUP A;  1EY4 A;  2HIV A;  3J81 E;  4X65 L;  2K01 A;  4J6H A;  1EQR A;  4NDX A;  5T1G A;  4FP5 D;  2KEC A;  3E9H A;  2D0O A;  4DNR B;  2M2L A;  2XNA C;  1S72 A;  4H02 A;  5K5P A;  2J7Z A;  4A93 H;  1TWC B;  2IPK D;  1DYQ A;  2EVB A;  3AU7 A;  1TWA B;  4Q0F A;  3MTS A;  5IYB H;  1F2M A;  1MD2 D;  3MHB A;  3RN5 A;  4HIM A;  4IUU A;  5I2X A;  1JB7 A;  4A3B H;  2WFW A;  3L9A X;  1LAB A;  2CH4 W;  2K05 A;  4IN3 A;  4MIU A;  2CCZ A;  3GTG B;  4XXE A;  1A3V A;  1EYG A;  5IGF A;  3DUZ A;  2PW7 A;  2WAQ G;  1B8A A;  3UDF A;  1IL2 A;  4C3I B;  2B29 A;  4DFA A;  3S1R B;  1YIT A;  1MSG A;  5LHY 1;  2ZXO A;  3MFG A;  1LTS D;  1BXT A;  5BN5 A;  3NTK A;  3OWF A;  1EUJ A;  1T5E A;  1CKM A;  3PF4 A;  4QUC A;  4HTH A;  1CHP D;  5IOC A;  1NNX A;  3KDF B;  3RZD H;  3VA5 A;  1E7Z A;  4FDB A;  3CPF A;  1Q82 C;  2K33 A;  1WJJ A;  2A74 C;  1HA5 A;  1N36 L;  1SSO A;  1PH4 A;  2LY7 A;  4JOI A;  1GD7 A;  2E5L Q;  3DEP A;  3OMC A;  3OW2 A;  4FF4 A;  2L0C A;  3UE0 A;  3BDL A;  2E75 C;  3HEJ A;  4KN7 C;  1HHV A;  4DV5 Q;  1A6X A;  2Q2H A;  3CME A;  5EJW A;  1VQA A;  3QOL A;  4BA2 I;  1B7Y B;  4JYA L;  1S5D D;  4ZQ3 A;  5D14 A;  1UEA B;  4KK7 A;  3MEH A;  1NCV A;  2F0N A;  1RIP A;  4JI2 Q;  2ALY B;  4ZUI A;  2K14 A;  4HED A;  1JJ2 A;  1F2L A;  1GOZ A;  2DNC A;  1WTP A;  2BCO A;  3BZD B;  1Q12 A;  3PUZ A;  2NVQ B;  1ZEQ X;  2IX0 A;  5M5X H;  1VQ4 A;  1RCV D;  1H95 A;  3EIV A;  3OW7 A;  2AUJ D;  2CKZ B;  3Q24 A;  2UXD L;  1BOS A;  3RR5 A;  2ZTE A;  3I70 A;  2VQE Q;  2UU9 Q;  3PO2 H;  4JI6 Q;  1L0W A;  5LMN L;  1XTC D;  2RDG A;  3K5L A;  2NN6 H;  4PQX A;  1N33 L;  4N8F A;  1KLU D;  4IPC A;  4RWS C;  3QO2 A;  2MGS A;  5DNF A;  1HPC A;  4X3U A;  3NEM A;  3HOV H;  5IGD A;  5IY0 A;  5NUC A;  1IHZ A;  1SYC A;  4OX9 L;  1F9S A;  1LTR D;  1STH A;  4C1N I;  1ET6 A;  4JI1 L;  4XT1 B;  3F2C A;  1I4R A;  3VA7 A;  2B2T A;  4YHH Q;  1XMO L;  2PNR C;  2H5X A;  1V9P A;  5FLX c;  4BBR G;  1EY9 A;  4GNX B;  2R7F A;  4DKA C;  3CF5 A;  1Q81 C;  1HH2 P;  2RHS B;  3STB D;  2B63 H;  1CHQ D;  4NXM Q;  3J81 L;  1C48 A;  1I4H A;  1LTA D;  1M4V A;  3D3R A;  3PO3 B;  3HS0 C;  3U9S A;  4RFB A;  1H9S A;  1YNX A;  4JPB W;  1PA6 A;  1UE6 A;  1CQF A;  1Q90 A;  3MEF A;  5CYU A;  1PXU A;  3OIQ A;  1D1K A;  3ERS X;  3IFD A;  4JI8 Q;  1QG7 A;  3UDI A;  5BR8 Q;  3GTO H;  3E0E A;  3N6R A;  5C4Z A;  3PCO B;  3HKZ E;  4BY1 G;  3HKS A;  1KDA A;  1SND A;  3ND9 A;  3J7A 5;  4KKU A;  3VR4 A;  3CCR A;  1UAP A;  3J80 i;  3BVZ A;  4RG1 A;  2GN5 A;  2JA8 G;  2K4K A;  1CUK A;  1EWH A;  3DM3 A;  1G2T A;  3IKJ A;  5C4J B;  3J7Y W;  3VR5 A;  2OQ0 A;  2UXC L;  1CZW A;  2F4V L;  1E2Z A;  4OWX B;  1V1P B;  4X3K A;  2MO1 A;  2JA5 G;  4NMZ A;  4LAA A;  2RCF A;  3SVM A;  3H0G G;  5CGK A;  1WFQ A;  5LMU L;  1GO3 E;  2ICI A;  1EQQ A;  1TWC H;  5G3L F;  2VQF Q;  1RTO A;  1C7Y A;  1VQG A;  4HCE A;  3H6M A;  3CU7 A;  3FKI H;  1PFN A;  2KHI A;  4G4K A;  4B3S Q;  2LFN A;  4LFC Q;  2B39 A;  4L5S A;  4FF3 A;  4FNF A;  3QR8 A;  3GTG H;  4F8M A;  3T1H Q;  1E22 A;  4ZRZ A;  3MXN B;  4PZ7 A;  4ZK9 B;  1HA6 A;  2HD3 A;  2KEE A;  2AHO B;  3S1R H;  1QE6 A;  3SHL A;  2NWG A;  5JJI A;  1RDP D;  3QB3 A;  3DWA A;  2EQS A;  3A8I E;  1V43 A;  2EZV A;  3PQI A;  4LF8 Q;  1AFP A;  1A3U A;  3G6J B;  5EGT A;  1O80 A;  5M9O A;  3S9W A;  2X69 A;  3CCS A;  2JA6 G;  4J1M A;  2X6L A;  3AFQ A;  1MGS A;  3CRL C;  2EJF C;  4YCU A;  1B44 D;  1EYC A;  1L2F A;  3AQQ A;  4A3J B;  3TZD A;  4KKT A;  4WRD A;  3KF8 B;  2B3G A;  3A54 A;  1XNQ L;  3LWE A;  1Q3L A;  1XPU A;  2SOB A;  2K03 A;  3J7A F;  4GLA C;  2KCM A;  4A3E B;  1QIL A;  3ULJ A;  1MJE A;  3R8B A;  1DCZ A;  4A3G B;  4BY7 G;  1H9R A;  1SE8 A;  4IJL A;  2OCE A;  5JEA J;  1IBK Q;  4BBS B;  5C3E G;  3PSI A;  2E2J H;  4R4C A;  2NVQ H;  1QWY A;  4A3M B;  4BWG B;  3TDQ A;  3OHX C;  4R4I A;  2JYO A;  3TS2 A;  3K57 A;  3C2P A;  4DV4 L;  1SJH D;  5IE8 A;  4X64 Q;  4OIJ A;  3V05 A;  2OEO A;  4A3L G;  4C1N K;  4B3M L;  2Z6K C;  2F3W A;  1ICW A;  4K14 A;  2YTX A;  1HZ9 A;  1U4P A;  1BVS A;  3CCL A;  4JI0 Q;  1PFB A;  3NSW A;  2V4D A;  3RLF A;  1YJN A;  3OWE B;  3CPW A;  3D0F A;  2NB0 A;  5C0X J;  3T51 B;  2WB1 G;  2ZJR A;  3M4O H;  1DOM A;  1IBM L;  1E2W A;  4JBW A;  1LO5 D;  