1Y8NB

Crystal structure of the pdk3-l2 complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
102
structure length
97
Chain Sequence
SYPPHMQVLLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILVPEGTRDVPLGTPLCIIVEKEADISAFADYTDLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 3
publication title Crystal structure of pyruvate dehydrogenase kinase 3 bound to lipoyl domain 2 of human pyruvate dehydrogenase complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 14
structure length 97
sequence length 102
ec nomenclature ec 2.3.1.12: Dihydrolipoyllysine-residue acetyltransferase.
pdb deposition date 2004-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1y8nB00
5KNDA 3OOCA 1Q1EA 4H0LC 2V4DA 1K8OA 3OPOA 2BE5C 2NN6I 1B9MA 1E2ZA 1YNJC 3A8IE 3T56B 5JEAH 3KLRA 1GJXA 3QIAA 2A6HD 1GHJA 4KKTA 3IKJA 3GQBA 1Z6HA 1E2WA 3LNNA 1ZKOA 2A6ED 4JBWA 4L8JA 1V8QA 1Q1BA 4KI0A 1HPCA 2D62A 1TKWB 4KN4C 1EWHA 2A68D 1HTPA 3A8JE 1H9MA 3WDNA 4G7HC 4XIGS 3H94A 3A7AB 4IFDG 4DK1A 2A68C 5BN5A 4DNRB 3RLFA 1IW7C 3T51B 2O5IC 2DN8A 5KNCA 1T5EA 3FPPA 2K7VA 4I7ZC 3U9SA 1ONLA 1H9SB 2DNCA 4TKOB 2BE5D 3SE0A 1Y69U 5KNBA 5K36G 3BDOA 4OO1H 2L5TA 1O7LA 1FYCA 5C0XG 1H9RA 4OGQC 3A7LA 2E74C 1H9KA 2KA7A 2E76C 4KN7C 3VA7A 2CW0C 3LWUA 2NN6H 4H44C 2B8FA 3TZUA 5A35A 5JEAG 2EJGC 2BA0A 2K33A 3CRLC 1GUSA 1Z7TA 3OW7A 2K32A 3PUWA 4IQZA 1VDZA 1Y8OB 1OXSC 1K8MA 3D4RA 1A6XA 3M85A 1IW7D 4KKSA 2BA1A 1H9JA 3IFTA 1IYVA 2ZT9C 1DXMA 3NE5B 2JXMB 3VR2A 3ND8A 1Y8PB 3P20A 4G7ZC 2A69C 3I4LA 2BDOA 3QG1A 3A8KE 2R6GA 4DNTB 4KHZA 1OXVA 4LJZC 1FR3A 4BA2I 4GZYC 4PV1C 4G7OC 2B8GA 3ND9A 2JEAI 2AWOA 1Q90A 1TU2B 1V43A 3VR5A 1LABA 4KMUC 3VR6A 3SDZA 3VR4A 3M7NA 4DK0A 2D2CC 5BN3A 3T53B 2KCCA 3M4YA 1DD2A 1DCZA 2EDGA 3PUYA 4LK1C 1GHKA 3PUXA 1LACA 2Q8IB 2DNEA 2LMCB 4RCNA 1QJOA 1HQMC 1G291 2AUKA 1GUTA 2PCFB 3N6RA 3VR3A 4KKUA 2A69D 1CFMA 3HGBA 2E75C 3PV0A 2EJMA 1VF7A 3I72A 1YNNC 5C0XH 3FMCA 1VF5C 3BG3A 3QJYA 1OXUA 1GUOA 1CI3M 2JEBI 2O5JC 1CTMA 3PUZA 1BDOA 4JK1C 1ZYRC 2D5DA 4TQUS 5BN4A 1Y8NB 2F1MA 1E2VA 2EJFC 1OXTA 1VCIA 2A6HC 2EVBA 3AB9A 3DXJC 3L7ZC 1H9SA 1B9NA 2PNRC 4IFDH 1GUNA 4OO1G 1OXXK 2A6EC 3GD7A 2QF7A 2IT1A 3CRKC 1GUGA 3W3AA 3PUVA 1PMRA 2YYZA 3MFYA 2AUJD 1HCZA 4H13C 3D31A 4HR7B 4BA1I 2NN6G 3MXUA 2PPBC 3I73A 4XTCS 1I6VC 2JE6I 3EQLC 1O78A 5K36H 1IYUA 1SMYC 1Q12A
chains in the Genus database with same CATH superfamily
2Q2UA 3F2UA 1GO3E 4OX9Q 4CGYB 2BE5C 2NVQB 2K5WA 1A3TA 3QIAA 2TMPA 3PO2G 3KBGA 4KKTA 3CCVA 1JJGA 1LTID 1YVCA 2EYLA 4KN4C 4DXFA 2VW9A 2QCPX 3F1ZA 4R8IA 3GTLH 1MI2A 4IN3A 5CBAE 2KCNA 4R1JA 5KNCA 1QVGA 3HOVH 5HGTA 2WAQG 1TS5A 1Y69U 5KNBA 2K5VA 1Z47A 4BY1G 2K6AA 2RDGA 4R4IA 4DUYQ 4CKEA 4KN7C 3CXCA 1D1KA 1ET6A 3C2PA 2L11A 4CKBA 1EIGA 1HJPA 2MPMA 1C7YA 3HOXB 5I9PA 3NTIA 1WCMG 2PW7A 3VA5A 4GKJL 1N9WA 1IYVA 2QEXA 4GOPA 2UUCL 5E4WC 5COYA 5D3DA 3KJOA 2OCEA 4ALPA 1PH1A 2VQEL 1ZEQX 4BA2I 3K5NA 2XNAC 4P74A 4LF9Q 4JI3L 3JAML 1DM0B 2HD3A 2MJ8A 4ODGA 4YIJA 3GTQH 4GOPB 3TREA 4C3HG 4BY7B 3K0YA 1K3BC 4MN3A 4ZKCB 1GHKA 4JI1Q 2NVTB 4AIMA 4G4KA 1SRUA 5IT9L 4OWWB 1PTOB 1YITA 2I5HA 1WD0A 1R4PB 4QCLA 2WKCA 3RN2A 3HEJA 5EPKA 1PFMA 2J4XA 2NVYB 2IHFA 4IUVA 4ID6A 5C3XA 5CGKA 2O2LD 1GUNA 1ICWA 1OXXK 4A3GH 1J8IA 1WTQA 3S2DB 2F0IA 2L12A 3A5UA 1VQ4A 4A3JB 1PYWD 4KV6A 3OHXC 2QDLA 1Q12A 1YI2A 4XQNA 5C44B 4H0LC 1M4VA 1VQDA 2X6LA 3PIOA 5DNFA 2L55A 1ZYRD 4DV4L 1EY0A 4PZ8A 5FK9C 4YHHQ 1IBML 3PMFA 3AMUA 1JJCB 1B2TA 4CJ1B 3ERSX 1WJJA 1P16A 3WDNA 4KLKA 4HJ9A 3GTPB 1TWAB 3KJPA 4BBSG 1XNQL 2RCNA 1VQOA 3CQZB 2XSCA 3SK8A 4ZAIA 5DLQE 4L5TA 3GTKH 3U9SA 1Z9FA 2E2JB 4TKOB 3NSWA 5IGEA 1E1OA 5C4JB 1LTGD 2RVLA 3DM1A 4NPSA 2KECA 1C9OA 2NZOA 1XMOQ 4YCUA 1MSGA 2E74C 2I5LX 4DR4L 4B3SQ 1I3QB 4JC0A 5K5PA 1Z7TA 1UE1A 3NELA 4FVMA 3EN2A 3DLLA 2IW3A 1I50B 1F77A 5FO7B 4EVOA 1HRJA 3ND8A 4G7ZC 5CV8A 4O42A 2VL6A 1IKMA 1TS2A 4PMCA 4RWSC 1JWMD 3FDTA 3W2DA 5M9OA 1VQNA 1CKOA 1N32L 2WFWA 4DAYA 3FVQA 3I4NB 1SE8A 1S5DD 4K14A 4QJFA 1EIFA 1ASZA 1J5EL 4A3DG 4DK0A 4PG3A 1STGA 3LX0A 3CCEA 3S1RB 2KCCA 5A2QE 2ES2A 3DWQA 2B2VA 2JA5B 4DPGA 2AUKA 5T1GA 1GUTA 3A74A 2LXJA 4DV3L 1CFMA 2UUBL 1LLRD 3SK6A 5IWAQ 4IJLA 3GTGB 2ATWA 3S1NB 5C5LA 1UE6A 1CTMA 4A4IA 1FNUA 4K0KQ 3D3RA 3IRBA 1OXTA 2N78A 2A6EC 2KBNA 2QF7A 5FO9B 5C3EH 1W3SA 2IT1A 4M8AA 2I5MX 3F2DA 4LF9L 4DAPA 3L9AX 3SK4A 1SNPA 4GKKL 1F2MA 1I6VC 4POFA 4HJ5A 2A8VA 3VYUA 2DJGC 4HJAA 4GNXA 3T1HQ 1SLJA 1VQHA 2Z8LA 4HSVA 5M3MB 1S3OA 1EL0A 3D4DA 3HKZG 5FO8B 1BBXC 1V8QA 2ZJPA 4GNXB 4KI0A 4JI2Q 2D62A 1D8LA 5C4XH 4UP8A 3Q22A 3RN5A 1HTPA 1VQFA 2NTTA 3ICEA 1Y14B 1LT3D 2RCFA 3IFDA 2B63G 3T4AC 3KYHC 1SJED 2F0WA 4UPAA 5EKLA 1HZBA 2WINB 5AFWA 3Q23A 1OTCA 1D5ZC 3BVMA 1A3UA 2FMMA 5KYLA 2E2HH 3FKIB 3J81E 2HQLA 1TWCH 3A7LA 2HHHQ 1JE4A 1LTAD 4IOCA 5A35A 5I6YA 3TP6A 3GTOB 2C9OA 2QW7A 2F03A 1EU4A 3TZDA 1STYA 4J1MA 5M5WB 3RZOH 2R61A 3EJIA 2IX1A 3CF5A 4OXPA 4KD3A 3P20A 4DU9A 3QG1A 1GKHA 3J80E 4DV2Q 4IALA 4C2MH 2B8GA 2RSNA 5EJWA 3J80i 3BDCA 1V43A 4PQXA 3VR5A 4A3KH 3HOWH 3BDLA 1PH9A 3CCSA 1YJ9A 1WTPA 3VR4A 4K8IA 1SYBA 2VUMH 4HIKA 2EYPA 2ASBA 2EDGA 5GADC 4RA8A 5DEHA 1PXUA 3H3VC 5JJKA 3CCRA 1Q81C 1HQMC 1ENCA 2JA8H 3S15H 2KUMA 4EQPA 4KJNA 3FMCA 3H6MA 1FL0A 3HRZC 2F0QA 4F88A 2JEBI 2F3VA 1BOSA 2D5DA 1JMCA 4K5XA 3KDFA 3QWNA 4FYDA 3KLWA 1BO0A 4DV0Q 1N33L 1DONA 1G8ZD 3MC0B 3R2TA 1K73C 4K5WA 1A15A 1NMGA 2VS1A 3D8GA 2EYMA 1IYUA 5I2YA 1NSNS 4DV5Q 3T1YL 5CV4A 3S9WA 1IBKL 4GLXA 1VQ6A 3NBIA 4DR6L 2B2VC 1HFNA 2Y0SB 4Y7NB 4A3BH 3T56B 3QOJA 1HQRD 2A6HD 3HOXG 1HNZQ 3GQBA 3H3VH 2ZTEA 3C46A 4BBRB 2I0QA 3I4MH 4L8JA 4I65A 1X3PA 3E9HA 1IBLQ 4IPGA 3VYSA 4ZLTF 5M3FB 1VQLA 5LMUQ 5IYBH 2LS01 1P8LA 2BCOA 2NTSA 4A3LH 1E1TA 2JA6H 1ONLA 3HG9A 1KL9A 2IY5B 1VQBA 3K5LA 2CVRA 1G91A 1LT6D 1YEZA 5IYCG 2CW0C 2WAQE 3EVQA 5IP7G 4JI0L 4X62Q 3CC4A 4RAUC 1B8AA 3CRLC 3OW7A 2CKZB 4PMBA 4JI6L 3D4RA 4AYBB 3CP0A 2H4OA 2R3ZA 4K2LA 5EBDA 3IFTA 4X3TA 3VR2A 4QB4A 1Y8PB 1EY7A 1IKLA 1MKHA 1RTNA 2EOTA 1E3PA 1CZWA 2PMZB 3C3LA 4GZYC 4PV1C 4CDFC 2PI2E 4R4TA 3R8BA 3TS2A 3MWYW 3VYTA 3S2HH 3M4YA 3A0JA 5KYIA 2WB1B 1LACA 2Q8IB 1WYDA 1AZPA 2D0OA 4HJ8A 3C1EA 1HNXQ 1ZXTA 2K14A 4F87A 1EYAA 3OMCA 2R92H 3L2PA 1BDOA 3FHWA 1HNWQ 3GTLB 3NENA 3MXNB 2F1MA 1CT1D 3SEBA 4IFDH 3HOVB 3GD7A 1SFOH 1QB5D 1V1PA 3CRKC 3W3AA 4HTHA 1ILQA 1UEAB 4DR5L 3EROA 2K5HA 4ZKBB 1SNCA 4ZQ3A 1CQFA 3KF6A 2CHBD 1O78A 1SNQA 2SDFA 1PV4A 2K50A 2EY1A 1D7QA 3KBXA 2YTYA 4WJ3M 4GS3A 4HIMA 4U673 3DHQA 1E2ZA 4WFN3 2A1AA 2P5ZX 4XYOA 1QUQA 1G51A 1ZKOA 3I56A 2B2TA 1XNRL 2K5QA 4QUFA 4AQYQ 2QGQA 3FRPB 1L1OA 3R93A 1JWUD 1XMQL 1RTOA 2BE5D 4JCVE 2LSSA 2CCZA 3I4NG 1BVSA 4DV0L 3RUZA 1PTOF 2K1BA 1H9RA 1U4MA 4JBMA 4DR1Q 3PIO3 1HHVA 1NAPA 2JA5G 1QNKA 3AYHB 3SHLA 3L0OA 2EJGC 5IGCA 2F0TA 1TVXA 2M00A 1DOLA 4A3FB 1VMCA 4LF4Q 4XQJA 2F4VQ 2Z1CA 3J7A5 3R3OA 1N36Q 3Q24A 1GUWA 3I90A 4JI4L 3PO2H 2SEBD 1W6KA 4A3GB 3WOEA 1IBLL 4DR3Q 1NCVA 4EX5A 1Q90A 1BUVT 5CC4A 4Q5VA 2NVXH 3GTJB 5HY6A 1G2SA 1XXGA 3TRZA 2M2LA 3SDZA 1RDPD 5ISRA 1HXYD 2PQAA 2Q2HA 1YHBA 3UDGA 3PQIA 1DJRD 1I4RA 4QUCA 1TWFB 2LKVA 3J7AF 3S1MH 5GQOA 2K05A 2Z4IA 1SE2A 4KKUA 3QOLA 1D5MC 1EOVA 2E75C 4BY1H 4OL7A 1PRTF 3H15A 2XWBB 2E5LQ 4YWKA 2ZM6L 2OT2A 3DUZA 1JQYD 2GVBA 3EA6A 4QIWB 1RD9D 3DXJC 2HIVA 3DMUA 2KHJA 3GTKB 4RG1A 4ZRZA 4NXML 2XVSA 3BZCA 3NBHB 4H13C 4UP9A 4X3SA 1HH2P 2HQEA 2UXDL 2AHOB 2BH8A 3OYYA 3FKIG 1U4RA 1SYFA 2EY6A 4JI5Q 4C3HH 3O13A 3RZDH 2OWOA 4KY6A 1YNJC 4PNYA 2ZJRA 2E2DC 2SNSA 4DV6L 1V1QA 1TKWB 2Z0SA 4LF6L 3G71A 1JE5A 1SE3A 4GN5A 4KY5A 3U4ZA 3K5MA 4JV5Q 2AQ3B 4B3MQ 1T5XD 1EYCA 3NTKA 2EY5A 1JICA 4LFCL 4P73A 1IW7C 4LWCA 1TR5A 3M7GA 1I94Q 1MIUA 5CMDA 1RJTA 1U4PA 1FYCA 5JJZA 5J1ZA 2R7DA 3JAMc 3TEHB 4X66Q 3CC7A 1KRSA 4RGOS 4IPDA 1SEBD 2RDHA 3MVVA 4DV7L 4RKBA 4KHPQ 1OXSC 1KNAA 4O1NA 4KKSA 4DV1Q 1O7YA 4DN4M 1H9JA 2ZTCA 5IT9c 2B2TC 1X56A 2ZT9C 4U68A 3RNUA 1EY6A 5AJ3Q 2BDOA 4BS9A 2VQFQ 1SSOA 2ZTDA 5C3EB 4WJWA 1WTVA 1X3FA 2AWOA 5FLXc 1L1OC 1XJVA 4X64Q 1XPRA 4KMUC 1MBYA 5BR8Q 4CDCC 4R9WA 2ZXPA 4LK1C 1DD2A 2KENA 4DR7Q 2UU9L 3TMEA 3SR1A 3CCMA 4IO9A 4JI8Q 