4I65 A;  4G7H C;  2F0M A;  4B9W A;  3NUC A;  2A69 D;  3I4N B;  4DU9 A;  3KDF A;  4DR7 L;  4DUY Q;  3KBG A;  2R93 B;  1Y8P B;  2Q2U A;  1WOC A;  1PRT F;  4HIK A;  1YEZ A;  3NXW A;  3NHH A;  1X32 A;  1LTI D;  2Y0S G;  2IHF A;  3I8Z A;  2Q8T A;  4DAY B;  4DK6 C;  2I0Q A;  5M5Y B;  3TZU A;  3PO3 H;  1RKN A;  3OMG A;  4ZKC B;  1MI2 A;  2QGQ A;  3RMH A;  3I7F A;  3SK6 A;  5EPK A;  1E24 A;  3DWQ A;  4LF4 Q;  4GLV B;  5C3X A;  4B3R L;  4EQP A;  3MA2 B;  2FJ2 A;  2EY5 A;  3A7L A;  4RKB A;  3J80 E;  2BA1 A;  2JA9 A;  4DF7 A;  5JVH 3;  5C4J H;  5F2D A;  5JPM C;  4AH6 A;  1JMC A;  5EQ0 A;  2PZU A;  4QUF A;  1F2Z A;  1STG A;  1CSQ A;  1LYL A;  1QOH A;  3J7A V;  3CCM A;  4JBK A;  3CC7 A;  4O1N A;  2F0K A;  4DN4 M;  3SEB A;  2Z1C A;  3WOF A;  3UDG A;  1OXT A;  1E1T A;  2K28 A;  1WTO A;  1JQY D;  4JV5 Q;  4DNT B;  3K80 C;  1Y8O B;  2EXD A;  2ENB A;  2F3I A;  2PZW A;  3VR3 A;  3KF6 A;  1BO0 A;  1TR5 A;  3K7A H;  4JI7 Q;  1G8Z D;  5I2Y A;  2YU9 B;  3PUV A;  4KHV A;  1VQO A;  2KJX A;  2ZT9 C;  2ZM6 Q;  2K1B A;  1Y1W G;  1SE2 A;  2Q8R E;  1QB5 D;  1HCZ A;  4YY3 L;  4LF7 Q;  4CJ0 B;  4F7X A;  2X6G A;  5ELB A;  4GNX A;  2D5D A;  2JP1 A;  4KY7 A;  1BF4 A;  4XT3 B;  4TKO B;  2QKI C;  3DXJ C;  1SMY C;  1A2U A;  5IYC G;  4J15 A;  2KCN A;  5DLQ E;  3I4L A;  1VQN A;  4YCV A;  4ABN A;  4A93 B;  2XWJ B;  3K5N A;  2F0H A;  4DK1 A;  4K8J A;  1HNZ L;  1D5X C;  2SNM A;  3CCQ A;  5IIF A;  3HOY H;  2VUM G;  4A3J H;  4A3B B;  1JE4 A;  2E2D C;  2PQA A;  2CQA A;  4A3I B;  5HGQ A;  2QEJ C;  4FF2 A;  1KDC A;  4ALP A;  4UP9 A;  2ZXR A;  1KAB A;  4JI4 Q;  3BZK A;  2EYO A;  2G9H D;  2K5W A;  2M00 A;  4JI3 Q;  3HOX B;  1C4Q A;  4CDF C;  4KHP L;  3GTQ H;  1EY5 A;  1KRT A;  4BY1 H;  4A3G H;  4IUT A;  3CC2 A;  1PH8 A;  2A5H A;  3R3O A;  4BBS H;  1PYS B;  4ZAI A;  3M7G A;  1CK1 A;  2L1B A;  1QVG A;  1JWM D;  1U4M A;  2A73 B;  3F1Z A;  4A3M H;  5EAY A;  1TQO A;  1BBU A;  3S14 H;  2UUC Q;  3GD7 A;  4UY8 C;  4LJZ C;  5IYD H;  4OO1 I;  1XNR L;  2GVA A;  4LUV A;  1FVI A;  1MBY A;  4XQQ A;  4GN3 B;  5KYI A;  1WTX A;  1P16 A;  1NR2 A;  1UE5 A;  2F0I A;  5M3F G;  4B3T L;  4DR4 Q;  1NE3 A;  3GTP B;  3MXN A;  3W3A A;  3X3M A;  2JSO A;  4C3H B;  3T16 A;  1EY8 A;  1F9Q A;  2FMC A;  4A3D G;  1PRT C;  4KI0 A;  1EWC A;  4OWT B;  1EYA A;  2K7V A;  3MXG A;  3P75 A;  4OO1 G;  3TS0 A;  4K2L A;  3I4N H;  3NBI A;  4LUZ A;  1QVC A;  2R93 H;  3J80 L;  1C0A A;  2B2U C;  5FKA C;  2L12 A;  5L37 A;  3HOZ B;  3WWV A;  1VQP A;  2NUC A;  4UP8 A;  2NVT B;  3CC4 A;  2CHB D;  3M7N A;  1YBY A;  2DJF C;  1TVX A;  5TSS A;  1SNO A;  3NK9 A;  5C5L A;  1PH1 A;  3KF8 A;  2C5C A;  1O7Y A;  1J8I A;  3NP8 A;  1NTG A;  3LX0 A;  1WCM B;  3A8J E;  4CDC C;  2JA7 B;  4L5Q A;  1S3O A;  2A6E C;  3HGB A;  1IZ6 A;  4K5X A;  1XXG A;  3S2H H;  4UPA A;  4DV0 L;  1VQE A;  1TS3 A;  1T9H A;  4WFN 3;  1L0X B;  1A62 A;  5AFW A;  5IP9 G;  1YVC A;  1VQJ A;  1VDZ A;  1MJC A;  2XGT A;  1LUZ A;  4DGZ A;  1H9M A;  1B2T A;  3GTL B;  2UXB Q;  2VB2 X;  3BVG A;  4IPG A;  1SNM A;  4A3F B;  4K5W A;  2JEB I;  1K9M C;  3H15 A;  4DR5 L;  1XMQ Q;  4GKK L;  3K58 A;  3HOW B;  3NWS A;  4AQY L;  2IWH A;  1LTT D;  1JC7 A;  3TSS A;  5J1Z A;  2PYK A;  3HKZ G;  2A19 A;  2KED A;  1Z6H A;  5C44 G;  5LMN Q;  3ONA B;  5I4D A;  2K5Q A;  3L3O C;  3GTK B;  3S1M H;  3BYY B;  4S3S A;  1PH2 A;  3CW2 C;  2YU9 H;  1L1O C;  4IFD I;  5EBD A;  3LWU A;  4B08 A;  2NZO A;  4LUO A;  2H4O A;  3HP3 A;  4DR2 L;  1QNK A;  2BDO A;  1KAA A;  4K0K L;  4JI1 Q;  2WV6 D;  4YWK A;  4C56 C;  1UNS A;  2IL8 A;  4DAY A;  4WJW A;  4KY5 A;  3UE1 A;  3NQT A;  5JPN C;  4C3J G;  3RLO A;  1SRO A;  1HNW L;  4WOR A;  2UUB L;  4IFD G;  2QDL A;  4EVO A;  1CA5 A;  1VQB A;  3U9O A;  2KVM A;  4L6T B;  3RZO H;  3SGI A;  5FO8 B;  5ELN A;  3VYT A;  2O4X A;  1YJ9 A;  2N8N A;  3FKI B;  4AYB E;  4N9T A;  4XQN A;  1HZA A;  4A3I H;  1EWI A;  5K36 G;  4XQJ A;  1GUO A;  1EU3 A;  3G4S A;  2AWN A;  1NMG A;  1YHA A;  2I5H A;  5J22 A;  1IKM A;  3GP7 A;  1M90 C;  4LFB L;  1GKH A;  5HGT A;  4ID6 A;  2HUG A;  3HOX H;  1J9O A;  1PHJ A;  1SJE D;  5E4X A;  2Z9H A;  5CR3 A;  2EY1 A;  3T1Y Q;  1UUP A;  3A0J A;  3U4Z A;  4HJ5 A;  3KLS A;  2UXC Q;  2ES2 A;  3URY A;  2F4V Q;  2RHQ B;  2RA4 A;  1LT3 D;  2WII B;  1V1O A;  5EBC A;  3HOU G;  1YNN D;  1PYW D;  4HCS A;  4QIW B;  1C8C A;  1F9P A;  1FGB D;  5LMU Q;  2JQO A;  4A3K G;  2K32 A;  1KXL A;  4A4I A;  1KQS A;  2CFM A;  1EQT A;  3Q22 A;  2PMZ E;  5JJK A;  1OXX K;  2XWB B;  5CBE E;  3GTP H;  2HHH L;  4YWM A;  1DJR D;  2SDF A;  3RD4 A;  1IYJ B;  1JE5 A;  4C3H H;  3NPP A;  4JW0 A;  4OL7 A;  2TSS A;  4B9X A;  1JJG A;  3IRB A;  3H3V C;  2BH8 A;  2XIW A;  1SDF A;  4A76 A;  1JT8 A;  4MHE A;  3ER0 A;  1Y1V B;  4MTK A;  4RMF A;  1PH6 A;  2E2J B;  2F0D A;  1FR3 A;  4KD4 A;  3T13 A;  2EOT A;  3PIP A;  1TWG B;  1PTO C;  1AZP A;  5I9P A;  3HOZ H;  4LW1 A;  1TWH B;  4HJ8 A;  2QEX A;  3I4M G;  1TS4 A;  3G7L A;  5FLX L;  2B8G A;  1JOO A;  3BU2 A;  5IYC H;  2NVT H;  3FEW X;  2P5Z X;  1HTL D;  1NBW A;  4G7Z C;  1VMP A;  3D6W A;  1IXR A;  2YTY A;  2MFI A;  3ERQ A;  1VQM A;  4PZ8 A;  1WCM H;  2JA7 H;  3KF6 B;  4IJH A;  2F0E A;  1Z9F A;  2VB3 X;  3M4O B;  1N8R C;  1VQK A;  2R7Z H;  1SE4 A;  2AQ2 B;  4DR3 L;  4R9W A;  1FYC A;  1WTH A;  5C3W A;  1X9N A;  3UI2 A;  3PIO A;  3HFZ B;  2CWA A;  1WYD A;  1I94 L;  3ULL A;  4BA1 I;  2WAQ B;  1Z47 A;  3GTL H;  1TY2 A;  1SBB B;  5D3D A;  2PZT A;  3BVM A;  4A3F H;  4LF5 L;  2E2H B;  5C4X G;  1LAC A;  3HZX A;  2JEA I;  4NB3 A;  3F8T A;  3DEO A;  1ROD A;  3A5U A;  4DK3 C;  4DV7 L;  3HOW H;  4GOP C;  3SXH A;  3R93 A;  1SAP A;  3QIA A;  1PLF A;  4GKJ Q;  1SYG A;  5IP7 G;  1X55 A;  1VQ6 A;  5M3M G;  1IW7 D;  3WOE A;  2IW3 A;  3GTK H;  1BCP C;  5E1F A;  3H94 A;  3MXP A;  2J4X A;  4DUZ L;  1B70 B;  2A6H C;  4GLX A;  4XYQ A;  1WI5 A;  3J7Z C;  2RCN A;  2PQA B;  2CH4 A;  5LL6 S;  1AEX A;  2AWO A;  5CV8 A;  2R92 G;  5JEA H;  4P73 A;  1I4Q A;  1LT5 D;  4POF A;  1HFG A;  1NSN S;  1ILQ A;  2WKD A;  1VCI A;  3I72 A;  2HCC A;  4LF6 L;  1S5C D;  4DR6 Q;  2CVR A;  5I6W A;  4OHJ A;  2AUK A;  3X3N A;  1STY A;  3K7A B;  5FLM G;  1I6H B;  1ENA A;  2D0P A;  4N9P A;  3A74 A;  3EJI A;  5C0X H;  1AW7 A;  4U68 A;  2Q2T A;  1HJP A;  2DY8 A;  5C4H A;  1RL2 A;  1VQC A;  4DV3 Q;  2VNU D;  3HRZ C;  5FOB B;  4JI5 Q;  4Y7N H;  5A2Q E;  2E5L L;  1IBL Q;  2B2W C;  4HJ7 A;  4B3R Q;  1X3Q A;  2LMC B;  3GV3 A;  4DV5 L;  4JC0 A;  3N52 A;  2B8F A;  2BH2 A;  1ASY A;  1QJO A;  1TT2 A;  4IZ8 A;  1PYB A;  2ID0 A;  2B2V C;  2NBF A;  5I9O A;  3MAQ A;  2F03 A;  2ASB A;  5IP9 H;  2K5V A;  2L5T A;  2PQE A;  4P74 A;  1W3S A;  3CCE A;  4BBR B;  4JI2 L;  2O5I C;  2VW9 A;  2NTT A;  3OIP A;  1VF7 A;  1XTD A;  1CKN B;  1CFM A;  1M8A A;  2IT1 A;  4GS3 A;  3HOY B;  3OPO A;  2UUA Q;  1ESR A;  1Q8K A;  2RDF A;  2F0F A;  2KCT A;  1UWV A;  2RBM A;  1O78 A;  2BE5 C;  3QJY A;  2VQE L;  5C44 H;  5ISR A;  1QVF A;  1HXY D;  3G71 A;  5EKL A;  4XYO A;  3GTQ B;  4RKL A;  5GAH C;  2HT1 A;  1KRS A;  4YY3 Q;  3MXU A;  4BY1 B;  2A6E D;  4R4Q A;  1VQF A;  3I73 A;  4CJ1 B;  1Y1V H;  5ELF A;  3U50 C;  3HG9 A;  1TWG H;  3VR2 A;  3S14 B;  3W5O A;  1TWH H;  1PV4 A;  1VQD A;  1PH9 A;  5KIX A;  3L2P A;  5EPJ A;  3TP7 A;  3Q0A A;  2JA5 B;  2OXP A;  2D9U A;  4NPS A;  5C6A A;  3H0G B;  2N78 A;  2L4N A;  4R8I A;  3OYY A;  5CV6 A;  4EX5 A;  1ASZ A;  1UE1 A;  4YIJ A;  3PUW A;  3F2B A;  4NXM L;  3NBH B;  3PIO 3;  3ERO A;  1YNJ C;  1ET9 A;  1E1O A;  2VL6 A;  1SYB A;  1A63 A;  2Z0S A;  3P7J A;  4KKS A;  3GQB A;  1EFW A;  4FXK C;  4CKB A;  4GZY C;  1G6Z A;  5COR A;  1FNV A;  3I90 A;  3VDY A;  5BR8 L;  5FJ8 G;  2HDM A;  4FXD A;  4ME3 A;  2CWP A;  1CQV A;  2MHV A;  1IYU A;  3FMC A;  2F1M A;  1BR9 A;  4ODG A;  3EBE A;  1HNX Q;  5JAV A;  2B2Y C;  1EOT A;  3T53 B;  2E2H H;  4P72 A;  1SYF A;  2EDG A;  2A8V A;  2L9H A;  3TME A;  3S1N B;  3DMU A;  5CMD A;  4X3S A;  3RN2 A;  5IT9 E;  4A93 G;  1KDB A;  1WD0 A;  1RJT A;  2KQ3 A;  4NXN L;  3KJP A;  5KNC A;  1WVL A;  2ZJQ A;  2JA6 B;  4N8X 1;  5IYB G;  2VQF L;  4M1U B;  5IGG A;  5DEH A;  1CM9 A;  1ENC A;  2R61 A;  2MJ8 A;  4Y52 H;  1TS2 A;  1AE2 A;  3S2H B;  2NVY B;  4A3B G;  1KAW A;  1HRJ A;  1NJI C;  4X66 L;  3U4V A;  1WTW A;  2ZTC A;  5JJZ A;  4B3S L;  3RNU A;  1B9M A;  2EYJ A;  5A2Q L;  2I46 A;  1KL9 A;  3M85 A;  3T1H L;  1AZQ A;  5ELC A;  2K75 A;  2Z4I A;  2KHJ A;  4BY7 B;  3CXC A;  4DV1 L;  3TEH B;  1STE A;  5C3E B;  1D6E C;  1JJC B;  3PGZ A;  1FNW A;  4V0B A;  