4OONA 1IHZA 1JR0D 1ILPA 1GM5A 3BG3A 4C3JH 5FLMG 3QJYA 4B3RL 4BBRG 3E3XA 1STAA 4LAAA 1E7ZA 4RH6A 2RHSB 2UXCQ 2I46A 2CH4A 1EWCA 3CCLA 1L0XB 4DR2L 1LM0A 2UXBQ 1RCVD 1EY4A 1A3VA 1SMXA 2JK8A 5M3FG 1N36L 4FXDA 1WTRA 1STNA 4ME3A 5KEEA 3PUVA 1HUMA 3DM3A 1Q86C 3PF5A 4FXGC 2E2HB 4YY3L 4FF1A 4S3SA 1HR0L 1TWCB 2MUYA 3NWTA 2OF1A 1VQPA 4EQOA 4X65L 2DY7A 1FGUA 4BXXG 4A3DH 4LF8L 1SJHD 5FLXL 3KLRA 1E22A 2JJQA 5I6WA 2A6ED 3HZXA 4AYBG 4DFAA 3QB3A 3VYRA 2RF4A 1QCBD 1BKBA 2G9HD 1LTTD 2EE1A 4G7HC 1EWIA 4C2MB 3RLFA 3HOWB 4A3KB 5I9OA 1QILA 4OHJA 1GXDC 5IE8A 3UE0A 5LMNW 5EKIA 1EIHA 1UNSA 2VUMB 2DGYA 3ULPA 3BDOA 1O7LA 2HCCA 1L0YB 1EOTA 3STBC 2F0UA 1BQQT 3J7YW 2JA8B 3S15B 2R7FA 3NK9A 4LFAL 4FF2A 3MEHA 2BA0A 3L3OC 2JA7B 1GOZA 5LMNQ 4DUZQ 2RBMA 1KRTA 3NQIA 1Q7YC 4LF7L 1KQSA 1BF4A 1G6PA 1ML0D 3OW2A 3KFUA 2RKSA 3T13A 4KHZA 4A3IH 4G7OC 5IODA 2Z9HA 3HOZB 3HOYH 5LL6X 4HIOA 1SYDA 1EZ6A 2F0VA 2FINB 4DXGA 3M7NA 3S24A 2B63H 4WORA 2PQEA 4FO2A 4OX9L 1IZ6A 5M5XH 1DYQA 1YNND 2PCFB 1X3QA 3K7AB 5CORA 3H09A 1EQQA 2EYOA 2MGSA 1WOCA 2B3GA 2F3WA 3I4MB 1MGSA 1YHAA 1SE4A 5I2XA 3P1HA 3K57A 5I4DA 5EGTA 4F8MA 4E6IA 2HDMA 1S5BD 2PNRC 1FJGQ 2CFMA 2JA6B 1MD2D 2R93B 3S14H 4YWLA 4X3UA 5EPJA 3Q6SA 4WRDA 4P75A 5CV6A 1EQVA 4DAYB 4DUYL 3IL8A 1Y1WH 1Q1EA 1EYDA 2K5NA 1K8OA 3X3NA 1H95A 1GHJA 4A3MH 3P7JA 4YCVA 1SXTA 4L6TB 4A3FG 4IFDJ 4ZUJA 3HOUH 4HCSA 4B3TQ 1UEBA 3F2CA 4JPBW 4MTNA 5IYDG 2GVAA 2A68D 2HCIA 3M4QA 3M3YH 1D5XC 1KABA 2CWAA 3HFZB 4RHSA 4A3GG 3S16H 3H91A 5D3IB 1T5EA 2K7VA 2DNCA 4YCWA 3S2HB 1NBWA 3NEMA 4XQQA 3MXGA 1X32A 4JI1L 4A93H 3SGIA 1HUNA 5C0XG 1TWHH 1JCKB 4NXNQ 3NP8A 2XN9C 2FMCA 3AQQA 5CYUA 2B8FA 5DM73 2R92B 2QKIC 4B08A 1U0LA 2BA1A 4R4QA 1K0SA 1XWEA 1TT2A 3NUCA 3PO3B 1PH3A 2EPBA 4IZ8A 2R6GA 1XYIA 3Q0AA 2KCMA 2D0PA 1Q82C 2CW0D 1OO9B 4JI7Q 4K8JA 2LFNA 4ZCKA 3J81i 4G57A 2D2CC 3V2TA 2IX0A 3PUYA 2FXQA 3U9OA 1KAWA 2IL8A 2EQSA 4XT1B 3N6RA 4YHHL 1YNNC 2HIXA 5IYCH 2NVTH 4KTAA 4HIDA 1N34Q 5IOCA 5D14A 3IAYA 2PZWA 1PTOH 4XT3B 1BCPF 2EJFC 2K01A 3F2BA 1I4GA 1PRTC 4LF5Q 3K81C 4GN4B 1VQIA 3PIPA 5ELDA 1D2BA 2NZ1D 1T9HA 2DJFC 1AE2A 2NVYH 1EZ8A 4M1UB 1XMOL 1WFQA 3MXPA 5KNDA 1EY8A 3AU7A 1HA5A 3S2DH 4B3SL 3K5OA 2VB3X 1G2TA 2F0GA 1CHPD 2V1CC 2GN5A 3U58A 5G3LF 3MZ5A 1XTCD 2FFKB 3A54A 4ZUIA 1QOHA 2OTJA 1W6JA 2K03A 1STBA 4IUTA 2I07B 4NB3A 2A68C 1BR9A 4DA2A 1VQ5A 2KEEA 5C3EG 1J6QA 2QA4A 2EXDA 1QVFA 3KDFB 1SNDA 2R7ZH 4L63B 1A2TA 3UDXA 1PH7A 2ICEC 1X55A 4QY7A 2QDBA 1ET9A 3CQZH 1B70B 5EBCA 2XWJB 4C3IH 3S1MB 2E76C 1FGBD 1KC8C 2E2JH 1R9TH 1EIYB 3GV6A 1BXTA 5IWAL 3BS1A 1GUSA 3M4OH 2PI2A 4RMFA 5C0XI 2B2WA 1K83H 4K0KL 4MIUA 4GLAC 5JVH3 5ELOA 3G7LA 2AWNA 1SNOA 4RGMA 2A69C 3TP7A 1I5FA 2VZAA 3SXHA 2VNUD 2F0LA 1CM9A 1Y1VB 2E2IH 2F3IA 3BYTB 2JEAI 5JPNC 4BY7G 1KLGD 1I50H 2YU9H 3KOJA 4LFBQ 1LABA 4IUUA 3OIPA 1K8AC 2ZJQA 5KRUA 2PO4A 5IGBA 2NB0A 3UDFA 1A0IA 3PUXA 3RR5A 3T1HL 2LY7A 4HSPA 2DNEA 1SR3A 3K6OA 1CKMA 1CKNA 3I4NH 1V9PA 2PYKA 1PA6A 2HT1A 2B2UA 3S1RH 2JA9A 1XX8A 3V96A 4JI2L 2JA5H 3E6ZX 3I4OA 2Y0SE 1Q8KA 3OTOQ 1VCIA 1H9SA 3W1BA 1I6HB 4A3JG 1NTGA 4XXEA 1GUGA 4HCEA 4UHVA 1MSHA 3N52A 5C44G 4BA1I 4JYAQ 1QVCA 1S40A 1GVPA 2VUMG 1SMYD 2X69A 3ERQA 4JG2A 3I70A 5K36H 2HHHL 4JI7L 5ELCA 1NR4A 3BU2A 2JA8G 5IGFA 4A3EH 2Q2IA 2IHEA 3CMEA 4JVZA 2Z6BA 5JEAH 2JA7G 3TP5A 2N49A 4JBWA 5J3BA 1LUZA 1FNVA 3FP9A 5E4XA 4DV2L 2ZXRA 5C6AA 2A5HA 4DNRB 5EKKA 3K0XA 1M8AA 2WKDA 4AYBE 3J81j 2O5IC 5A2QL 2CWPA 3CU7A 3HOZG 4ZYSA 2QEJC 3I2ZA 1PHJA 1EFID 1I4HA 4OEMB 1YNJD 2K52A 1V1PB 2PMZE 1JJ2A 1EQTA 3BVGA 1WI5A 3VA7A 1Q46A 3KF6B 1JC7A 1HZAA 4KK7A 5ELNA 4C3JB 3J81c 1STHA 1JOQA 4IQZA 3OWEB 3I4MG 1R4QB 2WB1E 1IW7D 4WJ4A 4DKAC 2A19A 1QUQB 3MHBA 3GTQB 4DK3C 1HFGA 1M90C 4APVA 2VXWA 2MHVA 2JA6G 2R93G 1WTXA 4QF4A 3VR6A 3J80c 1L1OB 4DV5L 3H0GH 5LL6S 1E0BA 4A3DB 3G4SA 4P72A 1FNWA 3V05A 1IL2A 3VR3A 4LW1A 4J8QA 1HNZL 3DEPA 3KF8A 3AFPA 5TSSA 3GTMH 1KD1C 2B2WC 1GUOA 5D65A 1U4LA 5E3FA 3QO2A 5IP9G 2EIFA 2RDFA 3NXWA 4GKJQ 2UUCQ 2L9HA 5LMUL 5JOBA 1NE3A 1UAPA 4IUQA 2DUDA 4PZ6A 5FJ8G 2VQEQ 1HR0W 3J81L 2EXZA 4JI3Q 3E0JA 5C4HA 2YYZA 1X3GA 4J6HA 2NN6G 3MTSA 4LFBL 1KXLA 5CR3A 1SMYC 5FOBB 1ENAA 5L37A 5EPLA 2PQAB 4X62L 3HS0C 1CSPA 5M3MG 4ZK9B 5J22A 5JVG3 1KNEA 1B7YB 1JORA 2B2UC 2JN4A 1NR2A 1KAAA 2EYHA 4LMQD 3J80L 1WCMH 4CJ2C 3K8AA 1W2BA 1PFNA 3PO3G 4A3IB 4IFDG 2WP8J 5FLMH 3OWFA 3HOYB 4FF3A 4L5SA 4BBRH 3D0FA 4JBJA 1A2UA 4KY7A 1N8RC 2Q8RE 3A5ZB 2B63B 1C4QA 1VQKA 1S5FD 3SE0A 4QL5A 5M3FH 2C35B 3MAQA 4OGQC 5M5XB 3CKIB 1TY0A 1K9MC 4B9XA 1CZGA 1HNXL 4DV4Q 2L1BA 3I55A 2D9UA 1JOKA 3TS0A 2MFIA 4BXXH 1HNWL 1IBMQ 1NNXA 1PZKD 2F0FA 3I4LA 4HAEA 1KDBA 3ZJYC 4DNTB 1OXVA 1AEXA 1VQJA 1B1ZA 2F0SA 3STBD 1PH2A 4LNQA 2K28A 5M5YH 1FD7D 1L2FA 4QIWE 1Y1WB 1A8VA 3T53B 2L15A 3DWPA 1U5KA 3KLSA 4RKLA 3A55A 2LMCB 2LXKA 4V0BA 1PH8A 4DR4Q 1SBBB 2H1EA 4A3MB 3K80C 1VF7A 3I72A 3GDEA 3HOUB 2PW5A 4ABNA 1CQVA 1I4PA 1NJIC 3AFQA 5CV9A 3M3YB 4AQYL 1ESFA 5C3WA 1QE6A 3S16B 4OO1G 2NZHA 4BBSH 1YNXA 1V1OA 3SVMA 5EAYA 4FDBA 1BCPC 4FXKC 1PMRA 3BZKA 3MFYA 1N32Q 1HCZA 4HMIA 4HR7B 4RHRA 2PPBC 4A93B 4A3CG 3VDYA 1VQAA 2JE6I 3I91A 1TWHB 1J5EQ 1CI3M 1F9RA 2Y0SG 4DR1L 3UE1A 3NPPA 4QQBX 1B53A 2L0CA 2NN6I 2KHIA 3ER0A 5C4XB 2KQ3A 4DV3Q 4LF4L 1SDFA 2KEDA 2L4NA 2UUBQ 2F4VL 1Z6HA 3WOFA 1AZQA 3EFXD 3HP3A 3LGJA 1RKNA 4CDDC 2F0DA 1TWGH 4X6AH 1VQCA 5ELBA 1PZJD 1EUJA 3H94A 4DR3L 4ULLA 1LO5D 1Y1VG 2G5DA 4RGTA 3GV3A 3S17H 3PIP3 1F9SA 1B3QA 1KDAA 1LTBD 4DNIA 1PH5A 1VQEA 4IFDI 2B39A 4IPCA 4GKKQ 1ASYA 1PZID 4KD4A 1VQ9A 3RZOB 3NWSA 1STEA 2KCTA 4LUOA 4QGUA 3EIVA 2JP1A 2JSOA 3FPUB 3TZUA 3BJUA 5J39A 3ZYYX 4TVAB 3PUWA 1HTLD 1VDZA 1Y8OB 2E5LL 1A6XA 3ULLA 1X54A 4UDUC 3PGZA 2AMCB 1F9QA 5E1FA 4I7AA 1X3EA 3ONAB 3B6YA 4K6DA 2IPKD 4A3FH 3WWVA 5HGQA 1B3AA 4IJHA 1TU2B 5IYDH 2VY3A 2WB1G 2ICIA 2Q2TA 1WTWA 5GAEC 1F2ZA 1PTOD 4JW0A 4NMZA 4R8NA 3UI2A 2B2YC 3E0EA 4KJOA 5C4ZA 3TN2A 4AH6A 4JI5L 3GTJH 1PLFA 1AP0A 3JC66 1I4QA 2NBFA 4IURA 2B29A 1IXRA 5CV5A 3SK5A 5C0XH 4DF7A 1TWFH 2O5JC 4TSSA 3HOVG 4IUNA 4JV5L 4B3ML 1Y8NB 1E2VA 1FVIA 2YV5A 4ILWA 5GROA 2OTLA 1EY9A 2JYOA 1I94L 2R7ZB 2YTVA 1BNZA 1PRTB 1IL8A 3PCOB 4OIJA 1SYEA 1A63A 4XTCS 4FP5D 1AFPA 2WACA 4A3BB 3EQLC 1SYCA 4OO1I 4C3IB 1VS0A 4X66L 3RMHA 1R9TB 2V4DA 2AQ1B 2A74C 3J7ZC 3M4OB 2EYFA 2F0NA 2SNMA 4KHPL 1K83B 4C3JG 3S1QH 3IKJA 2FHTA 4DV1L 1PRTD 3RD4A 5KIXA 5AJ3L 1HPCA 3I7FA 2OQKA 2VQFL 3A8JE 1H9MA 2E2IB 4N8X1 4C1NI 2YU9B 5CV7A 5IGGA 2XGTA 1SAPA 4X64L 4YWMA 3CW2C 1N33Q 5BR8L 5C5MA 1TS4A 1LTRD 2WIIB 4N9TA 1F2LA 1AH9A 1X6OA 5JEAJ 1YBYA 4DR7L 1TXYA 3T1YQ 5F2DA 1IBKQ 1NY4A 3LWUA 4H44C 4JI8L 3P75A 4DR6Q 2UUAQ 4KHVA 2NVQH 2F0KA 2K32A 2RSOA 1QNUA 1CUKA 2K75A 3CPWA 3NQTA 4R4OA 1DXMA 2UXCL 3U50C 1B44D 2UXBL 3A8KE 2CH4W 1YJNA 1FR3A 1J9OA 4GOPC 1UE7A 4HEDA 3MEFA 1CA5A 2F0JA 2IWHA 1LYLA 1B4OA 1HA6A 1PTOC 1II3A 4A3EB 2ENBA 1KLUD 2Z6KA 4P71A 3G48A 1RIPA 4OWTB 2RA4A 3CCQA 2J0TD 2F0OA 2A69D 1MHWC 4JI0Q 1O80A 3GP7A 1XPUA 3BZDB 5E7NA 3A56A 1VF5C 1HZ9A 4JI6Q 3HOXH 1O7ZA 1SFOB 3PUZA 1ZYRC 1RF2D 4H02A 4TQUS 2KHSA 1D6EC 3NHHA 2NYZD 4A3IG 1CA6A 3AB9A 1TQOA 3HOYG 3GO5A 4A75A 4IPHA 1C8CA 3NTHA 4OELB 5JAVA 1VMPA 4H7BA 4BY7H 4CHTB 1NUCA 1WTOA 4HJ7A 3CCUA 2ZXOA 1QG7A 4HMJA 4J15A 5LMNL 4DUZL 4LUVA 5IP7H 4UY8C 2F0MA 3D6CA 1ICFB 1TY2A 3W5OA 4Q0FA 3LNNA 1B50A 1K8GA 1Q1BA 1PYSB 1EWHA 4Z9CB 3A7AB 4DK1A 4O2DA 1PDQA 5IGDA 1MJEA 4UP7A 2PNHA 2K4KA 2DN8A 4MHEA 3LWEA 2J7ZA 1IYJB 4I7ZC 4X3KA 1I4XA 3H0GB 5H1SE 4DR5Q 1ESRA 3I8ZA 1Y1WG 1KTKA 4A3JH 1PFBA 1H9KA 4RFBA 2MQHA 2K04A 3KLSX 2MO1A 1AN8A 5C44H 2JQOA 2F0EA 3TQYA 2K33A 2ID0A 3GTMB 4A3MG 5HURA 3PO2B 3HOUG 1K8MA 3CMAA 3NE5B 2NVXB 3MFGA 4IOAA 3X3MA 2JA7H 1XNRQ 1YZ6A 2YTXA 1LTLA 2A73B 1FJGL 2HDLA 3GTPH 1Q3LA 1TWAH 4CDEC 4FF4A 1BBWA 1S4ZA 2WAQB 2F4IA 3G6EA 1YJWA 3M9BA 1XMQQ 2OXPA 4A93G 4DAVA 1JOOA 3E9IA 5BN3A 1PH4A 4BY1B 5C4JH 2EY2A 3HOZH 2AKWB 2EZVA 4RCNA 3BYYB 1G291 1XPOA 2BH2A 5C4XG 3HGBA 1X9NA 2EJMA 1I3QH 2KJXA 4N8FA 1WCMB 2FJ2A 4B3TL 1GD7A 2UUAL 1OXUA 3CD6A 4ME5A 2SOBA 4C56C 2N55A 3K7AH 3KK7A 2EVBA 1QZGA 5CBEE 4JI4Q 1B9NA 1S5ED 1NMFA 4POGA 3ITPA 2F0PA 