4LMQ D;  1KHI A;  1K8G A;  3D31 A;  4LF9 Q;  5JJL A;  1JB3 A;  3EQL C;  1BDO A;  2AKW B;  1QCB D;  4XDX A;  1MSH A;  3CQZ B;  4H7B A;  1OXU A;  3S1M B;  1I6H H;  1ZXT A;  2MNA A;  1U5K A;  2QF7 A;  4IFD J;  4KY6 A;  3UDX A;  1CI3 M;  2IY5 B;  1EIY B;  3KLW A;  1KNE A;  5EKI A;  1RD9 D;  1I4G A;  2WKC A;  2CW0 C;  2D2C C;  2WB1 B;  1CTM A;  1D5Z C;  2K5D A;  5J39 A;  4QMG A;  3SDZ A;  4HJ9 A;  2NN6 I;  1LV9 A;  3C1F A;  1KTK A;  1RTN A;  3S1Q B;  1X3E A;  1GXD C;  1WTV A;  2RSN A;  4GN4 B;  4BBR H;  5CV4 A;  4AYB G;  1N34 L;  2V1C C;  4DAM A;  1PTO D;  5C4X H;  3QG1 A;  3CKI B;  1IBK L;  3RZO B;  1GHK A;  4AQY Q;  3AB9 A;  1EEF D;  2D62 A;  2QA4 A;  4XIG S;  3PO2 G;  2RF4 A;  3M4P A;  4X64 L;  1YJW A;  1EZ8 A;  3KLS X;  1DOK A;  2NTS A;  1CA6 A;  2NN6 G;  4DNI A;  2LS0 1;  2EJG C;  3W1G A;  3CCJ A;  4DV2 Q;  3A5Z B;  4DV6 Q;  4DR2 Q;  1KNA A;  1Y14 B;  4IO9 A;  3BYT B;  4JI0 L;  3HOV G;  2L15 A;  4K0K Q;  3NE5 B;  1SLJ A;  3SK4 A;  3FPP A;  4QQB X;  1DZ1 A;  2XTI A;  1O7I A;  2VS1 A;  3TRZ A;  1D5M C;  4RHS A;  4X65 Q;  5LL6 X;  2JA8 H;  2R92 H;  1SNC A;  1R4Q B;  5T1I A;  2MQH A;  5IGB A;  5ELO A;  4JOI C;  4DR1 L;  2JA5 H;  4DUY L;  1H9J A;  2B63 G;  3H0G H;  2EXZ A;  4OEM B;  3ZJY C;  2I5M X;  1YZ6 A;  4BXX G;  4DXF A;  4R4T A;  1A3T A;  2N49 A;  1HQM C;  4UAI A;  2F0O A;  4FVM A;  3D4D A;  4EQO A;  3V96 A;  4L5R C;  1X3P A;  5DAU A;  3SR1 A;  1YIJ A;  1EL0 A;  1PFS A;  5AJ3 L;  2HDL A;  1BCP D;  3BZC A;  4QB4 A;  4CKC A;  4O2D A;  1PZI D;  1VQI A;  2Z6K A;  2RKS A;  4NW2 A;  1Y1W B;  3KBX A;  2NZH A;  4LF4 L;  1ZYR C;  2H1E A;  3D8G A;  1OXS C;  3O13 A;  1STN A;  3NTH A;  3GTM B;  1Q7Y C;  5C0X I;  1NR4 A;  4ILW A;  1CKN A;  4YWL A;  3GTJ B;  1LT4 D;  2DUD A;  2LSS A;  3PUX A;  2EYH A;  5KGU A;  3E3X A;  1L1O B;  2F0U A;  4DAV A;  3OTO L;  4CBV A;  1FNU A;  1G29 1;  1N36 Q;  4PV1 C;  1EEI D;  1X54 A;  3S1N H;  5IT9 c;  4CKE A;  5A35 A;  1SE3 A;  4JBM A;  3MWY W;  4H13 C;  3QOJ A;  2FXQ A;  2SEB D;  4R4O A;  2K52 A;  2JA6 H;  2VUM B;  2R7Z B;  1CZG A;  1EZ6 A;  2EY2 A;  4JYA Q;  1UEB A;  4WJ4 A;  2NVY H;  1VQH A;  4IPH A;  4O42 A;  2B2T C;  4LWC A;  3W2D A;  3BG3 A;  4HN7 A;  4M8A A;  3I56 A;  1OXV A;  3S24 A;  2YTV A;  4HMJ A;  4C3I G;  2ZM6 L;  1STA A;  1QZH A;  2FHT A;  3WDN A;  1JOK A;  4BY7 H;  2JN4 A;  4LF7 L;  1STB A;  3FDT A;  5C3E H;  1G91 A;  2QCP X;  3CMA A;  2UXD Q;  1IYV A;  1S5E D;  1K0S A;  1VQL A;  3NBH A;  4UDU C;  5KND A;  3F2D A;  3CQZ H;  4A3L H;  1SFO H;  1B3A A;  1U0L A;  1LTB D;  1N33 Q;  2F0V A;  1SRU A;  2SNS A;  2R3Z A;  5M3F B;  4AIM A;  1CSP A;  4LK1 C;  1LT6 D;  1Q8I A;  2ICE C;  1FJG L;  2E74 C;  1PZJ D;  2R6G A;  3D4W A;  1X3F A;  4OX9 Q;  4DR3 Q;  4P71 A;  1B4O A;  2BE5 D;  4A3D B;  3LNN A;  3Q6S A;  3EFX D;  3NQI A;  4OON A;  1XMO Q;  2RQX A;  3K81 C;  1QZG A;  1B9N A;  4K6D A;  3S2D B;  2EYP A;  4RAU C;  3S1Q H;  2NYZ D;  1WD1 A;  3SE0 A;  2R7D A;  3KFU A;  4LF5 Q;  1BKB A;  1R9T B;  1I50 B;  3CAM A;  1OO9 B;  2EE1 A;  1FD7 D;  2IX3 A;  1M1K C;  2IX1 A;  4TVA B;  1PDQ A;  1I6V C;  4X6A H;  3I3C A;  1HR0 W;  2UUC L;  1K0R A;  1C9O A;  2HIX A;  4HR7 B;  1JCK B;  5KEE A;  2YYZ A;  5FO7 B;  3VYR A;  3JAM E;  4DUZ Q;  1DD2 A;  3PF5 A;  1S40 A;  4Y7N B;  3M4Q A;  1PTO B;  1TS5 A;  1PFM A;  2NZ1 D;  2GA4 B;  5E7N A;  4DR4 L;  4MZ9 A;  4KJO A;  1YNJ D;  4Z9C B;  1GHJ A;  4RGM A;  1F77 A;  1YHB A;  3E0J A;  4ULL A;  1TWF H;  4I7Z C;  4PZ6 A;  1U4L A;  2CQO A;  1K8O A;  3QWN A;  3EA6 A;  4EQ5 A;  4KMU C;  4LF6 Q;  1XWE A;  4RGN A;  4CDD C;  3FVQ A;  4OGQ C;  1F2Y A;  1SXT A;  1P8L A;  3KK7 A;  2KHS A;  4X62 L;  2FIN B;  2F0J A;  3PO3 G;  3OOC A;  2OTJ A;  3HKZ B;  1PVO A;  1BBW A;  5C44 B;  4K2K A;  2HCI A;  1Q1B A;  2OT2 A;  1TXY A;  2EPB A;  2F0P A;  4BS9 A;  1YI2 A;  1KD1 C;  3D6C A;  2DY7 A;  1EU4 A;  2GVB A;  4HAE A;  2LXJ A;  1Y1W H;  1SN8 A;  1V8Q A;  3K59 A;  1X3G A;  4GOP B;  3FPU B;  2F4I A;  4RCN A;  4IUN A;  3U58 A;  1X65 A;  3GTM H;  3S17 B;  2F0T A;  3E6Z X;  2MUY A;  1BCP B;  5G3L D;  3GTJ H;  1VMC A;  2K5H A;  3IL8 A;  1EIF A;  1XJV A;  4O0A A;  4MNO A;  5KYL A;  4G7O C;  4C3J B;  2OF1 A;  2PI2 A;  1SYE A;  2UXB L;  2IHE A;  2K6A A;  2PPB C;  5IGC A;  