1JT8A 3K59A 3DEOA 3AEVA 1A62A 1LT5D 2TSSA 4FNFA 4C3HB 3RZDB 2XRSD 4Y52H 1K0RA 1YHQA 4NXNL 2R93H 3T16A 3D4WA 4RCOA 1AE3A 1D1IA 2Z6KC 5LHY1 5EQ0A 3RLOA 2CQOA 4C1NK 3A8IE 1GJXA 3TBIB 3BVZA 4GNXC 1CKNB 4NP5A 1SYGA 1E2WA 4PMWA 2VB2X 3GTGH 1O7IA 2MNAA 3S1NH 1EQRA 2ZM6Q 1EEID 3CC2A 4A3KG 3HOWG 4MZ9A 2DY8A 1PVOA 3RLNA 1DOMA 2RHQB 4CJ0B 5M5YB 3T51B 5IP9H 1VQGA 3FPPA 2CQAA 4NXMQ 3JAME 4TRDA 1H9SB 1LV9A 2XIWA 5NUCA 3JAMi 5FJ8H 4CKCA 3EBEA 2UXDQ 4JOIA 5T1IA 2KA7A 4QMGA 4NDXA 2NN6H 1F2YA 5IT9E 3CAMA 5JPMC 2N8NA 3CHBD 2QILA 1QWYA 3MXNA 3M85A 4DV6Q 1N34L 5GAGC 2X6GA 5M3MH 4UAIA 4DK6C 2OEOA 5FLXE 5IY0A 4LF6Q 4BBSB 4K2KA 4NW2A 1WD1A 4LF5L 3G6JB 3MA2B 3ND9A 3TSSA 4LFCQ 3OMGA 2R7ZG 3PO3H 4PZ7A 3C1FA 1TS3A 4N9PA 2BDNA 4RGNA 2G9DA 1VQ8A 1AW7A 1JB3A 1VQ7A 2N88A 4A3BG 4C3IG 2GA4B 3FKIH 1RODA 1QJOA 2EYJA 4V190 2KVMA 3K58A 4DV7Q 3PV0A 4XYQA 3GTOH 1TIID 1HZCA 2BOSA 1EU3A 2F0HA 5IYBG 1TWGB 1PFSA 3D6WA 2WV6D 4JK1C 1KHIA 4GLVB 5M5WH 3HKSA 4A3LG 4K5VA 3OIQA 4O0AA 1C48A 3J7AV 3L7ZC 2A6HC 3S17B 1L0WA 4B9WA 1YIJA 1S5CD 3CPFA 2RQXA 2AUJD 2N3SA 3I73A 1EFWA 1BCPB 3U4VA 5C0XJ 1KIXA 4DAMA 3OOCA 4EQNA 1K3RA 3OPOA 2UU9Q 1B9MA 1SROA 1CSQA 3ULJA 4F7XA 2H5XA 1CHQD 2K5DA 4MTKA 2M9VA 3TDQA 2KOLA 1CK1A 3KF8B 4B3RQ 1BCPD 5ELEA 5KGUA 1KDCA 4NKLA 2XTIA 4XIGS 4L5QA 3I3CA 3R2IA 5BN5A 1WTHA 1E24A 4DR2Q 4OWXB 4XDXA 4JBKA 3FEWX 3F8TA 4HN7A 4EGVA 2ALYB 2PZTA 1PH6A 5K36G 4EQ5A 4OO1H 2L5TA 3URYA 4YY3Q 1HR0Q 1EYGA 1F9PA 1RHPA 4MNOA 1K28A 4A3EG 1SNMA 4A76A 1DGSA 4X65Q 1G6ZA 2R92G 4A3CH 2AQ2B 1C0AA 5JEAG 5G3LD 5JJLA 3Q8DA 1S72A 1QZHA 2XRQD 4LF8Q 3DWAA 1UUPA 4Y7NH 3KUPA 4BWGB 3HKZB 1LTSD 3UDIA 1BBUA 3M4PA 2JXMB 3OTOL 1SN8A 5ELFA 4L5RC 3NBHA 4GN3B 4LJZC 1JB7A 1Q8IA 2B2YA 4LUZA 4IUPA 1WVLA 1MJCA 1UE5A 1X65A 5FKAC 2C5CA 4JYAL 1RL2A 2OQ0A 4DGZA 5GAHC 5JJIA 2IX3A 3TP8A 1Y1VH 2MO0A 3PF4A 4R4CA 1DCZA 1M1KC 4JOIC 5DAUA 2Q8TA 1EEFD 1PYBA 3S1QB 4LFAQ 5IIFA 2MP1A 2O4XA 2NWGA 1DOKA 1JWSD 3K7UC 3H3VI 2Z4HA 1EY5A 4LF7Q 2E8GA 4CBVA 3E5SA 1XNQQ 1XTDA 3S14B 5BN4A 2F52A 3OSOA 2PZUA 4P2CB 3PSIA 1LT4D 3CCJA 1ENFA 2HUGA 1DZ1A 1U9RA 2NUCA 3QR8A 1VQMA 3D31A 3MXUA 3H0GG 4K6LA 3W1GA 3HKZE 2IJ0A 4OIKA 5DM63 1I6HH 1UWVA
chains in the Genus database with same CATH topology
3F2UA 4CGYB 2BE5C 2NVQB 2K5WA 1A3TA 3QIAA 2TMPA 3KBGA 4KKTA 1LTID 2EYLA 4KN4C 4DXFA 2QCPX 4R8IA 1MI2A 4IN3A 5CBAE 2KCNA 5KNCA 5HGTA 1TS5A 1Y69U 5KNBA 1Z47A 2K6AA 2RDGA 4CKEA 4KN7C 1D1KA 1ET6A 3C2PA 2L11A 4CKBA 1EIGA 2MPMA 3HOXB 5I9PA 3NTIA 2PW7A 3VA5A 1IYVA 5E4WC 5COYA 5D3DA 1ZEQX 4BA2I 3K5NA 2XNAC 3JAML 1DM0B 2MJ8A 4ODGA 4YIJA 4C3HG 4BY7B 3K0YA 4ZKCB 4MN3A 1GHKA 2NVTB 4G4KA 5IT9L 1PTOB 1WD0A 1R4PB 4QCLA 2WKCA 3HEJA 5EPKA 1PFMA 2J4XA 2NVYB 4IUVA 4ID6A 5C3XA 5CGKA 2O2LD 1GUNA 1ICWA 1OXXK 1J8IA 1WTQA 3S2DB 2F0IA 2L12A 4A3JB 1PYWD 4KV6A 3OHXC 1Q12A 4XQNA 5C44B 4H0LC 1M4VA 2X6LA 5DNFA 2L55A 1ZYRD 1EY0A 5FK9C 3PMFA 3AMUA 1B2TA 4CJ1B 3WDNA 3GTPB 1TWAB 3CQZB 2XSCA 3SK8A 4ZAIA 3U9SA 2E2JB 4TKOB 3NSWA 5IGEA 5C4JB 1LTGD 2RVLA 3DM1A 2KECA 1MSGA 2E74C 1I3QB 5K5PA 1Z7TA 4FVMA 2IW3A 1I50B 1F77A 5FO7B 4EVOA 1HRJA 3ND8A 4G7ZC 5CV8A 4O42A 1IKMA 1TS2A 4PMCA 4RWSC 1JWMD 3FDTA 3W2DA 5M9OA 4DAYA 3FVQA 3I4NB 1S5DD 4K14A 4DK0A 3S1RB 1STGA 3LX0A 2KCCA 5A2QE 3DWQA 2B2VA 2JA5B 2AUKA 5T1GA 1GUTA 1CFMA 1LLRD 3SK6A 3GTGB 3S1NB 5C5LA 1CTMA 1FNUA 3D3RA 1OXTA 2A6EC 2QF7A 5FO9B 2IT1A 4M8AA 4DAPA 3L9AX 3SK4A 1SNPA 1F2MA 1I6VC 3VYUA 2Z8LA 4HSVA 5M3MB 1EL0A 3D4DA 5FO8B 1BBXC 1V8QA 4KI0A 2D62A 3Q22A 1HTPA 2NTTA 1LT3D 3IFDA 3T4AC 1SJED 2F0WA 5EKLA 2WINB 5AFWA 3Q23A 1D5ZC 3BVMA 1A3UA 2FMMA 5KYLA 3FKIB 3J81E 3A7LA 1JE4A 1LTAD 5A35A 5I6YA 3TP6A 3GTOB 2C9OA 2F03A 1EU4A 3TZDA 1STYA 4J1MA 5M5WB 2R61A 3EJIA 2IX1A 4KD3A 3P20A 4DU9A 3QG1A 3J80E 4IALA 2B8GA 2RSNA 5EJWA 3BDCA 1V43A 4PQXA 3VR5A 3BDLA 1WTPA 3VR4A 4K8IA 1SYBA 2EYPA 2EDGA 4RA8A 5DEHA 1PXUA 3H3VC 1HQMC 1ENCA 2KUMA 4EQPA 4KJNA 3FMCA 3H6MA 3HRZC 2F0QA 4F88A 2JEBI 2F3VA 1BOSA 2D5DA 4K5XA 3QWNA 4FYDA 1BO0A 1DONA 1G8ZD 3MC0B 3R2TA 4K5WA 1A15A 3D8GA 2EYMA 1IYUA 5I2YA 1NSNS 5CV4A 3S9WA 3NBIA 2B2VC 1HFNA 2Y0SB 4Y7NB 3T56B 3QOJA 1HQRD 2A6HD 3GQBA 3C46A 4BBRB 4L8JA 4I65A 1X3PA 3VYSA 4ZLTF 5M3FB 2LS01 2BCOA 2NTSA 1ONLA 3HG9A 3K5LA 2CVRA 1G91A 1LT6D 2CW0C 3EVQA 4RAUC 3CRLC 3OW7A 4PMBA 3D4RA 4AYBB 2H4OA 2R3ZA 4K2LA 5EBDA 3IFTA 4X3TA 3VR2A 4QB4A 1Y8PB 1EY7A 1IKLA 1RTNA 2EOTA 1CZWA 2PMZB 3C3LA 4GZYC 4PV1C 3R8BA 3MWYW 3VYTA 3M4YA 5KYIA 2WB1B 1LACA 2Q8IB 1AZPA 3C1EA 1ZXTA 4F87A 1EYAA 3OMCA 1BDOA 3GTLB 2F1MA 1CT1D 3SEBA 4IFDH 3HOVB 3GD7A 1QB5D 1V1PA 3CRKC 3W3AA 4HTHA 1ILQA 1UEAB 3EROA 4ZKBB 1SNCA 4ZQ3A 1CQFA 2CHBD 1O78A 1SNQA 2SDFA 2EY1A 3KBXA 4U673 3DHQA 1E2ZA 4WFN3 4XYOA 1ZKOA 2B2TA 2K5QA 4QUFA 3FRPB 3R93A 1JWUD 1RTOA 2BE5D 3RUZA 1PTOF 2K1BA 1H9RA 1U4MA 3PIO3 1HHVA 1NAPA 1QNKA 3SHLA 5IGCA 2EJGC 2F0TA 1TVXA 2M00A 1DOLA 4A3FB 1VMCA 4XQJA 2Z1CA 3R3OA 3Q24A 1GUWA 3I90A 2SEBD 1W6KA 4A3GB 3WOEA 1NCVA 1Q90A 1BUVT 5CC4A 4Q5VA 3GTJB 1G2SA 1XXGA 2M2LA 3SDZA 1RDPD 5ISRA 1HXYD 1DJRD 1I4RA 4QUCA 1TWFB 2LKVA 3J7AF 2K05A 2Z4IA 1SE2A 4KKUA 3QOLA 1D5MC 2E75C 4OL7A 1PRTF 2XWBB 2OT2A 3DUZA 1JQYD 3EA6A 4QIWB 1RD9D 3DXJC 3DMUA 3GTKB 4ZRZA 2XVSA 4H13C 4X3SA 2HQEA 1U4RA 1SYFA 2EY6A 3O13A 4KY6A 1YNJC 4PNYA 2E2DC 2SNSA 1TKWB 1SE3A 4KY5A 3K5MA 2AQ3B 1T5XD 1EYCA 3NTKA 2EY5A 1JICA 1IW7C 1TR5A 3M7GA 5CMDA 1RJTA 1U4PA 1FYCA 5JJZA 5J1ZA 4RGOS 1SEBD 2RDHA 3MVVA 4RKBA 1OXSC 1KNAA 4O1NA 4KKSA 1O7YA 4DN4M 1H9JA 2B2TC 2ZT9C 4U68A 1EY6A 2BDOA 4BS9A 1SSOA 5C3EB 4WJWA 1WTVA 2AWOA 4KMUC 1MBYA 4R9WA 2ZXPA 4LK1C 1DD2A 3TMEA 3SR1A 1IHZA 1JR0D 1ILPA 3BG3A 3QJYA 1STAA 4LAAA 4RH6A 2I46A 1EWCA 1L0XB 1RCVD 1EY4A 1A3VA 4FXDA 1WTRA 1STNA 5KEEA 3PUVA 1HUMA 4FXGC 2E2HB 4FF1A 4S3SA 1TWCB 2MUYA 3NWTA 2OF1A 4EQOA 2DY7A 1SJHD 5FLXL 3KLRA 5I6WA 2A6ED 3HZXA 4DFAA 3QB3A 3VYRA 1QCBD 2G9HD 1LTTD 2EE1A 4G7HC 4C2MB 3RLFA 3HOWB 4A3KB 5I9OA 1QILA 4OHJA 1GXDC 5EKIA 1EIHA 1UNSA 2VUMB 3BDOA 1O7LA 2HCCA 1L0YB 1EOTA 2F0UA 1BQQT 3J7YW 2JA8B 3S15B 3NK9A 4FF2A 3MEHA 2BA0A 3L3OC 2JA7B 1GOZA 2RBMA 3NQIA 1BF4A 1ML0D 2RKSA 3T13A 4KHZA 4G7OC 5IODA 3HOZB 5LL6X 1SYDA 1EZ6A 2F0VA 2FINB 4DXGA 3M7NA 4WORA 2PQEA 4FO2A 1DYQA 1YNND 2PCFB 1X3QA 3K7AB 5CORA 3H09A 2EYOA 2MGSA 2F3WA 3I4MB 1MGSA 1SE4A 5I2XA 3P1HA 3K57A 5I4DA 5EGTA 4F8MA 4E6IA 2HDMA 1S5BD 2PNRC 2JA6B 1MD2D 2R93B 4X3UA 5EPJA 3Q6SA 4WRDA 5CV6A 1EQVA 3IL8A 1Q1EA 1EYDA 1K8OA 3X3NA 1GHJA 3P7JA 1SXTA 4L6TB 4IFDJ 4ZUJA 4HCSA 2A68D 2HCIA 1D5XC 1KABA 4RHSA 3H91A 5D3IB 1T5EA 2K7VA 2DNCA 3S2HB 4XQQA 3MXGA 1X32A 1HUNA 5C0XG 1JCKB 3NP8A 2XN9C 2FMCA 5CYUA 2B8FA 5DM73 2R92B 2QKIC 4B08A 2BA1A 1XWEA 1TT2A 3NUCA 3PO3B 2EPBA 4IZ8A 2R6GA 1XYIA 3Q0AA 2CW0D 1OO9B 4K8JA 2LFNA 4G57A 2D2CC 3V2TA 2IX0A 3PUYA 3U9OA 2IL8A 4XT1B 3N6RA 1YNNC 4KTAA 5IOCA 5D14A 3IAYA 2PZWA 1PTOH 4XT3B 1BCPF 2EJFC 2K01A 1I4GA 1PRTC 5ELDA 1D2BA 2NZ1D 1EZ8A 4M1UB 3MXPA 5KNDA 1EY8A 3AU7A 1HA5A 3K5OA 2VB3X 1G2TA 2F0GA 1CHPD 5G3LF 3MZ5A 1XTCD 2FFKB 3A54A 4ZUIA 1QOHA 1W6JA 2K03A 1STBA 4IUTA 2I07B 4DA2A 2A68C 1BR9A 2KEEA 1SNDA 4L63B 1A2TA 2ICEC 2QDBA 1ET9A 5EBCA 2XWJB 3S1MB 2E76C 1FGBD 3GV6A 1BXTA 3BS1A 1GUSA 5C0XI 2B2WA 4MIUA 5JVH3 3G7LA 2AWNA 1SNOA 4RGMA 2A69C 3TP7A 3SXHA 2VNUD 2F0LA 1CM9A 1Y1VB 3BYTB 2JEAI 5JPNC 1KLGD 1LABA 4IUUA 3OIPA 5KRUA 2PO4A 5IGBA 2NB0A 3PUXA 2LY7A 4HSPA 2DNEA 3K6OA 2PYKA 2B2UA 1XX8A 3V96A 3E6ZX 1VCIA 1H9SA 1I6HB 4XXEA 1GUGA 4HCEA 1MSHA 3N52A 4BA1I 1SMYD 2X69A 3ERQA 3I70A 5K36H 5ELCA 1NR4A 5IGFA 5JEAH 3TP5A 4JBWA 1FNVA 5E4XA 2ZXRA 5C6AA 2A5HA 4DNRB 5EKKA 1M8AA 2WKDA 2O5IC 5A2QL 3CU7A 4ZYSA 2QEJC 1EFID 1I4HA 1YNJD 1V1PB 1EQTA 3BVGA 3VA7A 1JC7A 4KK7A 4C3JB 1STHA 1JOQA 4IQZA 3OWEB 1R4QB 1IW7D 3MHBA 3GTQB 1HFGA 2VXWA 2MHVA 1WTXA 4QF4A 3VR6A 5LL6S 1E0BA 4A3DB 3V05A 1FNWA 3VR3A 4J8QA 3DEPA 3KF8A 5TSSA 2B2WC 1GUOA 5D65A 1U4LA 5E3FA 3QO2A 2RDFA 3NXWA 2L9HA 5JOBA 1UAPA 4IUQA 3J81L 2EXZA 3E0JA 5C4HA 2YYZA 4J6HA 2NN6G 3MTSA 5CR3A 1SMYC 5FOBB 1ENAA 5EPLA 3HS0C 4ZK9B 5J22A 5JVG3 1KNEA 1JORA 2B2UC 1NR2A 1KAAA 2EYHA 4LMQD 3J80L 4CJ2C 1PFNA 4A3IB 4IFDG 2WP8J 3OWFA 3HOYB 4FF3A 1A2UA 4KY7A 2Q8RE 2B63B 1C4QA 1S5FD 3SE0A 3MAQA 4OGQC 5M5XB 3CKIB 1TY0A 4B9XA 1CZGA 2L1BA 2D9UA 1JOKA 1PZKD 2F0FA 3I4LA 4HAEA 1KDBA 4DNTB 1OXVA 1AEXA 1B1ZA 2F0SA 2K28A 1FD7D 1Y1WB 3T53B 3DWPA 3KLSA 4RKLA 3A55A 2LMCB 4V0BA 1SBBB 2H1EA 4A3MB 1VF7A 3I72A 3HOUB 2PW5A 4ABNA 1CQVA 1I4PA 5CV9A 3M3YB 1ESFA 5C3WA 1QE6A 3S16B 4OO1G 1V1OA 3SVMA 1BCPC 4FXKC 1PMRA 3MFYA 1HCZA 4HMIA 4HR7B 4RHRA 2PPBC 4A93B 2JE6I 3I91A 1TWHB 1CI3M 1F9RA 3NPPA 1B53A 2L0CA 2NN6I 5C4XB 2KQ3A 1SDFA 2KEDA 2L4NA 1Z6HA 3WOFA 1AZQA 3EFXD 3HP3A 1RKNA 2F0DA 5ELBA 1PZJD 3H94A 4ULLA 1LO5D 4RGTA 3GV3A 3PIP3 1F9SA 1KDAA 1LTBD 4IFDI 2B39A 1PZID 4KD4A 3RZOB 3NWSA 1STEA 2JP1A 2JSOA 3FPUB 3TZUA 5J39A 3ZYYX 3PUWA 1HTLD 1VDZA 1Y8OB 1A6XA 4UDUC 1F9QA 5E1FA 3ONAB 4K6DA 2IPKD 1B3AA 1TU2B 2ICIA 1WTWA 1F2ZA 1PTOD 4NMZA 3UI2A 4R8NA 2B2YC 4KJOA 5C4ZA 3TN2A 1PLFA 1AP0A 1I4QA 2NBFA 4IURA 5CV5A 3SK5A 5C0XH 4DF7A 2O5JC 4TSSA 4IUNA 1Y8NB 1E2VA 4ILWA 1EY9A 2JYOA 2R7ZB 1BNZA 1PRTB 1IL8A 4OIJA 1SYEA 4XTCS 4FP5D 1AFPA 2WACA 4A3BB 3EQLC 1SYCA 4OO1I 4C3IB 3RMHA 1R9TB 2V4DA 2AQ1B 2A74C 3M4OB 2EYFA 2F0NA 2SNMA 1K83B 4C3JG 3IKJA 2FHTA 1PRTD 3RD4A 5KIXA 1HPCA 3A8JE 1H9MA 2E2IB 4C1NI 2YU9B 5CV7A 5IGGA 1SAPA 5C5MA 1TS4A 1LTRD 2WIIB 4N9TA 1F2LA 5JEAJ 5F2DA 3LWUA 4H44C 3P75A 4KHVA 2F0KA 2K32A 2RSOA 1QNUA 3NQTA 1DXMA 1B44D 3A8KE 1FR3A 1J9OA 4HEDA 1CA5A 2F0JA 2IWHA 1B4OA 1HA6A 1PTOC 1II3A 4A3EB 2ENBA 1KLUD 2RA4A 2J0TD 2F0OA 2A69D 1O80A 3GP7A 3BZDB 3A56A 1VF5C 1O7ZA 1SFOB 3PUZA 1ZYRC 1RF2D 4TQUS 2KHSA 1D6EC 3NHHA 2NYZD 1CA6A 3AB9A 1TQOA 3GO5A 1C8CA 3NTHA 5JAVA 1VMPA 4H7BA 4CHTB 1NUCA 1WTOA 2ZXOA 1QG7A 4HMJA 2F0MA 3D6CA 1TY2A 4Q0FA 3LNNA 1B50A 1Q1BA 1EWHA 4Z9CB 3A7AB 4DK1A 1PDQA 5IGDA 2DN8A 4MHEA 3LWEA 2J7ZA 4I7ZC 4X3KA 1I4XA 3H0GB 1ESRA 3I8ZA 1KTKA 1PFBA 1H9KA 4RFBA 3KLSX 2K04A 1AN8A 2F0EA 3GTMB 2K33A 2ID0A 5HURA 3PO2B 1K8MA 3NE5B 2NVXB 3MFGA 3X3MA 2A73B 2HDLA 1Q3LA 4FF4A 1S4ZA 2WAQB 2F4IA 2OXPA 4DAVA 1JOOA 5BN3A 4BY1B 2EY2A 2EZVA 4RCNA 3BYYB 1G291 3HGBA 2EJMA 2KJXA 1WCMB 2FJ2A 1OXUA 4ME5A 2SOBA 4C56C 2N55A 3KK7A 2EVBA 5CBEE 1B9NA 1S5ED 3ITPA 2F0PA 3K59A 3DEOA 4C3HB 1LT5D 2TSSA 4FNFA 3RZDB 2XRSD 3T16A 3D4WA 4RCOA 1D1IA 5LHY1 5EQ0A 4C1NK 3A8IE 1GJXA 3TBIB 3BVZA 4NP5A 1SYGA 1E2WA 4PMWA 2VB2X 1EEID 2DY8A 1DOMA 4CJ0B 5M5YB 3T51B 3FPPA 2CQAA 3JAME 4TRDA 1H9SB 1LV9A 2XIWA 5NUCA 4CKCA 5T1IA 2KA7A 4QMGA 4NDXA 2NN6H 1F2YA 5IT9E 5JPMC 3CHBD 2QILA 1QWYA 3MXNA 3M85A 2X6GA 4UAIA 2OEOA 5FLXE 4BBSB 4K2KA 4NW2A 1WD1A 3G6JB 3MA2B 3ND9A 3TSSA 3OMGA 3C1FA 1TS3A 4N9PA 2BDNA 4RGNA 2G9DA 1AW7A 1JB3A 2N88A 4C3IG 2GA4B 1RODA 1QJOA 2EYJA 4V190 2KVMA 3K58A 3PV0A 4XYQA 1TIID 2BOSA 1EU3A 2F0HA 1TWGB 3D6WA 2WV6D 4JK1C 4K5VA 3OIQA 3J7AV 1C48A 3L7ZC 2A6HC 3S17B 4B9WA 1S5CD 2RQXA 2AUJD 3I73A 1BCPB 5C0XJ 3OOCA 4EQNA 3OPOA 1B9MA 4F7XA 1CHQD 2K5DA 2M9VA 3TDQA 2KOLA 1CK1A 1BCPD 5ELEA 5KGUA 1KDCA 4NKLA 4XIGS 3I3CA 3R2IA 5BN5A 4XDXA 3FEWX 4HN7A 4EGVA 2PZTA 5K36G 4OO1H 2L5TA 3URYA 1F9PA 1RHPA 1SNMA 1G6ZA 2AQ2B 5JEAG 5G3LD 2XRQD 3DWAA 1UUPA 3KUPA 4BWGB 3HKZB 1LTSD 2JXMB 5ELFA 3NBHA 4LJZC 1Q8IA 2B2YA 4IUPA 1WVLA 5FKAC 2C5CA 4DGZA 2IX3A 3TP8A 1DCZA 5DAUA 2Q8TA 1EEFD 3S1QB 5IIFA 2MP1A 2O4XA 2NWGA 1DOKA 1JWSD 2Z4HA 1EY5A 4CBVA 3E5SA 3S14B 5BN4A 3OSOA 2PZUA 4P2CB 1LT4D 1ENFA 2HUGA 1DZ1A 1U9RA 2NUCA 3D31A 3MXUA 4K6LA 2IJ0A 4OIKA 5DM63
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KND A;  3OOC A;  1Q1E A;  4H0L C;  2V4D A;  1K8O A;  3OPO A;  2BE5 C;  2NN6 I;  1B9M A;  1E2Z A;  1YNJ C;  3A8I E;  3T56 B;  5JEA H;  3KLR A;  1GJX A;  3QIA A;  2A6H D;  1GHJ A;  4KKT A;  3IKJ A;  3GQB A;  1Z6H A;  1E2W A;  3LNN A;  1ZKO A;  2A6E D;  4JBW A;  4L8J A;  1V8Q A;  1Q1B A;  4KI0 A;  1HPC A;  2D62 A;  1TKW B;  4KN4 C;  1EWH A;  2A68 D;  1HTP A;  3A8J E;  1H9M A;  3WDN A;  4G7H C;  4XIG S;  3H94 A;  3A7A B;  4IFD G;  4DK1 A;  2A68 C;  5BN5 A;  4DNR B;  3RLF A;  1IW7 C;  3T51 B;  2O5I C;  2DN8 A;  5KNC A;  1T5E A;  3FPP A;  2K7V A;  4I7Z C;  3U9S A;  1ONL A;  1H9S B;  2DNC A;  4TKO B;  2BE5 D;  3SE0 A;  1Y69 U;  5KNB A;  5K36 G;  3BDO A;  4OO1 H;  2L5T A;  1O7L A;  1FYC A;  5C0X G;  1H9R A;  4OGQ C;  3A7L A;  2E74 C;  1H9K A;  2KA7 A;  2E76 C;  4KN7 C;  3VA7 A;  2CW0 C;  3LWU A;  2NN6 H;  4H44 C;  2B8F A;  3TZU A;  5A35 A;  5JEA G;  2EJG C;  2BA0 A;  2K33 A;  3CRL C;  1GUS A;  1Z7T A;  3OW7 A;  2K32 A;  3PUW A;  4IQZ A;  1VDZ A;  1Y8O B;  1OXS C;  1K8M A;  3D4R A;  1A6X A;  3M85 A;  1IW7 D;  4KKS A;  2BA1 A;  1H9J A;  3IFT A;  1IYV A;  2ZT9 C;  1DXM A;  3NE5 B;  2JXM B;  3VR2 A;  3ND8 A;  1Y8P B;  3P20 A;  4G7Z C;  2A69 C;  3I4L A;  2BDO A;  3QG1 A;  3A8K E;  2R6G A;  4DNT B;  4KHZ A;  1OXV A;  4LJZ C;  1FR3 A;  4BA2 I;  4GZY C;  4PV1 C;  4G7O C;  2B8G A;  3ND9 A;  2JEA I;  2AWO A;  1Q90 A;  1TU2 B;  1V43 A;  3VR5 A;  1LAB A;  4KMU C;  3VR6 A;  3SDZ A;  3VR4 A;  3M7N A;  4DK0 A;  2D2C C;  5BN3 A;  3T53 B;  2KCC A;  3M4Y A;  1DD2 A;  1DCZ A;  2EDG A;  3PUY A;  4LK1 C;  1GHK A;  3PUX A;  1LAC A;  2Q8I B;  2DNE A;  2LMC B;  4RCN A;  1QJO A;  1HQM C;  1G29 1;  2AUK A;  1GUT A;  2PCF B;  3N6R A;  3VR3 A;  4KKU A;  2A69 D;  1CFM A;  3HGB A;  2E75 C;  3PV0 A;  2EJM A;  1VF7 A;  3I72 A;  1YNN C;  5C0X H;  3FMC A;  1VF5 C;  3BG3 A;  3QJY A;  1OXU A;  1GUO A;  1CI3 M;  2JEB I;  2O5J C;  1CTM A;  3PUZ A;  1BDO A;  4JK1 C;  1ZYR C;  2D5D A;  4TQU S;  5BN4 A;  1Y8N B;  2F1M A;  1E2V A;  2EJF C;  1OXT A;  1VCI A;  2A6H C;  2EVB A;  3AB9 A;  3DXJ C;  3L7Z C;  1H9S A;  1B9N A;  2PNR C;  4IFD H;  1GUN A;  4OO1 G;  1OXX K;  2A6E C;  3GD7 A;  2QF7 A;  2IT1 A;  3CRK C;  1GUG A;  3W3A A;  3PUV A;  1PMR A;  2YYZ A;  3MFY A;  2AUJ D;  1HCZ A;  4H13 C;  3D31 A;  4HR7 B;  4BA1 I;  2NN6 G;  3MXU A;  2PPB C;  3I73 A;  4XTC S;  1I6V C;  2JE6 I;  3EQL C;  1O78 A;  5K36 H;  1IYU A;  1SMY C;  1Q12 A; 
#chains in the Genus database with same CATH topology
 2Q2U A;  3F2U A;  1GO3 E;  4OX9 Q;  4CGY B;  2BE5 C;  2NVQ B;  2K5W A;  1A3T A;  3QIA A;  2TMP A;  3PO2 G;  3KBG A;  4KKT A;  3CCV A;  1JJG A;  1LTI D;  1YVC A;  2EYL A;  4KN4 C;  4DXF A;  2VW9 A;  2QCP X;  3F1Z A;  4R8I A;  3GTL H;  1MI2 A;  4IN3 A;  5CBA E;  2KCN A;  4R1J A;  5KNC A;  1QVG A;  3HOV H;  5HGT A;  2WAQ G;  1TS5 A;  1Y69 U;  5KNB A;  2K5V A;  1Z47 A;  4BY1 G;  2K6A A;  2RDG A;  4R4I A;  4DUY Q;  4CKE A;  4KN7 C;  3CXC A;  1D1K A;  1ET6 A;  3C2P A;  2L11 A;  4CKB A;  1EIG A;  1HJP A;  2MPM A;  1C7Y A;  3HOX B;  5I9P A;  3NTI A;  1WCM G;  2PW7 A;  3VA5 A;  4GKJ L;  1N9W A;  1IYV A;  2QEX A;  4GOP A;  2UUC L;  5E4W C;  5COY A;  5D3D A;  3KJO A;  2OCE A;  4ALP A;  1PH1 A;  2VQE L;  1ZEQ X;  4BA2 I;  3K5N A;  2XNA C;  4P74 A;  4LF9 Q;  4JI3 L;  3JAM L;  1DM0 B;  2HD3 A;  2MJ8 A;  4ODG A;  4YIJ A;  3GTQ H;  4GOP B;  3TRE A;  4C3H G;  4BY7 B;  3K0Y A;  1K3B C;  4MN3 A;  4ZKC B;  1GHK A;  4JI1 Q;  2NVT B;  4AIM A;  4G4K A;  1SRU A;  5IT9 L;  4OWW B;  1PTO B;  1YIT A;  2I5H A;  1WD0 A;  1R4P B;  4QCL A;  2WKC A;  3RN2 A;  3HEJ A;  5EPK A;  1PFM A;  2J4X A;  2NVY B;  2IHF A;  4IUV A;  4ID6 A;  5C3X A;  5CGK A;  2O2L D;  1GUN A;  1ICW A;  1OXX K;  4A3G H;  1J8I A;  1WTQ A;  3S2D B;  2F0I A;  2L12 A;  3A5U A;  1VQ4 A;  4A3J B;  1PYW D;  4KV6 A;  3OHX C;  2QDL A;  1Q12 A;  1YI2 A;  4XQN A;  5C44 B;  4H0L C;  1M4V A;  1VQD A;  2X6L A;  3PIO A;  5DNF A;  2L55 A;  1ZYR D;  4DV4 L;  1EY0 A;  4PZ8 A;  5FK9 C;  4YHH Q;  1IBM L;  3PMF A;  3AMU A;  1JJC B;  1B2T A;  4CJ1 B;  3ERS X;  1WJJ A;  1P16 A;  3WDN A;  4KLK A;  4HJ9 A;  3GTP B;  1TWA B;  3KJP A;  4BBS G;  1XNQ L;  2RCN A;  1VQO A;  3CQZ B;  2XSC A;  3SK8 A;  4ZAI A;  5DLQ E;  4L5T A;  3GTK H;  3U9S A;  1Z9F A;  2E2J B;  4TKO B;  3NSW A;  5IGE A;  1E1O A;  5C4J B;  1LTG D;  2RVL A;  3DM1 A;  4NPS A;  2KEC A;  1C9O A;  2NZO A;  1XMO Q;  4YCU A;  1MSG A;  2E74 C;  2I5L X;  4DR4 L;  4B3S Q;  1I3Q B;  4JC0 A;  5K5P A;  1Z7T A;  1UE1 A;  3NEL A;  4FVM A;  3EN2 A;  3DLL A;  2IW3 A;  1I50 B;  1F77 A;  5FO7 B;  4EVO