2IJ0 A;  4ZUJ A;  1S4Z A;  2YV5 A;  4UHV A;  3BDC A;  4CGY B;  2B2U A;  1GVP A;  1XMQ L;  2XN9 C;  2E8G A;  4C2M H;  4A75 A;  3EVQ A;  1Q1E A;  2VUM H;  3L0O A;  1J5E L;  1VQ9 A;  1XNQ Q;  5E4W C;  5IWA L;  1EY6 A;  4TRD A;  5C5M A;  4PNY A;  4KV6 A;  1XPR A;  2JK8 A;  4KTA A;  5CV5 A;  4X3T A;  1D7Q A;  1EIH A;  5M5W B;  3DM1 A;  2EIF A;  2ATW A;  2CW0 D;  1N32 L;  2XVS A;  3MZ5 A;  1HR0 L;  1GUW A;  4IQZ A;  4RGO S;  3LGJ A;  4DV4 Q;  4LFA L;  1SMY D;  3C1E A;  4FYD A;  3CD6 A;  1FL0 A;  2FFK B;  1ILP A;  4ZLT F;  3HOU B;  4PMC A;  4CJ2 C;  4B3M Q;  2VY3 A;  4A3C G;  1A0I A;  1SNP A;  4JCV E;  5CV9 A;  3I4O A;  4A3K B;  1E3P A;  4HJA A;  2OQK A;  4UP7 A;  2MPM A;  5COY A;  5M3F H;  1Y69 U;  3HOY G;  2F52 A;  4KJN A;  4A3J G;  4BXX H;  3KOJ A;  4QIW E;  1AE3 A;  1IBM Q;  1SEB D;  3S16 B;  3BDO A;  3AMU A;  2KA7 A;  2KEN A;  1I4X A;  3A55 A;  1B53 A;  3JAM L;  1EFI D;  4A3D H;  1HUM A;  1JOR A;  2DGY A;  5CC4 A;  5KNB A;  1DGS A;  4A3E G;  4DR7 Q;  3S2D H;  4OO1 H;  1L1O A;  4A3G G;  2PNH A;  1I3Q B;  1SR3 A;  1R9T H;  1I50 H;  4BBS G;  2AMC B;  4HSP A;  3T1Y L;  4JVZ A;  4A3M G;  4MN3 A;  3K8A A;  5I6Y A;  3I4M B;  5IYD G;  3J81 c;  1XYI A;  4IUR A;  4QF4 A;  1BBX C;  1K3R A;  4DA2 A;  3H3V H;  3A7A B;  1U4R A;  3C46 A;  3TRE A;  1K83 B;  1ESF A;  4NXN Q;  4QJF A;  3JAM c;  3FRP B;  4ZKB B;  4APV A;  1G6P A;  1PTO H;  2VZA A;  4GNX C;  1TWA H;  1NAP A;  3NEN A;  5CBA E;  4JK1 C;  1D8L A;  4X66 Q;  2KUM A;  1YHQ A;  1PRT D;  2BA0 A;  1PMR A;  2RDH A;  1NMF A;  2OWO A;  1GUN A;  4DK0 A;  3R2I A;  3I4N G;  4DV1 Q;  1ZYR D;  2R93 G;  4C3I H;  4R8N A;  5C4X B;  1HQR D;  1N9W A;  2PO4 A;  4PG3 A;  3ITP A;  3DWP A;  2EYF A;  2PW5 A;  3KJO A;  3TBI B;  2WAQ E;  1PH5 A;  1W2B A;  2EYL A;  1RF2 D;  3VR6 A;  3Q23 A;  2I07 B;  2MO0 A;  2A68 C;  5M3M B;  2UU9 L;  4JI6 L;  5HUR A;  1DOL A;  5JVG 3;  3P1H A;  4Q5V A;  3PMF A;  3PIP 3;  1CKO A;  2KOL A;  1LTG D;  4K5V A;  3RUZ A;  3PV0 A;  2J0T D;  1A2T A;  4IAL A;  2I5L X;  3T4A C;  4FF1 A;  1JWU D;  2Z6B A;  1Y8N B;  4IPD A;  2JA8 B;  2R92 B;  4TSS A;  3CHB D;  3S17 H;  2XRS D;  1DON A;  2EJM A;  4QY7 A;  1A8V A;  2Q2I A;  4RH6 A;  4YHH L;  3S15 B;  4C3J H;  1HNZ Q;  2QW7 A;  1N34 Q;  3MFY A;  1VQ7 A;  3K0Y A;  1TU2 B;  4IFD H;  1HFN A;  1E0B A;  1O7L A;  4ME5 A;  1WTQ A;  2N55 A;  4GN5 A;  2O5J C;  2WIN B;  3TN2 A;  2DJG C;  1EYD A;  3IFT A;  1SNQ A;  2RSO A;  4GKJ L;  1KC8 C;  3NTI A;  1QUQ B;  4CDE C;  4OWW B;  1K8M A;  3FHW A;  1L0Y B;  5K36 H;  3G6E A;  1B1Z A;  4V19 0;  4JI8 L;  4KHP Q;  3M9B A;  3M3Y B;  1I4P A;  2Z4H A;  3E9I A;  4KLK A;  4RA8 A;  1BUV T;  1EY0 A;  2LXK A;  2MP1 A;  4YCW A;  5BN3 A;  5M5W H;  2C35 B;  3VYU A;  2BDN A;  3JC6 6;  3KUP A;  1CT1 D;  3V2T A;  3MC0 B;  1XNR Q;  4U67 3;  2XSC A;  1S5F D;  1S5B D;  1J6Q A;  3HOU H;  1YNN C;  2ZJP A;  4DR1 Q;  5DM6 3;  1K3B C;  1G51 A;  4B3T Q;  4A3K H;  2VXW A;  4DR6 L;  4ZYS A;  1I5F A;  1MHW C;  3MVV A;  3M4Y A;  2F0W A;  4IOA A;  3L7Z C;  4XTC S;  1DXM A;  1AP0 A;  3TP6 A;  3K7U C;  5GAD C;  1V1Q A;  4OEL B;  4J8Q A;  4GOP A;  2E2I B;  5AJ3 Q;  3S16 H;  3SK5 A;  4A3I G;  3W1B A;  3C3L A;  4TQU S;  4LFC L;  3TP5 A;  1QNU A;  1K28 A;  3HOX G;  1VQ8 A;  4L8J A;  5FO9 B;  4KHZ A;  4DV3 L; 
#chains in the Genus database with same CATH homology
 4G57 A;  5IOD A;  5E3F A;  3DHQ A;  1H9K A;  1GUT A;  1E2V A;  1SFO B;  2LKV A;  1JIC A;  1HUN A;  1D2B A;  2HQE A;  3H09 A;  4H44 C;  2DNE A;  5CV7 A;  3ND8 A;  2PCF B;  4HSV A;  2F0S A;  1D1I A;  2NVX B;  1IKL A;  4C3H G;  2JXM B;  2G9D A;  3CRK C;  3GV6 A;  4P2C B;  5BN4 A;  4DAP A;  1JWS D;  2B2W A;  2Y0S B;  1EY7 A;  4EGV A;  2E76 C;  1PRT B;  2F0G A;  2B2V A;  4IUV A;  2M9V A;  1II3 A;  4RHR A;  3KLR A;  1IW7 C;  2N88 A;  1BNZ A;  3SK8 A;  4FXG C;  1EIG A;  1W6J A;  1IL8 A;  4EQN A;  4NP5 A;  4H0L C;  1ZKO A;  4L63 B;  2K04 A;  5ELD A;  1TWF B;  4PMB A;  1BQQ T;  2EY6 A;  1GUS A;  1A15 A;  5D65 A;  4IUQ A;  4F87 A;  4QCL A;  4RCO A;  2EYM A;  1AN8 A;  3E5S A;  2JE6 I;  1V1P A;  4OIK A;  2WAC A;  3GO5 A;  3NWT A;  4KD3 A;  2AQ1 B;  2QDB A;  4HMI A;  3H91 A;  2AQ3 B;  3RZD B;  2DN8 A;  5IT9 L;  4RGT A;  1WTR A;  2F0L A;  1TKW B;  3IAY A;  3D4R A;  5KRU A;  2BOS A;  2A6H D;  2F3V A;  3TP8 A;  1GUG A;  1H9S B;  1JOQ A;  5JEA G;  1U9R A;  3K5M A;  3PUY A;  1LLR D;  2L55 A;  1G2S A;  3K5O A;  4AYB B;  4KN4 C;  1F9R A;  3VYS A;  3F2U A;  1B50 A;  5M5X B;  4C2M B;  2B2Y A;  2F0Q A;  4FO2 A;  1DM0 B;  1HTP A;  5JOB A;  3PO2 B;  5C0X G;  2XRQ D;  2C9O A;  5DM7 3;  4F88 A;  2Z8L A;  1PTO F;  4NKL A;  1W6K A;  1KLG D;  1ENF A;  1O7Z A;  3I91 A;  3P20 A;  1EQV A;  5EPL A;  3HOV B;  2Q8I B;  5IGE A;  1PZK D;  1XX8 A;  1R4P B;  2WP8 J;  3R2T A;  1ONL A;  2PMZ B;  3T56 B;  5FLX E;  3K6O A;  3BS1 A;  1SYD A;  1Z7T A;  2B63 B;  1VF5 C;  1NUC A;  3A8K E;  1ML0 D;  1TY0 A;  4E6I A;  5EKK A;  4K8I A;  2ZXP A;  3OSO A;  2L11 A;  2O2L D;  2RVL A;  2A68 D;  2KCC A;  5D3I B;  2QIL A;  4CHT B;  2TMP A;  1T5X D;  3GTO B;  3ZYY X;  1TII D;  4PMW A;  4DXG A;  1GJX A;  4K6L A;  5ELE A;  2FMM A;  1JR0 D;  2A69 C;  1RHP A;  3A56 A;  1BCP F;  5FK9 C;  4IUP A;  1EY4 A;  3J81 E;  2K01 A;  4J6H A;  4NDX A;  5T1G A;  4FP5 D;  2KEC A;  4DNR B;  2M2L A;  2XNA C;  5K5P A;  2J7Z A;  1TWC B;  2IPK D;  1DYQ A;  2EVB A;  3AU7 A;  1TWA B;  4Q0F A;  3MTS A;  1F2M A;  1MD2 D;  3MHB A;  4IUU A;  5I2X A;  3L9A X;  1LAB A;  2K05 A;  4IN3 A;  4MIU A;  3GTG B;  4XXE A;  1A3V A;  5IGF A;  3DUZ A;  2PW7 A;  4C3I B;  4DFA A;  3S1R B;  1MSG A;  5LHY 1;  2ZXO A;  3MFG A;  1LTS D;  1BXT A;  5BN5 A;  3NTK A;  3OWF A;  1T5E A;  4QUC A;  4HTH A;  1CHP D;  5IOC A;  3VA5 A;  2K33 A;  2A74 C;  1HA5 A;  1SSO A;  2LY7 A;  3DEP A;  3OMC A;  4FF4 A;  2L0C A;  3BDL A;  2E75 C;  3HEJ A;  4KN7 C;  1HHV A;  1A6X A;  5EJW A;  3QOL A;  4BA2 I;  1S5D D;  4ZQ3 A;  5D14 A;  1UEA B;  4KK7 A;  3MEH A;  1NCV A;  2F0N A;  4ZUI A;  4HED A;  1F2L A;  1GOZ A;  2DNC A;  1WTP A;  2BCO A;  3BZD B;  1Q12 A;  3PUZ A;  2NVQ B;  1ZEQ X;  2IX0 A;  1RCV D;  3OW7 A;  2AUJ D;  3Q24 A;  1BOS A;  3I70 A;  1XTC D;  2RDG A;  3K5L A;  2NN6 H;  4PQX A;  1KLU D;  4RWS C;  3QO2 A;  2MGS A;  5DNF A;  1HPC A;  4X3U A;  5IGD A;  5NUC A;  1IHZ A;  1SYC A;  4C1N I;  1F9S A;  1LTR D;  1STH A;  1ET6 A;  4XT1 B;  1I4R A;  3VA7 A;  2B2T A;  2PNR C;  1EY9 A;  1CHQ D;  3J81 L;  1C48 A;  1I4H A;  1LTA D;  1M4V A;  3D3R A;  3PO3 B;  3HS0 C;  3U9S A;  4RFB A;  1H9S A;  1CQF A;  1Q90 A;  5CYU A;  1PXU A;  3OIQ A;  1D1K A;  3IFD A;  1QG7 A;  3N6R A;  5C4Z A;  1KDA A;  1SND A;  3ND9 A;  4KKU A;  3VR4 A;  1UAP A;  3BVZ A;  1EWH A;  1G2T A;  3IKJ A;  5C4J B;  3J7Y W;  3VR5 A;  1CZW A;  1E2Z A;  1V1P B;  4X3K A;  4NMZ A;  4LAA A;  3SVM A;  5CGK A;  2ICI A;  5G3L F;  1RTO A;  4HCE A;  3H6M A;  3CU7 A;  1PFN A;  4G4K A;  2LFN A;  2B39 A;  4FF3 A;  4FNF A;  4F8M A;  4ZRZ A;  4ZK9 B;  1HA6 A;  2KEE A;  1QE6 A;  3SHL A;  2NWG A;  1RDP D;  3QB3 A;  3DWA A;  3A8I E;  1V43 A;  2EZV A;  1AFP A;  1A3U A;  3G6J B;  5EGT A;  1O80 A;  5M9O A;  3S9W A;  2X69 A;  4J1M A;  2X6L A;  1MGS A;  3CRL C;  2EJF C;  1B44 D;  1EYC A;  4A3J B;  3TZD A;  4KKT A;  4WRD A;  3A54 A;  3LWE A;  1Q3L A;  2SOB A;  2K03 A;  3J7A F;  4A3E B;  1QIL A;  3R8B A;  1DCZ A;  4A3G B;  1H9R A;  5JEA J;  4BBS B;  1QWY A;  4A3M B;  4BWG B;  3TDQ A;  3OHX C;  2JYO A;  3K57 A;  3C2P A;  1SJH D;  4OIJ A;  3V05 A;  2OEO A;  4C1N K;  2F3W A;  1ICW A;  4K14 A;  1U4P A;  3RLF A;  1PFB A;  2V4D A;  3NSW A;  3OWE B;  2NB0 A;  5C0X J;  3T51 B;  1DOM A;  1E2W A;  4JBW A;  1LO5 D;  4I65 A;  4G7H C;  2F0M A;  4B9W A;  3NUC A;  2A69 D;  3I4N B;  4DU9 A;  3KBG A;  2R93 B;  1Y8P B;  1PRT F;  3NXW A;  3NHH A;  1X32 A;  1LTI D;  3I8Z A;  2Q8T A;  5M5Y B;  3TZU A;  1RKN A;  3OMG A;  4ZKC B;  1MI2 A;  3RMH A;  3SK6 A;  5EPK A;  3DWQ A;  5C3X A;  4EQP A;  3MA2 B;  2FJ2 A;  2EY5 A;  3A7L A;  4RKB A;  3J80 E;  2BA1 A;  4DF7 A;  5JVH 3;  5F2D A;  5JPM C;  5EQ0 A;  2PZU A;  4QUF A;  1F2Z A;  1STG A;  1QOH A;  3J7A V;  4O1N A;  2F0K A;  4DN4 M;  3SEB A;  2Z1C A;  3WOF A;  1OXT A;  2K28 A;  1WTO A;  1JQY D;  4DNT B;  1Y8O B;  3VR3 A;  2ENB A;  2PZW A;  1BO0 A;  1TR5 A;  1G8Z D;  5I2Y A;  2YU9 B;  3PUV A;  4KHV A;  2KJX A;  2ZT9 C;  2K1B A;  1SE2 A;  2Q8R E;  1QB5 D;  1HCZ A;  4CJ0 B;  4F7X A;  2X6G A;  5ELB A;  2D5D A;  2JP1 A;  4KY7 A;  1BF4 A;  4XT3 B;  4TKO B;  2QKI C;  3DXJ C;  1SMY C;  1A2U A;  2KCN A;  3I4L A;  4ABN