A;  1HRJ A;  3ND8 A;  4G7Z C;  5CV8 A;  4O42 A;  2VL6 A;  1IKM A;  1TS2 A;  4PMC A;  4RWS C;  1JWM D;  3FDT A;  3W2D A;  5M9O A;  1VQN A;  1CKO A;  1N32 L;  2WFW A;  4DAY A;  3FVQ A;  3I4N B;  1SE8 A;  1S5D D;  4K14 A;  4QJF A;  1EIF A;  1ASZ A;  1J5E L;  4A3D G;  4DK0 A;  4PG3 A;  1STG A;  3LX0 A;  3CCE A;  3S1R B;  2KCC A;  5A2Q E;  2ES2 A;  3DWQ A;  2B2V A;  2JA5 B;  4DPG A;  2AUK A;  5T1G A;  1GUT A;  3A74 A;  2LXJ A;  4DV3 L;  1CFM A;  2UUB L;  1LLR D;  3SK6 A;  5IWA Q;  4IJL A;  3GTG B;  2ATW A;  3S1N B;  5C5L A;  1UE6 A;  1CTM A;  4A4I A;  1FNU A;  4K0K Q;  3D3R A;  3IRB A;  1OXT A;  2N78 A;  2A6E C;  2KBN A;  2QF7 A;  5FO9 B;  5C3E H;  1W3S A;  2IT1 A;  4M8A A;  2I5M X;  3F2D A;  4LF9 L;  4DAP A;  3L9A X;  3SK4 A;  1SNP A;  4GKK L;  1F2M A;  1I6V C;  4POF A;  4HJ5 A;  2A8V A;  3VYU A;  2DJG C;  4HJA A;  4GNX A;  3T1H Q;  1SLJ A;  1VQH A;  2Z8L A;  4HSV A;  5M3M B;  1S3O A;  1EL0 A;  3D4D A;  3HKZ G;  5FO8 B;  1BBX C;  1V8Q A;  2ZJP A;  4GNX B;  4KI0 A;  4JI2 Q;  2D62 A;  1D8L A;  5C4X H;  4UP8 A;  3Q22 A;  3RN5 A;  1HTP A;  1VQF A;  2NTT A;  3ICE A;  1Y14 B;  1LT3 D;  2RCF A;  3IFD A;  2B63 G;  3T4A C;  3KYH C;  1SJE D;  2F0W A;  4UPA A;  5EKL A;  1HZB A;  2WIN B;  5AFW A;  3Q23 A;  1OTC A;  1D5Z C;  3BVM A;  1A3U A;  2FMM A;  5KYL A;  2E2H H;  3FKI B;  3J81 E;  2HQL A;  1TWC H;  3A7L A;  2HHH Q;  1JE4 A;  1LTA D;  4IOC A;  5A35 A;  5I6Y A;  3TP6 A;  3GTO B;  2C9O A;  2QW7 A;  2F03 A;  1EU4 A;  3TZD A;  1STY A;  4J1M A;  5M5W B;  3RZO H;  2R61 A;  3EJI A;  2IX1 A;  3CF5 A;  4OXP A;  4KD3 A;  3P20 A;  4DU9 A;  3QG1 A;  1GKH A;  3J80 E;  4DV2 Q;  4IAL A;  4C2M H;  2B8G A;  2RSN A;  5EJW A;  3J80 i;  3BDC A;  1V43 A;  4PQX A;  3VR5 A;  4A3K H;  3HOW H;  3BDL A;  1PH9 A;  3CCS A;  1YJ9 A;  1WTP A;  3VR4 A;  4K8I A;  1SYB A;  2VUM H;  4HIK A;  2EYP A;  2ASB A;  2EDG A;  5GAD C;  4RA8 A;  5DEH A;  1PXU A;  3H3V C;  5JJK A;  3CCR A;  1Q81 C;  1HQM C;  1ENC A;  2JA8 H;  3S15 H;  2KUM A;  4EQP A;  4KJN A;  3FMC A;  3H6M A;  1FL0 A;  3HRZ C;  2F0Q A;  4F88 A;  2JEB I;  2F3V A;  1BOS A;  2D5D A;  1JMC A;  4K5X A;  3KDF A;  3QWN A;  4FYD A;  3KLW A;  1BO0 A;  4DV0 Q;  1N33 L;  1DON A;  1G8Z D;  3MC0 B;  3R2T A;  1K73 C;  4K5W A;  1A15 A;  1NMG A;  2VS1 A;  3D8G A;  2EYM A;  1IYU A;  5I2Y A;  1NSN S;  4DV5 Q;  3T1Y L;  5CV4 A;  3S9W A;  1IBK L;  4GLX A;  1VQ6 A;  3NBI A;  4DR6 L;  2B2V C;  1HFN A;  2Y0S B;  4Y7N B;  4A3B H;  3T56 B;  3QOJ A;  1HQR D;  2A6H D;  3HOX G;  1HNZ Q;  3GQB A;  3H3V H;  2ZTE A;  3C46 A;  4BBR B;  2I0Q A;  3I4M H;  4L8J A;  4I65 A;  1X3P A;  3E9H A;  1IBL Q;  4IPG A;  3VYS A;  4ZLT F;  5M3F B;  1VQL A;  5LMU Q;  5IYB H;  2LS0 1;  1P8L A;  2BCO A;  2NTS A;  4A3L H;  1E1T A;  2JA6 H;  1ONL A;  3HG9 A;  1KL9 A;  2IY5 B;  1VQB A;  3K5L A;  2CVR A;  1G91 A;  1LT6 D;  1YEZ A;  5IYC G;  2CW0 C;  2WAQ E;  3EVQ A;  5IP7 G;  4JI0 L;  4X62 Q;  3CC4 A;  4RAU C;  1B8A A;  3CRL C;  3OW7 A;  2CKZ B;  4PMB A;  4JI6 L;  3D4R A;  4AYB B;  3CP0 A;  2H4O A;  2R3Z A;  4K2L A;  5EBD A;  3IFT A;  4X3T A;  3VR2 A;  4QB4 A;  1Y8P B;  1EY7 A;  1IKL A;  1MKH A;  1RTN A;  2EOT A;  1E3P A;  1CZW A;  2PMZ B;  3C3L A;  4GZY C;  4PV1 C;  4CDF C;  2PI2 E;  4R4T A;  3R8B A;  3TS2 A;  3MWY W;  3VYT A;  3S2H H;  3M4Y A;  3A0J A;  5KYI A;  2WB1 B;  1LAC A;  2Q8I B;  1WYD A;  1AZP A;  2D0O A;  4HJ8 A;  3C1E A;  1HNX Q;  1ZXT A;  2K14 A;  4F87 A;  1EYA A;  3OMC A;  2R92 H;  3L2P A;  1BDO A;  3FHW A;  1HNW Q;  3GTL B;  3NEN A;  3MXN B;  2F1M A;  1CT1 D;  3SEB A;  4IFD H;  3HOV B;  3GD7 A;  1SFO H;  1QB5 D;  1V1P A;  3CRK C;  3W3A A;  4HTH A;  1ILQ A;  1UEA B;  4DR5 L;  3ERO A;  2K5H A;  4ZKB B;  1SNC A;  4ZQ3 A;  1CQF A;  3KF6 A;  2CHB D;  1O78 A;  1SNQ A;  2SDF A;  1PV4 A;  2K50 A;  2EY1 A;  1D7Q A;  3KBX A;  2YTY A;  4WJ3 M;  4GS3 A;  4HIM A;  4U67 3;  3DHQ A;  1E2Z A;  4WFN 3;  2A1A A;  2P5Z X;  4XYO A;  1QUQ A;  1G51 A;  1ZKO A;  3I56 A;  2B2T A;  1XNR L;  2K5Q A;  4QUF A;  4AQY Q;  2QGQ A;  3FRP B;  1L1O A;  3R93 A;  1JWU D;  1XMQ L;  1RTO A;  2BE5 D;  4JCV E;  2LSS A;  2CCZ A;  3I4N G;  1BVS A;  4DV0 L;  3RUZ A;  1PTO F;  2K1B A;  1H9R A;  1U4M A;  4JBM A;  4DR1 Q;  3PIO 3;  1HHV A;  1NAP A;  2JA5 G;  1QNK A;  3AYH B;  3SHL A;  3L0O A;  2EJG C;  5IGC A;  2F0T A;  1TVX A;  2M00 A;  1DOL A;  4A3F B;  1VMC A;  4LF4 Q;  4XQJ A;  2F4V Q;  2Z1C A;  3J7A 5;  3R3O A;  1N36 Q;  3Q24 A;  1GUW A;  3I90 A;  4JI4 L;  3PO2 H;  2SEB D;  1W6K A;  4A3G B;  3WOE A;  1IBL L;  4DR3 Q;  1NCV A;  4EX5 A;  1Q90 A;  1BUV T;  5CC4 A;  4Q5V A;  2NVX H;  3GTJ B;  5HY6 A;  1G2S A;  1XXG A;  3TRZ A;  2M2L A;  3SDZ A;  1RDP D;  5ISR A;  1HXY D;  2PQA A;  2Q2H A;  1YHB A;  3UDG A;  3PQI A;  1DJR D;  1I4R A;  4QUC A;  1TWF B;  2LKV A;  3J7A F;  3S1M H;  5GQO A;  2K05 A;  2Z4I A;  1SE2 A;  4KKU A;  3QOL A;  1D5M C;  1EOV A;  2E75 C;  4BY1 H;  4OL7 A;  1PRT F;  3H15 A;  2XWB B;  2E5L Q;  4YWK A;  2ZM6 L;  2OT2 A;  3DUZ A;  1JQY D;  2GVB A;  3EA6 A;  4QIW B;  1RD9 D;  3DXJ C;  2HIV A;  3DMU A;  2KHJ A;  3GTK B;  4RG1 A;  4ZRZ A;  4NXM L;  2XVS A;  3BZC A;  3NBH B;  4H13 C;  4UP9 A;  4X3S A;  1HH2 P;  2HQE A;  2UXD L;  2AHO B;  2BH8 A;  3OYY A;  3FKI G;  1U4R A;  1SYF A;  2EY6 A;  4JI5 Q;  4C3H H;  3O13 A;  3RZD H;  2OWO A;  4KY6 A;  1YNJ C;  4PNY A;  2ZJR A;  2E2D C;  2SNS A;  4DV6 L;  1V1Q A;  1TKW B;  2Z0S A;  4LF6 L;  3G71 A;  1JE5 A;  1SE3 A;  4GN5 A;  4KY5 A;  3U4Z A;  3K5M A;  4JV5 Q;  2AQ3 B;  4B3M Q;  1T5X D;  1EYC A;  3NTK A;  2EY5 A;  1JIC A;  4LFC L;  4P73 A;  1IW7 C;  4LWC A;  1TR5 A;  3M7G A;  1I94 Q;  1MIU A;  5CMD A;  1RJT A;  1U4P A;  1FYC A;  5JJZ A;  5J1Z A;  2R7D A;  3JAM c;  3TEH B;  4X66 Q;  3CC7 A;  1KRS A;  4RGO S;  4IPD A;  1SEB D;  2RDH A;  3MVV A;  4DV7 L;  4RKB A;  4KHP Q;  1OXS C;  1KNA A;  4O1N A;  4KKS A;  4DV1 Q;  1O7Y A;  4DN4 M;  1H9J A;  2ZTC A;  5IT9 c;  2B2T C;  1X56 A;  2ZT9 C;  4U68 A;  3RNU A;  1EY6 A;  5AJ3 Q;  2BDO A;  4BS9 A;  2VQF Q;  1SSO A;  2ZTD A;  5C3E B;  4WJW A;  1WTV A;  1X3F A;  2AWO A;  5FLX c;  1L1O C;  1XJV A;  4X64 Q;  1XPR A;  4KMU C;  1MBY A;  5BR8 Q;  4CDC C;  4R9W A;  2ZXP A;  4LK1 C;  1DD2 A;  2KEN A;  4DR7 Q;  2UU9 L;  3TME A;  3SR1 A;  3CCM A;  4IO9 A;  4JI8 Q;  4OON A;  1IHZ A;  1JR0 D;  1ILP A;  1GM5 A;  3BG3 A;  4C3J H;  5FLM G;  3QJY A;  4B3R L;  4BBR G;  3E3X A;  1STA A;  4LAA A;  1E7Z A;  4RH6 A;  2RHS B;  2UXC Q;  2I46 A;  2CH4 A;  1EWC A;  3CCL A;  1L0X B;  4DR2 L;  1LM0 A;  2UXB Q;  1RCV D;  1EY4 A;  1A3V A;  1SMX A;  2JK8 A;  5M3F G;  1N36 L;  4FXD A;  1WTR A;  1STN A;  4ME3 A;  5KEE A;  3PUV A;  1HUM A;  3DM3 A;  1Q86 C;  3PF5 A;  4FXG C;  2E2H B;  4YY3 L;  4FF1 A;  4S3S A;  1HR0 L;  1TWC B;  2MUY A;  3NWT A;  2OF1 A;  1VQP A;  4EQO A;  4X65 L;  2DY7 A;  1FGU A;  4BXX G;  4A3D H;  4LF8 L;  1SJH D;  5FLX L;  3KLR A;  1E22 A;  2JJQ A;  5I6W A;  2A6E D;  3HZX A;  4AYB G;  4DFA A;  3QB3 A;  3VYR A;  2RF4 A;  1QCB D;  1BKB A;  2G9H D;  1LTT D;  2EE1 A;  4G7H C;  1EWI A;  4C2M B;  3RLF A;  3HOW B;  4A3K B;  5I9O A;  1QIL A;  4OHJ A;  1GXD C;  5IE8 A;  3UE0 A;  5LMN W;  5EKI A;  1EIH A;  1UNS A;  2VUM B;  2DGY A;  3ULP A;  3BDO A;  1O7L A;  2HCC A;  1L0Y B;  1EOT A;  3STB C;  2F0U A;  1BQQ T;  3J7Y W;  2JA8 B;  3S15 B;  2R7F A;  3NK9 A;  4LFA L;  4FF2 A;  3MEH A;  2BA0 A;  3L3O C;  2JA7 B;  1GOZ A;  5LMN Q;  4DUZ Q;  2RBM A;  1KRT A;  3NQI A;  1Q7Y C;  4LF7 L;  1KQS A;  1BF4 A;  1G6P A;  1ML0 D;  3OW2 A;  3KFU A;  2RKS A;  3T13 A;  4KHZ A;  4A3I H;  4G7O C;  5IOD A;  2Z9H A;  3HOZ B;  3HOY H;  5LL6 X;  4HIO A;  1SYD A;  1EZ6 A;  2F0V A;  2FIN B;  4DXG A;  3M7N A;  3S24 A;  2B63 H;  4WOR A;  2PQE A;  4FO2 A;  4OX9 L;  1IZ6 A;  5M5X H;  1DYQ A;  1YNN D;  2PCF B;  1X3Q A;  3K7A B;  5COR A;  3H09 A;  1EQQ A;  2EYO A;  2MGS A;  1WOC A;  2B3G A;  2F3W A;  3I4M B;  1MGS A;  1YHA A;  1SE4 A;  5I2X A;  3P1H A;  3K57 A;  5I4D A;  5EGT A;  4F8M A;  4E6I A;  2HDM A;  1S5B D;  2PNR C;  1FJG Q;  2CFM A;  2JA6 B;  1MD2 D;  2R93 B;  3S14 H;  4YWL A;  4X3U A;  5EPJ A;  3Q6S A;  4WRD A;  4P75 A;  5CV6 A;  1EQV A;  4DAY B;  4DUY L;  3IL8 A;  1Y1W H;  1Q1E A;  1EYD A;  2K5N A;  1K8O A;  3X3N A;  1H95 A;  1GHJ A;  4A3M H;  3P7J A;  4YCV A;  1SXT A;  4L6T B;  4A3F G;  4IFD J;  4ZUJ A;  3HOU H;  4HCS A;  4B3T Q;  1UEB A;  3F2C A;  4JPB W;  4MTN A;  5IYD G;  2GVA A;  2A68 D;  2HCI A;  3M4Q A;  3M3Y H;  1D5X C;  1KAB A;  2CWA A;  3HFZ B;  4RHS A;  4A3G G;  3S16 H;  3H91 A;  5D3I B;  1T5E A;  2K7V A;  2DNC A;  4YCW A;  3S2H B;  1NBW A;  3NEM A;  4XQQ A;  3MXG A;  1X32 A;  4JI1 L;  4A93 H;  3SGI A;  1HUN A;  5C0X G;  1TWH H;  1JCK B;  4NXN Q;  3NP8 A;  2XN9 C;  2FMC A;  3AQQ A;  5CYU A;  2B8F A;  5DM7 3;  2R92 B;  2QKI C;  4B08 A;  1U0L A;  2BA1 A;  4R4Q A;  1K0S A;  1XWE A;  1TT2 A;  3NUC A;  3PO3 B;  1PH3 A;  2EPB A;  4IZ8 A;  2R6G A;  1XYI A;  3Q0A A;  2KCM A;  2D0P A;  1Q82 C;  2CW0 D;  1OO9 B;  4JI7 Q;  4K8J A;  2LFN A;  4ZCK A;  3J81 i;  4G57 A;  2D2C C;  3V2T A;  2IX0 A;  3PUY A;  2FXQ A;  3U9O A;  1KAW A;  2IL8 A;  2EQS A;  4XT1 B;  3N6R A;  4YHH L;  1YNN C;  2HIX A;  5IYC H;  2NVT H;  4KTA A;  4HID A;  1N34 Q;  5IOC A;  5D14 A;  3IAY A;  2PZW A;  1PTO H;  4XT3 B;  1BCP F;  2EJF C;  2K01 A;  3F2B A;  1I4G A;  1PRT C;  4LF5 Q;  3K81 C;  4GN4 B;  1VQI A;  3PIP A;  5ELD A;  1D2B A;  2NZ1 D;  1T9H A;  2DJF C;  1AE2 A;  2NVY H;  1EZ8 A;  4M1U B;  1XMO L;  1WFQ A;  3MXP A;  5KND A;  1EY8 A;  3AU7 A;  1HA5 A;  3S2D H;  4B3S L;  3K5O A;  2VB3 X;  1G2T A;  2F0G A;  1CHP D;  2V1C C;  2GN5 A;  3U58 A;  5G3L F;  3MZ5 A;  1XTC D;  2FFK B;  3A54 A;  4ZUI A;  1QOH A;  2OTJ A;  1W6J A;  2K03 A;  1STB A;  4IUT A;  2I07 B;  4NB3 A;  2A68 C;  1BR9 A;  4DA2 A;  1VQ5 A;  2KEE A;  5C3E G;  1J6Q A;  2QA4 A;  2EXD A;  1QVF A;  3KDF B;  1SND A;  2R7Z H;  4L63 B;  1A2T A;  3UDX A;  1PH7 A;  2ICE C;  1X55 A;  4QY7 A;  2QDB A;  1ET9 A;  3CQZ H;  1B70 B;  5EBC A;  2XWJ B;  4C3I H;  3S1M B;  2E76 C;  1FGB D;  1KC8 C;  2E2J H;  1R9T H;  1EIY B;  3GV6 A;  1BXT A;  5IWA L;  3BS1 A;  1GUS A;  3M4O H;  2PI2 A;  4RMF A;  5C0X I;  2B2W A;  1K83 H;  4K0K L;  4MIU A;  4GLA C;  5JVH 3;  5ELO A;  3G7L A;  2AWN A;  1SNO A;  4RGM A;  2A69 C;  3TP7 A;  1I5F A;  2VZA A;  3SXH A;  2VNU D;  2F0L A;  1CM9 A;  1Y1V B;  2E2I H;  2F3I A;  3BYT B;  2JEA I;  5JPN C;  4BY7 G;  1KLG D;  1I50 H;  2YU9 H;  3KOJ A;  4LFB Q;  1LAB A;  4IUU A;  3OIP A;  1K8A C;  2ZJQ A;  5KRU A;  2PO4 A;  5IGB A;  2NB0 A;  3UDF A;  1A0I A;  3PUX A;  3RR5 A;  3T1H L;  2LY7 A;  4HSP A;  2DNE A;  1SR3 A;  3K6O A;  1CKM A;  1CKN A;  3I4N H;  1V9P A;  2PYK A;  1PA6 A;  2HT1 A;  2B2U A;  3S1R H;  2JA9 A;  1XX8 A;  3V96 A;  4JI2 L;  2JA5 H;  3E6Z X;  3I4O A;  2Y0S E;  1Q8K A;  3OTO Q;  1VCI A;  1H9S A;  3W1B A;  1I6H B;  4A3J G;  1NTG A;  4XXE A;  1GUG A;  4HCE A;  4UHV A;  1MSH A;  3N52 A;  5C44 G;  4BA1 I;  4JYA Q;  1QVC A;  1S40 A;  1GVP A;  2VUM G;  1SMY D;  2X69 A;  3ERQ A;  4JG2 A;  3I70 A;  5K36 H;  2HHH L;  4JI7 L;  5ELC A;  1NR4 A;  3BU2 A;  2JA8 G;  5IGF A;  4A3E H;  2Q2I A;  2IHE A;  3CME A;  4JVZ A;  2Z6B A;  5JEA H;  2JA7 G;  3TP5 A;  2N49 A;  4JBW A;  5J3B A;  1LUZ A;  1FNV A;  3FP9 A;  5E4X A;  4DV2 L;  2ZXR A;  5C6A A;  2A5H A;  4DNR B;  5EKK A;  3K0X A;  1M8A A;  2WKD A;  4AYB E;  3J81 j;  2O5I C;  5A2Q L;  2CWP A;  3CU7 A;  3HOZ G;  4ZYS A;  2QEJ C;  3I2Z A;  1PHJ A;  1EFI D;  1I4H A;  4OEM B;  1YNJ D;  2K52 A;  1V1P B;  2PMZ E;  1JJ2 A;  1EQT A;  3BVG A;  1WI5 A;  3VA7 A;  1Q46 A;  3KF6 B;  1JC7 A;  1HZA A;  4KK7 A;  5ELN A;  4C3J B;  3J81 c;  1STH A;  1JOQ A;  4IQZ A;  3OWE B;  3I4M G;  1R4Q B;  2WB1 E;  1IW7 D;  4WJ4 A;  4DKA C;  2A19 A;  1QUQ B;  3MHB A;  3GTQ B;  4DK3 C;  1HFG A;  1M90 C;  4APV A;  2VXW A;  2MHV A;  2JA6 G;  2R93 G;  1WTX A;  4QF4 A;  3VR6 A;  3J80 c;  1L1O B;  4DV5 L;  3H0G H;  5LL6 S;  1E0B A;  4A3D B;  3G4S A;  4P72 A;  1FNW A;  3V05 A;  1IL2 A;  3VR3 A;  4LW1 A;  4J8Q A;  1HNZ L;  3DEP A;  3KF8 A;  3AFP A;  5TSS A;  3GTM H;  1KD1 C;  2B2W C;  1GUO A;  5D65 A;  1U4L A;  5E3F A;  3QO2 A;  5IP9 G;  2EIF A;  2RDF A;  3NXW A;  4GKJ Q;  2UUC Q;  2L9H A;  5LMU L;  5JOB A;  1NE3 A;  1UAP A;  4IUQ A;  2DUD A;  4PZ6 A;  5FJ8 G;  2VQE Q;  1HR0 W;  3J81 L;  2EXZ A;  4JI3 Q;  3E0J A;  5C4H A;  2YYZ A;  1X3G A;  4J6H A;  2NN6 G;  3MTS A;  4LFB L;  1KXL A;  5CR3 A;  1SMY C;  5FOB B;  1ENA A;  5L37 A;  5EPL A;  2PQA B;  4X62 L;  3HS0 C;  1CSP A;  5M3M G;  4ZK9 B;  5J22 A;  5JVG 3;  1KNE A;  1B7Y B;  1JOR A;  2B2U C;  2JN4 A;  1NR2 A;  1KAA A;  2EYH A;  4LMQ D;  3J80 L;  1WCM H;  4CJ2 C;  3K8A A;  1W2B A;  1PFN A;  3PO3 G;  4A3I B;  4IFD G;  2WP8 J;  5FLM H;  3OWF A;  3HOY B;  4FF3 A;  4L5S A;  4BBR H;  3D0F A;  4JBJ A;  1A2U A;  4KY7 A;  1N8R C;  2Q8R E;  3A5Z B;  2B63 B;  1C4Q A;  1VQK A;  1S5F D;  3SE0 A;  4QL5 A;  5M3F H;  2C35 B;  3MAQ A;  4OGQ C;  5M5X B;  3CKI B;  1TY0 A;  1K9M C;  4B9X A;  1CZG A;  1HNX L;  4DV4 Q;  2L1B A;  3I55 A;  2D9U A;  1JOK A;  3TS0 A;  2MFI A;  4BXX H;  1HNW L;  1IBM Q;  1NNX A;  1PZK D;  2F0F A;  3I4L A;  4HAE A;  1KDB A;  3ZJY C;  4DNT B;  1OXV A;  1AEX A;  1VQJ A;  1B1Z A;  2F0S A;  3STB D;  1PH2 A;  4LNQ A;  2K28 A;  5M5Y H;  1FD7 D;  1L2F A;  4QIW E;  1Y1W B;  1A8V A;  3T53 B;  2L15 A;  3DWP A;  1U5K A;  3KLS A;  4RKL A;  3A55 A;  2LMC B;  2LXK A;  4V0B A;  1PH8 A;  4DR4 Q;  1SBB B;  2H1E A;  4A3M B;  3K80 C;  1VF7 A;  3I72 A;  3GDE A;  3HOU B;  2PW5 A;  4ABN A;  1CQV A;  1I4P A;  1NJI C;  3AFQ A;  5CV9 A;  3M3Y B;  4AQY L;  1ESF A;  5C3W A;  1QE6 A;  3S16 B;  4OO1 G;  2NZH A;  4BBS H;  1YNX A;  1V1O A;  3SVM A;  5EAY A;  4FDB A;  1BCP C;  4FXK C;  1PMR A;  3BZK A;  3MFY A;  1N32 Q;  1HCZ A;  4HMI A;  4HR7 B;  4RHR A;  2PPB C;  4A93 B;  4A3C G;  3VDY A;  1VQA A;  2JE6 I;  3I91 A;  1TWH B;  1J5E Q;  1CI3 M;  1F9R A;  2Y0S G;  4DR1 L;  3UE1 A;  3NPP A;  4QQB X;  1B53 A;  2L0C A;  2NN6 I;  2KHI A;  3ER0 A;  5C4X B;  2KQ3 A;  4DV3 Q;  4LF4 L;  1SDF A;  2KED A;  2L4N A;  2UUB Q;  2F4V L;  1Z6H A;  3WOF A;  1AZQ A;  3EFX D;  3HP3 A;  3LGJ A;  1RKN A;  4CDD C;  2F0D A;  1TWG H;  4X6A H;  1VQC A;  5ELB A;  1PZJ D;  1EUJ A;  3H94 A;  4DR3 L;  4ULL A;  1LO5 D;  1Y1V G;  2G5D A;  4RGT A;  3GV3 A;  3S17 H;  3PIP 3;  1F9S A;  1B3Q A;  1KDA A;  1LTB D;  4DNI A;  1PH5 A;  1VQE A;  4IFD I;  2B39 A;  4IPC A;  4GKK Q;  1ASY A;  1PZI D;  4KD4 A;  1VQ9 A;  3RZO B;  3NWS A;  1STE A;  2KCT A;  4LUO A;  4QGU A;  3EIV A;  2JP1 A;  2JSO A;  3FPU B;  3TZU A;  3BJU A;  5J39 A;  3ZYY X;  4TVA B;  3PUW A;  1HTL D;  1VDZ A;  1Y8O B;  2E5L L;  1A6X A;  3ULL A;  1X54 A;  4UDU C;  3PGZ A;  2AMC B;  1F9Q A;  5E1F A;  4I7A A;  1X3E A;  3ONA B;  3B6Y A;  4K6D A;  2IPK D;  4A3F H;  3WWV A;  5HGQ A;  1B3A A;  4IJH A;  1TU2 B;  5IYD H;  2VY3 A;  2WB1 G;  2ICI A;  2Q2T A;  1WTW A;  5GAE C;  1F2Z A;  1PTO D;  4JW0 A;  4NMZ A;  4R8N A;  3UI2 A;  2B2Y C;  3E0E A;  4KJO A;  5C4Z A;  3TN2 A;  4AH6 A;  4JI5 L;  3GTJ H;  1PLF A;  1AP0 A;  3JC6 6;  1I4Q A;  2NBF A;  4IUR A;  2B29 A;  1IXR A;  5CV5 A;  3SK5 A;  5C0X H;  4DF7 A;  1TWF H;  2O5J C;  4TSS A;  3HOV G;  4IUN A;  4JV5 L;  4B3M L;  1Y8N B;  1E2V A;  1FVI A;  2YV5 A;  4ILW A;  5GRO A;  2OTL A;  1EY9 A;  2JYO A;  1I94 L;  2R7Z B;  2YTV A;  1BNZ A;  1PRT B;  1IL8 A;  3PCO B;  4OIJ A;  1SYE A;  1A63 A;  4XTC S;  4FP5 D;  1AFP A;  2WAC A;  4A3B B;  3EQL C;  1SYC A;  4OO1 I;  4C3I B;  1VS0 A;  4X66 L;  3RMH A;  1R9T B;  2V4D A;  2AQ1 B;  2A74 C;  3J7Z C;  3M4O B;  2EYF A;  2F0N A;  2SNM A;  4KHP L;  1K83 B;  4C3J G;  3S1Q H;  3IKJ A;  2FHT A;  4DV1 L;  1PRT D;  3RD4 A;  5KIX A;  5AJ3 L;  1HPC A;  3I7F A;  2OQK A;  2VQF L;  3A8J E;  1H9M A;  2E2I B;  4N8X 1;  4C1N I;  2YU9 B;  5CV7 A;  5IGG A;  2XGT A;  1SAP A;  4X64 L;  4YWM A;  3CW2 C;  1N33 Q;  5BR8 L;  5C5M A;  1TS4 A;  1LTR D;  2WII B;  4N9T A;  1F2L A;  1AH9 A;  1X6O A;  5JEA J;  1YBY A;  4DR7 