A;  4A93 B;  2XWJ B;  3K5N A;  2F0H A;  4DK1 A;  4K8J A;  1D5X C;  2SNM A;  5IIF A;  4A3B B;  1JE4 A;  2E2D C;  2CQA A;  4A3I B;  2QEJ C;  4FF2 A;  1KDC A;  2ZXR A;  1KAB A;  2EYO A;  2G9H D;  2K5W A;  2M00 A;  3HOX B;  1C4Q A;  1EY5 A;  4IUT A;  2A5H A;  3R3O A;  4ZAI A;  3M7G A;  1CK1 A;  2L1B A;  1JWM D;  1U4M A;  2A73 B;  1TQO A;  3GD7 A;  4LJZ C;  4OO1 I;  1MBY A;  4XQQ A;  5KYI A;  1WTX A;  2F0I A;  1NR2 A;  3GTP B;  3MXN A;  3W3A A;  3X3M A;  2JSO A;  4C3H B;  3T16 A;  1EY8 A;  1F9Q A;  2FMC A;  1PRT C;  4KI0 A;  1EWC A;  1EYA A;  2K7V A;  3MXG A;  3P75 A;  4OO1 G;  4K2L A;  3NBI A;  3J80 L;  2B2U C;  5FKA C;  2L12 A;  3HOZ B;  2NUC A;  2NVT B;  2CHB D;  3M7N A;  1TVX A;  5TSS A;  1SNO A;  3NK9 A;  5C5L A;  3KF8 A;  2C5C A;  1O7Y A;  1J8I A;  3NP8 A;  3LX0 A;  1WCM B;  3A8J E;  2JA7 B;  2A6E C;  3HGB A;  4K5X A;  1XXG A;  1TS3 A;  4WFN 3;  1L0X B;  5AFW A;  1VDZ A;  4DGZ A;  1H9M A;  1B2T A;  3GTL B;  2VB2 X;  3BVG A;  1SNM A;  4A3F B;  4K5W A;  2JEB I;  3K58 A;  3HOW B;  3NWS A;  2IWH A;  1LTT D;  1JC7 A;  3TSS A;  5J1Z A;  2PYK A;  2KED A;  1Z6H A;  3GTK B;  3ONA B;  5I4D A;  2K5Q A;  3L3O C;  3BYY B;  4S3S A;  4IFD I;  5EBD A;  3LWU A;  4B08 A;  2H4O A;  3HP3 A;  1QNK A;  2BDO A;  1KAA A;  2WV6 D;  4C56 C;  1UNS A;  2IL8 A;  4DAY A;  4WJW A;  4KY5 A;  3NQT A;  5JPN C;  4C3J G;  4WOR A;  4IFD G;  4EVO A;  1CA5 A;  3U9O A;  2KVM A;  4L6T B;  5FO8 B;  3VYT A;  2O4X A;  3FKI B;  4N9T A;  4XQN A;  5K36 G;  4XQJ A;  1GUO A;  1EU3 A;  2AWN A;  1IKM A;  5J22 A;  3GP7 A;  5HGT A;  4ID6 A;  2HUG A;  1J9O A;  1SJE D;  5E4X A;  5CR3 A;  2EY1 A;  1UUP A;  3KLS A;  3URY A;  2RA4 A;  1LT3 D;  2WII B;  1V1O A;  5EBC A;  1YNN D;  1PYW D;  4HCS A;  4QIW B;  1C8C A;  1F9P A;  1FGB D;  2K32 A;  1EQT A;  3Q22 A;  1OXX K;  2XWB B;  5CBE E;  1DJR D;  2SDF A;  3RD4 A;  3NPP A;  4OL7 A;  2TSS A;  4B9X A;  3H3V C;  2XIW A;  1SDF A;  4MHE A;  1Y1V B;  2E2J B;  2F0D A;  1FR3 A;  4KD4 A;  3T13 A;  2EOT A;  1TWG B;  1PTO C;  1AZP A;  5I9P A;  1TWH B;  1TS4 A;  3G7L A;  5FLX L;  2B8G A;  1JOO A;  3FEW X;  1HTL D;  4G7Z C;  1VMP A;  3D6W A;  3ERQ A;  2F0E A;  2VB3 X;  3M4O B;  1SE4 A;  2AQ2 B;  4R9W A;  1FYC A;  5C3W A;  3UI2 A;  4BA1 I;  2WAQ B;  1Z47 A;  1TY2 A;  1SBB B;  5D3D A;  2PZT A;  3BVM A;  2E2H B;  1LAC A;  3HZX A;  2JEA I;  3DEO A;  1ROD A;  3SXH A;  3R93 A;  1SAP A;  3QIA A;  1PLF A;  1SYG A;  1IW7 D;  3WOE A;  2IW3 A;  1BCP C;  5E1F A;  3H94 A;  3MXP A;  2J4X A;  2A6H C;  4XYQ A;  5LL6 S;  1AEX A;  2AWO A;  5CV8 A;  5JEA H;  1I4Q A;  1LT5 D;  1HFG A;  1NSN S;  1ILQ A;  2WKD A;  1VCI A;  3I72 A;  2HCC A;  1S5C D;  2CVR A;  5I6W A;  4OHJ A;  2AUK A;  3X3N A;  1STY A;  3K7A B;  1I6H B;  1ENA A;  4N9P A;  3EJI A;  5C0X H;  1AW7 A;  4U68 A;  2DY8 A;  5C4H A;  2VNU D;  3HRZ C;  5FOB B;  5A2Q E;  2B2W C;  1X3Q A;  2LMC B;  3GV3 A;  3N52 A;  2B8F A;  1QJO A;  1TT2 A;  4IZ8 A;  5I9O A;  2ID0 A;  2B2V C;  2NBF A;  3MAQ A;  2F03 A;  2L5T A;  2PQE A;  4BBR B;  2O5I C;  2NTT A;  3OIP A;  1VF7 A;  1CFM A;  1M8A A;  2IT1 A;  3HOY B;  3OPO A;  1ESR A;  2RDF A;  2F0F A;  2RBM A;  1O78 A;  2BE5 C;  3QJY A;  5ISR A;  1HXY D;  5EKL A;  4XYO A;  3GTQ B;  4RKL A;  4BY1 B;  3MXU A;  2A6E D;  3I73 A;  4CJ1 B;  5ELF A;  3HG9 A;  3VR2 A;  3S14 B;  5KIX A;  5EPJ A;  3TP7 A;  3Q0A A;  2JA5 B;  2OXP A;  2D9U A;  5C6A A;  3H0G B;  2L4N A;  4R8I A;  5CV6 A;  4YIJ A;  3PUW A;  3PIO 3;  3ERO A;  1YNJ C;  1ET9 A;  1SYB A;  3P7J A;  4KKS A;  3GQB A;  4FXK C;  4CKB A;  4GZY C;  1G6Z A;  5COR A;  1FNV A;  3I90 A;  2HDM A;  4FXD A;  3FMC A;  1CQV A;  2MHV A;  1IYU A;  2F1M A;  1BR9 A;  4ODG A;  5JAV A;  2B2Y C;  1EOT A;  3T53 B;  1SYF A;  2EDG A;  2L9H A;  3TME A;  3S1N B;  3DMU A;  5CMD A;  4X3S A;  5IT9 E;  1KDB A;  1WD0 A;  1RJT A;  2KQ3 A;  5KNC A;  1WVL A;  2JA6 B;  4M1U B;  5IGG A;  5DEH A;  1CM9 A;  1ENC A;  2R61 A;  2MJ8 A;  1TS2 A;  3S2H B;  2NVY B;  1HRJ A;  1WTW A;  5JJZ A;  1B9M A;  2EYJ A;  5A2Q L;  2I46 A;  3M85 A;  1AZQ A;  5ELC A;  2Z4I A;  4BY7 B;  1STE A;  5C3E B;  1D6E C;  1FNW A;  4V0B A;  4LMQ D;  3D31 A;  1JB3 A;  3EQL C;  1BDO A;  1QCB D;  4XDX A;  1MSH A;  3CQZ B;  4H7B A;  1OXU A;  3S1M B;  1ZXT A;  2QF7 A;  4IFD