L;  1TXY A;  3T1Y Q;  5F2D A;  1IBK Q;  1NY4 A;  3LWU A;  4H44 C;  4JI8 L;  3P75 A;  4DR6 Q;  2UUA Q;  4KHV A;  2NVQ H;  2F0K A;  2K32 A;  2RSO A;  1QNU A;  1CUK A;  2K75 A;  3CPW A;  3NQT A;  4R4O A;  1DXM A;  2UXC L;  3U50 C;  1B44 D;  2UXB L;  3A8K E;  2CH4 W;  1YJN A;  1FR3 A;  1J9O A;  4GOP C;  1UE7 A;  4HED A;  3MEF A;  1CA5 A;  2F0J A;  2IWH A;  1LYL A;  1B4O A;  1HA6 A;  1PTO C;  1II3 A;  4A3E B;  2ENB A;  1KLU D;  2Z6K A;  4P71 A;  3G48 A;  1RIP A;  4OWT B;  2RA4 A;  3CCQ A;  2J0T D;  2F0O A;  2A69 D;  1MHW C;  4JI0 Q;  1O80 A;  3GP7 A;  1XPU A;  3BZD B;  5E7N A;  3A56 A;  1VF5 C;  1HZ9 A;  4JI6 Q;  3HOX H;  1O7Z A;  1SFO B;  3PUZ A;  1ZYR C;  1RF2 D;  4H02 A;  4TQU S;  2KHS A;  1D6E C;  3NHH A;  2NYZ D;  4A3I G;  1CA6 A;  3AB9 A;  1TQO A;  3HOY G;  3GO5 A;  4A75 A;  4IPH A;  1C8C A;  3NTH A;  4OEL B;  5JAV A;  1VMP A;  4H7B A;  4BY7 H;  4CHT B;  1NUC A;  1WTO A;  4HJ7 A;  3CCU A;  2ZXO A;  1QG7 A;  4HMJ A;  4J15 A;  5LMN L;  4DUZ L;  4LUV A;  5IP7 H;  4UY8 C;  2F0M A;  3D6C A;  1ICF B;  1TY2 A;  3W5O A;  4Q0F A;  3LNN A;  1B50 A;  1K8G A;  1Q1B A;  1PYS B;  1EWH A;  4Z9C B;  3A7A B;  4DK1 A;  4O2D A;  1PDQ A;  5IGD A;  1MJE A;  4UP7 A;  2PNH A;  2K4K A;  2DN8 A;  4MHE A;  3LWE A;  2J7Z A;  1IYJ B;  4I7Z C;  4X3K A;  1I4X A;  3H0G B;  5H1S E;  4DR5 Q;  1ESR A;  3I8Z A;  1Y1W G;  1KTK A;  4A3J H;  1PFB A;  1H9K A;  4RFB A;  2MQH A;  2K04 A;  3KLS X;  2MO1 A;  1AN8 A;  5C44 H;  2JQO A;  2F0E A;  3TQY A;  2K33 A;  2ID0 A;  3GTM B;  4A3M G;  5HUR A;  3PO2 B;  3HOU G;  1K8M A;  3CMA A;  3NE5 B;  2NVX B;  3MFG A;  4IOA A;  3X3M A;  2JA7 H;  1XNR Q;  1YZ6 A;  2YTX A;  1LTL A;  2A73 B;  1FJG L;  2HDL A;  3GTP H;  1Q3L A;  1TWA H;  4CDE C;  4FF4 A;  1BBW A;  1S4Z A;  2WAQ B;  2F4I A;  3G6E A;  1YJW A;  3M9B A;  1XMQ Q;  2OXP A;  4A93 G;  4DAV A;  1JOO A;  3E9I A;  5BN3 A;  1PH4 A;  4BY1 B;  5C4J H;  2EY2 A;  3HOZ H;  2AKW B;  2EZV A;  4RCN A;  3BYY B;  1G29 1;  1XPO A;  2BH2 A;  5C4X G;  3HGB A;  1X9N A;  2EJM A;  1I3Q H;  2KJX A;  4N8F A;  1WCM B;  2FJ2 A;  4B3T L;  1GD7 A;  2UUA L;  1OXU A;  3CD6 A;  4ME5 A;  2SOB A;  4C56 C;  2N55 A;  3K7A H;  3KK7 A;  2EVB A;  1QZG A;  5CBE E;  4JI4 Q;  1B9N A;  1S5E D;  1NMF A;  4POG A;  3ITP A;  2F0P A;  1JT8 A;  3K59 A;  3DEO A;  3AEV A;  1A62 A;  1LT5 D;  2TSS A;  4FNF A;  4C3H B;  3RZD B;  2XRS D;  4Y52 H;  1K0R A;  1YHQ A;  4NXN L;  2R93 H;  3T16 A;  3D4W A;  4RCO A;  1AE3 A;  1D1I A;  2Z6K C;  5LHY 1;  5EQ0 A;  3RLO A;  2CQO A;  4C1N K;  3A8I E;  1GJX A;  3TBI B;  3BVZ A;  4GNX C;  1CKN B;  4NP5 A;  1SYG A;  1E2W A;  4PMW A;  2VB2 X;  3GTG H;  1O7I A;  2MNA A;  3S1N H;  1EQR A;  2ZM6 Q;  1EEI D;  3CC2 A;  4A3K G;  3HOW G;  4MZ9 A;  2DY8 A;  1PVO A;  3RLN A;  1DOM A;  2RHQ B;  4CJ0 B;  5M5Y B;  3T51 B;  5IP9 H;  1VQG A;  3FPP A;  2CQA A;  4NXM Q;  3JAM E;  4TRD A;  1H9S B;  1LV9 A;  2XIW A;  5NUC A;  3JAM i;  5FJ8 H;  4CKC A;  3EBE A;  2UXD Q;  4JOI A;  5T1I A;  2KA7 A;  4QMG A;  4NDX A;  2NN6 H;  1F2Y A;  5IT9 E;  3CAM A;  5JPM C;  2N8N A;  3CHB D;  2QIL A;  1QWY A;  3MXN A;  3M85 A;  4DV6 Q;  1N34 L;  5GAG C;  2X6G A;  5M3M H;  4UAI A;  4DK6 C;  2OEO A;  5FLX E;  5IY0 A;  4LF6 Q;  4BBS B;  4K2K A;  4NW2 A;  1WD1 A;  4LF5 L;  3G6J B;  3MA2 B;  3ND9 A;  3TSS A;  4LFC Q;  3OMG A;  2R7Z G;  3PO3 H;  4PZ7 A;  3C1F A;  1TS3 A;  4N9P A;  2BDN A;  4RGN A;  2G9D A;  1VQ8 A;  1AW7 A;  1JB3 A;  1VQ7 A;  2N88 A;  4A3B G;  4C3I G;  2GA4 B;  3FKI H;  1ROD A;  1QJO A;  2EYJ A;  4V19 0;  2KVM A;  3K58 A;  4DV7 Q;  3PV0 A;  4XYQ A;  3GTO H;  1TII D;  1HZC A;  2BOS A;  1EU3 A;  2F0H A;  5IYB G;  1TWG B;  1PFS A;  3D6W A;  2WV6 D;  4JK1 C;  1KHI A;  4GLV B;  5M5W H;  3HKS A;  4A3L G;  4K5V A;  3OIQ A;  4O0A A;  1C48 A;  3J7A V;  3L7Z C;  2A6H C;  3S17 B;  1L0W A;  4B9W A;  1YIJ A;  1S5C D;  3CPF A;  2RQX A;  2AUJ D;  2N3S A;  3I73 A;  1EFW A;  1BCP B;  3U4V A;  5C0X J;  1KIX A;  4DAM A;  3OOC A;  4EQN A;  1K3R A;  3OPO A;  2UU9 Q;  1B9M A;  1SRO A;  1CSQ A;  3ULJ A;  4F7X A;  2H5X A;  1CHQ D;  2K5D A;  4MTK A;  2M9V A;  3TDQ A;  2KOL A;  1CK1 A;  3KF8 B;  4B3R Q;  1BCP D;  5ELE A;  5KGU A;  1KDC A;  4NKL A;  2XTI A;  4XIG S;  4L5Q A;  3I3C A;  3R2I A;  5BN5 A;  1WTH A;  1E24 A;  4DR2 Q;  4OWX B;  4XDX A;  4JBK A;  3FEW X;  3F8T A;  4HN7 A;  4EGV A;  2ALY B;  2PZT A;  1PH6 A;  5K36 G;  4EQ5 A;  4OO1 H;  2L5T A;  3URY A;  4YY3 Q;  1HR0 Q;  1EYG A;  1F9P A;  1RHP A;  4MNO A;  1K28 A;  4A3E G;  1SNM A;  4A76 A;  1DGS A;  4X65 Q;  1G6Z A;  2R92 G;  4A3C H;  2AQ2 B;  1C0A A;  5JEA G;  5G3L D;  5JJL A;  3Q8D A;  1S72 A;  1QZH A;  2XRQ D;  4LF8 Q;  3DWA A;  1UUP A;  4Y7N H;  3KUP A;  4BWG B;  3HKZ B;  1LTS D;  3UDI A;  1BBU A;  3M4P A;  2JXM B;  3OTO L;  1SN8 A;  5ELF A;  4L5R C;  3NBH A;  4GN3 B;  4LJZ C;  1JB7 A;  1Q8I A;  2B2Y A;  4LUZ A;  4IUP A;  1WVL A;  1MJC A;  1UE5 A;  1X65 A;  5FKA C;  2C5C A;  4JYA L;  1RL2 A;  2OQ0 A;  4DGZ A;  5GAH C;  5JJI A;  2IX3 A;  3TP8 A;  1Y1V H;  2MO0 A;  3PF4 A;  4R4C A;  1DCZ A;  1M1K C;  4JOI C;  5DAU A;  2Q8T A;  1EEF D;  1PYB A;  3S1Q B;  4LFA Q;  5IIF A;  2MP1 A;  2O4X A;  2NWG A;  1DOK A;  1JWS D;  3K7U C;  3H3V I;  2Z4H A;  1EY5 A;  4LF7 Q;  2E8G A;  4CBV A;  3E5S A;  1XNQ Q;  1XTD A;  3S14 B;  5BN4 A;  2F52 A;  3OSO A;  2PZU A;  4P2C B;  3PSI A;  1LT4 D;  3CCJ A;  1ENF A;  2HUG A;  1DZ1 A;  1U9R A;  2NUC A;  3QR8 A;  1VQM A;  3D31 A;  3MXU A;  3H0G G;  4K6L A;  3W1G A;  3HKZ E;  2IJ0 A;  4OIK A;  5DM6 3;  1I6H H;  1UWV A; 
#chains in the Genus database with same CATH homology
 3F2U A;  4CGY B;  2BE5 C;  2NVQ B;  2K5W A;  1A3T A;  3QIA A;  2TMP A;  3KBG A;  4KKT A;  1LTI D;  2EYL A;  4KN4 C;  4DXF A;  2QCP X;  4R8I A;  1MI2 A;  4IN3 A;  5CBA E;  2KCN A;  5KNC A;  5HGT A;  1TS5 A;  1Y69 U;  5KNB A;  1Z47 A;  2K6A A;  2RDG A;  4CKE A;  4KN7 C;  1D1K A;  1ET6 A;  3C2P A;  2L11 A;  4CKB A;  1EIG A;  2MPM A;  3HOX B;  5I9P A;  3NTI A;  2PW7 A;  3VA5 A;  1IYV A;  5E4W C;  5COY A;  5D3D A;  1ZEQ X;  4BA2 I;  3K5N A;  2XNA C;  3JAM L;  1DM0 B;  2MJ8 A;  4ODG A;  4YIJ A;  4C3H G;  4BY7 B;  3K0Y A;  4ZKC B;  4MN3 A;  1GHK A;  2NVT B;  4G4K A;  5IT9 L;  1PTO B;  1WD0 A;  1R4P B;  4QCL A;  2WKC A;  3HEJ A;  5EPK A;  1PFM A;  2J4X A;  2NVY B;  4IUV A;  4ID6 A;  5C3X A;  5CGK A;  2O2L D;  1GUN A;  1ICW A;  1OXX K;  1J8I A;  1WTQ A;  3S2D B;  2F0I A;  2L12 A;  4A3J B;  1PYW D;  4KV6 A;  3OHX C;  1Q12 A;  4XQN A;  5C44 B;  4H0L C;  1M4V A;  2X6L A;  5DNF A;  2L55 A;  1ZYR D;  1EY0 A;  5FK9 C;  3PMF A;  3AMU A;  1B2T A;  4CJ1 B;  3WDN A;  3GTP B;  1TWA B;  3CQZ B;  2XSC A;  3SK8 A;  4ZAI A;  3U9S A;  2E2J B;  4TKO B;  3NSW A;  5IGE A;  5C4J B;  1LTG D;  2RVL A;  3DM1 A;  2KEC A;  1MSG A;  2E74 C;  1I3Q B;  5K5P A;  1Z7T A;  4FVM A;  2IW3 A;  1I50 B;  1F77 A;  5FO7 B;  4EVO A;  1HRJ A;  3ND8 A;  4G7Z C;  5CV8 A;  4O42 A;  1IKM A;  1TS2 A;  4PMC A;  4RWS C;  1JWM D;  3FDT A;  3W2D A;  5M9O A;  4DAY A;  3FVQ A;  3I4N B;  1S5D D;  4K14 A;  4DK0 A;  3S1R B;  1STG A;  3LX0 A;  2KCC A;  5A2Q E;  3DWQ A;  2B2V A;  2JA5 B;  2AUK A;  5T1G A;  1GUT A;  1CFM A;  1LLR D;  3SK6 A;  3GTG B;  3S1N B;  5C5L A;  1CTM A;  1FNU A;  3D3R A;  1OXT A;  2A6E C;  2QF7 A;  5FO9 B;  2IT1 A;  4M8A A;  4DAP A;  3L9A X;  3SK4 A;  1SNP A;  1F2M A;  1I6V C;  3VYU A;  2Z8L A;  4HSV A;  5M3M B;  1EL0 A;  3D4D A;  5FO8 B;  1BBX C;  1V8Q A;  4KI0 A;  2D62 A;  3Q22 A;  1HTP A;  2NTT A;  1LT3 D;  3IFD A;  3T4A C;  1SJE D;  2F0W A;  5EKL A;  2WIN B;  5AFW A;  3Q23 A;  1D5Z C;  3BVM A;  1A3U A;  2FMM A;  5KYL A;  3FKI B;  3J81 E;  3A7L A;  1JE4 A;  1LTA D;  5A35 A;  5I6Y A;  3TP6 A;  3GTO B;  2C9O A;  2F03 A;  1EU4 A;  3TZD A;  1STY A;  4J1M A;  5M5W B;  2R61 A;  3EJI A;  2IX1 A;  4KD3 A;  3P20 A;  4DU9 A;  3QG1 A;  3J80 E;  4IAL A;  2B8G A;  2RSN A;  5EJW A;  3BDC A;  1V43 A;  4PQX A;  3VR5 A;  3BDL A;  1WTP A;  3VR4 A;  4K8I A;  1SYB A;  2EYP A;  2EDG A;  