J;  4KY6 A;  1CI3 M;  1KNE A;  5EKI A;  1RD9 D;  1I4G A;  2WKC A;  2CW0 C;  2D2C C;  2WB1 B;  1CTM A;  1D5Z C;  2K5D A;  5J39 A;  4QMG A;  3SDZ A;  2NN6 I;  1LV9 A;  3C1F A;  1KTK A;  1RTN A;  3S1Q B;  1GXD C;  1WTV A;  2RSN A;  5CV4 A;  1PTO D;  3QG1 A;  3CKI B;  1GHK A;  3RZO B;  3AB9 A;  1EEF D;  2D62 A;  4XIG S;  1EZ8 A;  3KLS X;  1DOK A;  2NTS A;  1CA6 A;  2NN6 G;  2LS0 1;  2EJG C;  1KNA A;  3BYT B;  3NE5 B;  3SK4 A;  3FPP A;  1DZ1 A;  1D5M C;  4RHS A;  5LL6 X;  1SNC A;  1R4Q B;  5T1I A;  5IGB A;  1H9J A;  2EXZ A;  4DXF A;  1A3T A;  1HQM C;  4UAI A;  2F0O A;  4FVM A;  3D4D A;  4EQO A;  3V96 A;  1X3P A;  5DAU A;  3SR1 A;  1EL0 A;  2HDL A;  1BCP D;  4CKC A;  4QB4 A;  1PZI D;  2RKS A;  4NW2 A;  1Y1W B;  3KBX A;  1ZYR C;  2H1E A;  3D8G A;  1OXS C;  3O13 A;  1STN A;  3NTH A;  3GTM B;  5C0X I;  1NR4 A;  4ILW A;  3GTJ B;  1LT4 D;  5KGU A;  3PUX A;  2EYH A;  2F0U A;  4DAV A;  4CBV A;  1FNU A;  1G29 1;  4PV1 C;  1EEI D;  4CKE A;  5A35 A;  1SE3 A;  3MWY W;  4H13 C;  3QOJ A;  2SEB D;  2VUM B;  2R7Z B;  1CZG A;  1EZ6 A;  2EY2 A;  4O42 A;  2B2T C;  3W2D A;  3BG3 A;  4HN7 A;  4M8A A;  1OXV A;  4HMJ A;  4C3I G;  1STA A;  2FHT A;  3WDN A;  1JOK A;  1STB A;  3FDT A;  1G91 A;  2QCP X;  1IYV A;  1S5E D;  3NBH A;  4UDU C;  5KND A;  1B3A A;  1LTB D;  2F0V A;  2SNS A;  2R3Z A;  5M3F B;  4LK1 C;  1LT6 D;  1Q8I A;  2ICE C;  2E74 C;  1PZJ D;  2R6G A;  3D4W A;  1B4O A;  2BE5 D;  4A3D B;  3LNN A;  3Q6S A;  3EFX D;  3NQI A;  2RQX A;  1B9N A;  4K6D A;  3S2D B;  2EYP A;  4RAU C;  2NYZ D;  1WD1 A;  3SE0 A;  1R9T B;  1I50 B;  1OO9 B;  2EE1 A;  1FD7 D;  2IX3 A;  2IX1 A;  1PDQ A;  1I6V C;  3I3C A;  4HR7 B;  1JCK B;  5KEE A;  2YYZ A;  5FO7 B;  3VYR A;  3JAM E;  1DD2 A;  4Y7N B;  1PTO B;  1TS5 A;  1PFM A;  2NZ1 D;  2GA4 B;  4KJO A;  1YNJ D;  4Z9C B;  1GHJ A;  4RGM A;  1F77 A;  3E0J A;  4ULL A;  4I7Z C;  1U4L A;  1K8O A;  3QWN A;  3EA6 A;  4KMU C;  1XWE A;  4RGN A;  3FVQ A;  4OGQ C;  1F2Y A;  1SXT A;  3KK7 A;  2KHS A;  2FIN B;  2F0J A;  3OOC A;  3HKZ B;  5C44 B;  4K2K A;  2HCI A;  1Q1B A;  2OT2 A;  2EPB A;  2F0P A;  4BS9 A;  3D6C A;  2DY7 A;  1EU4 A;  4HAE A;  1V8Q A;  3K59 A;  3FPU B;  2F4I A;  4RCN A;  4IUN A;  3S17 B;  2F0T A;  3E6Z X;  2MUY A;  1BCP B;  5G3L D;  1VMC A;  3IL8 A;  5KYL A;  4G7O C;  4C3J B;  2OF1 A;  1SYE A;  2K6A A;  2PPB C;  5IGC A;  2IJ0 A;  4ZUJ A;  1S4Z A;  3BDC A;  4CGY B;  2B2U A;  2XN9 C;  3EVQ A;  1Q1E A;  5E4W C;  1EY6 A;  4TRD A;  5C5M A;  4PNY A;  4KV6 A;  4KTA A;  5CV5 A;  4X3T A;  1EIH A;  5M5W B;  3DM1 A;  2CW0 D;  2XVS A;  3MZ5 A;  1GUW A;  4IQZ A;  4RGO S;  1SMY D;  3C1E A;  4FYD A;  2FFK B;  1ILP A;  4ZLT F;  3HOU B;  4PMC A;  4CJ2 C;  1SNP A;  5CV9 A;  4A3K B;  2MPM A;  5COY A;  1Y69 U;  4KJN A;  1SEB D;  3S16 B;  3BDO A;  3AMU A;  2KA7 A;  3A55 A;  1I4X A;  1B53 A;  3JAM L;  1EFI D;  1HUM A;  1JOR A;  5KNB A;  5CC4 A;  4OO1 H;  1I3Q B;  4HSP A;  4MN3 A;  5I6Y A;  3I4M B;  1XYI A;  4IUR A;  4QF4 A;  1BBX C;  4DA2 A;  3A7A B;  1U4R A;  3C46 A;  1K83 B;  1ESF A;  3FRP B;  4ZKB B;  1PTO H;  1NAP A;  5CBA E;  4JK1 C;  2KUM A;  1PRT D;  2BA0 A;  1PMR A;  2RDH A;  1GUN A;  4DK0 A;  3R2I A;  1ZYR D;  4R8N A;  5C4X B;  1HQR D;  2PO4 A;  3ITP A;  3DWP A;  2EYF A;  2PW5 A;  3TBI B;  2EYL A;  1RF2 D;  3VR6 A;  3Q23 A;  2I07 B;  2A68 C;  5M3M B;  5HUR A;  1DOL A;  5JVG 3;  3P1H A;  4Q5V A;  3PMF A;  3PIP 3;  2KOL A;  1LTG D;  4K5V A;  3RUZ A;  3PV0 A;  2J0T D;  1A2T A;  4IAL A;  3T4A C;  4FF1 A;  1JWU D;  2JA8 B;  1Y8N B;  2R92 B;  4TSS A;  3CHB D;  2XRS D;  1DON A;  2EJM A;  4RH6 A;  3S15 B;  3MFY A;  3K0Y A;  1TU2 B;  4IFD H;  1HFN A;  1E0B A;  1O7L A;  4ME5 A;  1WTQ A;  2N55 A;  2O5J C;  2WIN B;  3TN2 A;  1EYD A;  3IFT A;  1SNQ A;  2RSO A;  3NTI A;  1K8M A;  1L0Y B;  5K36 H;  1B1Z A;  4V19 0;  3M3Y B;  1I4P A;  2Z4H A;  4RA8 A;  1BUV T;  1EY0 A;  2MP1 A;  5BN3 A;  3VYU A;  2BDN A;  3KUP A;  1CT1 D;  3V2T A;  3MC0 B;  4U67 3;  2XSC A;  1S5F D;  1S5B D;  1YNN C;  5DM6 3;  2VXW A;  4ZYS A;  3MVV A;  3M4Y A;  2F0W A;  3L7Z C;  4XTC S;  1DXM A;  1AP0 A;  3TP6 A;  4J8Q A;  2E2I B;  3SK5 A;  3C3L A;  4TQU S;  3TP5 A;  1QNU A;  4L8J A;  5FO9 B;  4KHZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...