4RA8 A;  5DEH A;  1PXU A;  3H3V C;  1HQM C;  1ENC A;  2KUM A;  4EQP A;  4KJN A;  3FMC A;  3H6M A;  3HRZ C;  2F0Q A;  4F88 A;  2JEB I;  2F3V A;  1BOS A;  2D5D A;  4K5X A;  3QWN A;  4FYD A;  1BO0 A;  1DON A;  1G8Z D;  3MC0 B;  3R2T A;  4K5W A;  1A15 A;  3D8G A;  2EYM A;  1IYU A;  5I2Y A;  1NSN S;  5CV4 A;  3S9W A;  3NBI A;  2B2V C;  1HFN A;  2Y0S B;  4Y7N B;  3T56 B;  3QOJ A;  1HQR D;  2A6H D;  3GQB A;  3C46 A;  4BBR B;  4L8J A;  4I65 A;  1X3P A;  3VYS A;  4ZLT F;  5M3F B;  2LS0 1;  2BCO A;  2NTS A;  1ONL A;  3HG9 A;  3K5L A;  2CVR A;  1G91 A;  1LT6 D;  2CW0 C;  3EVQ A;  4RAU C;  3CRL C;  3OW7 A;  4PMB A;  3D4R A;  4AYB B;  2H4O A;  2R3Z A;  4K2L A;  5EBD A;  3IFT A;  4X3T A;  3VR2 A;  4QB4 A;  1Y8P B;  1EY7 A;  1IKL A;  1RTN A;  2EOT A;  1CZW A;  2PMZ B;  3C3L A;  4GZY C;  4PV1 C;  3R8B A;  3MWY W;  3VYT A;  3M4Y A;  5KYI A;  2WB1 B;  1LAC A;  2Q8I B;  1AZP A;  3C1E A;  1ZXT A;  4F87 A;  1EYA A;  3OMC A;  1BDO A;  3GTL B;  2F1M A;  1CT1 D;  3SEB A;  4IFD H;  3HOV B;  3GD7 A;  1QB5 D;  1V1P A;  3CRK C;  3W3A A;  4HTH A;  1ILQ A;  1UEA B;  3ERO A;  4ZKB B;  1SNC A;  4ZQ3 A;  1CQF A;  2CHB D;  1O78 A;  1SNQ A;  2SDF A;  2EY1 A;  3KBX A;  4U67 3;  3DHQ A;  1E2Z A;  4WFN 3;  4XYO A;  1ZKO A;  2B2T A;  2K5Q A;  4QUF A;  3FRP B;  3R93 A;  1JWU D;  1RTO A;  2BE5 D;  3RUZ A;  1PTO F;  2K1B A;  1H9R A;  1U4M A;  3PIO 3;  1HHV A;  1NAP A;  1QNK A;  3SHL A;  5IGC A;  2EJG C;  2F0T A;  1TVX A;  2M00 A;  1DOL A;  4A3F B;  1VMC A;  4XQJ A;  2Z1C A;  3R3O A;  3Q24 A;  1GUW A;  3I90 A;  2SEB D;  1W6K A;  4A3G B;  3WOE A;  1NCV A;  1Q90 A;  1BUV T;  5CC4 A;  4Q5V A;  3GTJ B;  1G2S A;  1XXG A;  2M2L A;  3SDZ A;  1RDP D;  5ISR A;  1HXY D;  1DJR D;  1I4R A;  4QUC A;  1TWF B;  2LKV A;  3J7A F;  2K05 A;  2Z4I A;  1SE2 A;  4KKU A;  3QOL A;  1D5M C;  2E75 C;  4OL7 A;  1PRT F;  2XWB B;  2OT2 A;  3DUZ A;  1JQY D;  3EA6 A;  4QIW B;  1RD9 D;  3DXJ C;  3DMU A;  3GTK B;  4ZRZ A;  2XVS A;  4H13 C;  4X3S A;  2HQE A;  1U4R A;  1SYF A;  2EY6 A;  3O13 A;  4KY6 A;  1YNJ C;  4PNY A;  2E2D C;  2SNS A;  1TKW B;  1SE3 A;  4KY5 A;  3K5M A;  2AQ3 B;  1T5X D;  1EYC A;  3NTK A;  2EY5 A;  1JIC A;  1IW7 C;  1TR5 A;  3M7G A;  5CMD A;  1RJT A;  1U4P A;  1FYC A;  5JJZ A;  5J1Z A;  4RGO S;  1SEB D;  2RDH A;  3MVV A;  4RKB A;  1OXS C;  1KNA A;  4O1N A;  4KKS A;  1O7Y A;  4DN4 M;  1H9J A;  2B2T C;  2ZT9 C;  4U68 A;  1EY6 A;  2BDO A;  4BS9 A;  1SSO A;  5C3E B;  4WJW A;  1WTV A;  2AWO A;  4KMU C;  1MBY A;  4R9W A;  2ZXP A;  4LK1 C;  1DD2 A;  3TME A;  3SR1 A;  1IHZ A;  1JR0 D;  1ILP A;  3BG3 A;  3QJY A;  1STA A;  4LAA A;  4RH6 A;  2I46 A;  1EWC A;  1L0X B;  1RCV D;  1EY4 A;  1A3V A;  4FXD A;  1WTR A;  1STN A;  5KEE A;  3PUV A;  1HUM A;  4FXG C;  2E2H B;  4FF1 A;  4S3S A;  1TWC B;  2MUY A;  3NWT A;  2OF1 A;  4EQO A;  2DY7 A;  1SJH D;  5FLX L;  3KLR A;  5I6W A;  2A6E D;  3HZX A;  4DFA A;  3QB3 A;  3VYR A;  1QCB D;  2G9H D;  1LTT D;  2EE1 A;  4G7H C;  4C2M B;  3RLF A;  3HOW B;  4A3K B;  5I9O A;  1QIL A;  4OHJ A;  1GXD C;  5EKI A;  1EIH A;  1UNS A;  2VUM B;  3BDO A;  1O7L A;  2HCC A;  1L0Y B;  1EOT A;  2F0U A;  1BQQ T;  3J7Y W;  2JA8 B;  3S15 B;  3NK9 A;  4FF2 A;  3MEH A;  2BA0 A;  3L3O C;  2JA7 B;  1GOZ A;  2RBM A;  3NQI A;  1BF4 A;  1ML0 D;  2RKS A;  3T13 A;  4KHZ A;  4G7O C;  5IOD A;  3HOZ B;  5LL6 X;  1SYD A;  1EZ6 A;  2F0V A;  2FIN B;  4DXG A;  3M7N A;  4WOR A;  2PQE A;  4FO2 A;  1DYQ A;  1YNN D;  2PCF B;  1X3Q A;  3K7A B;  5COR A;  3H09 A;  2EYO A;  2MGS A;  2F3W A;  3I4M B;  1MGS A;  1SE4 A;  5I2X A;  3P1H A;  3K57 A;  5I4D A;  5EGT A;  4F8M A;  4E6I A;  2HDM A;  1S5B D;  2PNR C;  2JA6 B;  1MD2 D;  2R93 B;  4X3U A;  5EPJ A;  3Q6S A;  4WRD A;  5CV6 A;  1EQV A;  3IL8 A;  1Q1E A;  1EYD A;  1K8O A;  3X3N A;  1GHJ A;  3P7J A;  1SXT A;  4L6T B;  4IFD J;  4ZUJ A;  4HCS A;  2A68 D;  2HCI A;  1D5X C;  1KAB A;  4RHS A;  3H91 A;  5D3I B;  1T5E A;  2K7V A;  2DNC A;  3S2H B;  4XQQ A;  3MXG A;  1X32 A;  1HUN A;  5C0X G;  1JCK B;  3NP8 A;  2XN9 C;  2FMC A;  5CYU A;  2B8F A;  5DM7 3;  2R92 B;  2QKI C;  4B08 A;  2BA1 A;  1XWE A;  1TT2 A;  3NUC A;  3PO3 B;  2EPB A;  4IZ8 A;  2R6G A;  1XYI A;  3Q0A A;  2CW0 D;  1OO9 B;  4K8J A;  2LFN A;  4G57 A;  2D2C C;  3V2T A;  2IX0 A;  3PUY A;  3U9O A;  2IL8 A;  4XT1 B;  3N6R A;  1YNN C;  4KTA A;  5IOC A;  5D14 A;  3IAY A;  2PZW A;  1PTO H;  4XT3 B;  1BCP F;  2EJF C;  2K01 A;  1I4G A;  1PRT C;  5ELD A;  1D2B A;  2NZ1 D;  1EZ8 A;  4M1U B;  3MXP A;  5KND A;  1EY8 A;  3AU7 A;  1HA5 A;  3K5O A;  2VB3 X;  1G2T A;  2F0G A;  1CHP D;  5G3L F;  3MZ5 A;  1XTC D;  2FFK B;  3A54 A;  4ZUI A;  1QOH A;  1W6J A;  2K03 A;  1STB A;  4IUT A;  2I07 B;  4DA2 A;  2A68 C;  1BR9 A;  2KEE A;  1SND A;  4L63 B;  1A2T A;  2ICE C;  2QDB A;  1ET9 A;  5EBC A;  2XWJ B;  3S1M B;  2E76 C;  1FGB D;  3GV6 A;  1BXT A;  3BS1 A;  1GUS A;  5C0X I;  2B2W A;  4MIU A;  5JVH 3;  3G7L A;  2AWN A;  1SNO A;  4RGM A;  2A69 C;  3TP7 A;  3SXH A;  2VNU D;  2F0L A;  1CM9 A;  1Y1V B;  3BYT B;  2JEA I;  5JPN C;  1KLG D;  1LAB A;  4IUU A;  3OIP A;  5KRU A;  2PO4 A;  5IGB A;  2NB0 A;  3PUX A;  2LY7 A;  4HSP A;  2DNE A;  3K6O A;  2PYK A;  2B2U A;  1XX8 A;  3V96 A;  3E6Z X;  1VCI A;  1H9S A;  1I6H B;  4XXE A;  1GUG A;  4HCE A;  1MSH A;  3N52 A;  4BA1 I;  1SMY D;  2X69 A;  3ERQ A;  3I70 A;  5K36 H;  5ELC A;  1NR4 A;  5IGF A;  5JEA H;  3TP5 A;  4JBW A;  1FNV A;  5E4X A;  2ZXR A;  5C6A A;  2A5H A;  4DNR B;  5EKK A;  1M8A A;  2WKD A;  2O5I C;  5A2Q L;  3CU7 A;  4ZYS A;  2QEJ C;  1EFI D;  1I4H A;  1YNJ D;  1V1P B;  1EQT A;  3BVG A;  3VA7 A;  1JC7 A;  4KK7 A;  4C3J B;  1STH A;  1JOQ A;  4IQZ A;  3OWE B;  1R4Q B;  1IW7 D;  3MHB A;  3GTQ B;  1HFG A;  2VXW A;  2MHV A;  1WTX A;  4QF4 A;  3VR6 A;  5LL6 S;  1E0B A;  4A3D B;  3V05 A;  1FNW A;  3VR3 A;  4J8Q A;  3DEP A;  3KF8 A;  5TSS A;  2B2W C;  1GUO A;  5D65 A;  1U4L A;  5E3F A;  3QO2 A;  2RDF A;  3NXW A;  2L9H A;  5JOB A;  1UAP A;  4IUQ A;  3J81 L;  2EXZ A;  3E0J A;  5C4H A;  2YYZ A;  4J6H A;  2NN6 G;  3MTS A;  5CR3 A;  1SMY C;  5FOB B;  1ENA A;  5EPL A;  3HS0 C;  4ZK9 B;  5J22 A;  5JVG 3;  1KNE A;  1JOR A;  2B2U C;  1NR2 A;  1KAA A;  2EYH A;  4LMQ D;  3J80 L;  4CJ2 C;  1PFN A;  4A3I B;  4IFD G;  2WP8 J;  3OWF A;  3HOY B;  4FF3 A;  1A2U A;  4KY7 A;  2Q8R E;  2B63 B;  1C4Q A;  1S5F D;  3SE0 A;  3MAQ A;  4OGQ C;  5M5X B;  3CKI B;  1TY0 A;  4B9X A;  1CZG A;  2L1B A;  2D9U A;  1JOK A;  1PZK D;  2F0F A;  3I4L A;  4HAE A;  1KDB A;  4DNT B;  1OXV A;  1AEX A;  1B1Z A;  2F0S A;  2K28 A;  1FD7 D;  1Y1W B;  3T53 B;  3DWP A;  3KLS A;  4RKL A;  3A55 A;  2LMC B;  4V0B A;  1SBB B;  2H1E A;  4A3M B;  1VF7 A;  3I72 A;  3HOU B;  2PW5 A;  4ABN A;  1CQV A;  1I4P A;  5CV9 A;  3M3Y B;  1ESF A;  5C3W A;  1QE6 A;  3S16 B;  4OO1 G;  1V1O A;  3SVM A;  1BCP C;  4FXK C;  1PMR A;  3MFY A;  1HCZ A;  4HMI A;  4HR7 B;  4RHR A;  2PPB C;  4A93 B;  2JE6 I;  3I91 A;  1TWH B;  1CI3 M;  1F9R A;  3NPP A;  1B53 A;  2L0C A;  2NN6 I;  5C4X B;  2KQ3 A;  1SDF A;  2KED A;  2L4N A;  1Z6H A;  3WOF A;  1AZQ A;  3EFX D;  3HP3 A;  1RKN A;  2F0D A;  5ELB A;  1PZJ D;  3H94 A;  4ULL A;  1LO5 D;  4RGT A;  3GV3 A;  3PIP 3;  1F9S A;  1KDA A;  1LTB D;  4IFD I;  2B39 A;  1PZI D;  4KD4 A;  3RZO B;  3NWS A;  1STE A;  2JP1 A;  2JSO A;  3FPU B;  3TZU A;  5J39 A;  3ZYY X;  3PUW A;  1HTL D;  1VDZ A;  1Y8O B;  1A6X A;  4UDU C;  1F9Q A;  5E1F A;  3ONA B;  4K6D A;  2IPK D;  1B3A A;  1TU2 B;  2ICI A;  1WTW A;  1F2Z A;  1PTO D;  4NMZ A;  3UI2 A;  4R8N A;  2B2Y C;  4KJO A;  5C4Z A;  3TN2 A;  1PLF A;  1AP0 A;  1I4Q A;  2NBF A;  4IUR A;  5CV5 A;  3SK5 A;  5C0X H;  4DF7 A;  2O5J C;  4TSS A;  4IUN A;  1Y8N B;  1E2V A;  4ILW A;  1EY9 A;  2JYO A;  2R7Z B;  1BNZ A;  1PRT B;  1IL8 A;  4OIJ A;  1SYE A;  4XTC S;  4FP5 D;  1AFP A;  2WAC A;  4A3B B;  3EQL C;  1SYC A;  4OO1 I;  4C3I B;  3RMH A;  1R9T B;  2V4D A;  2AQ1 B;  2A74 C;  3M4O B;  2EYF A;  2F0N A;  2SNM A;  1K83 B;  4C3J G;  3IKJ A;  2FHT A;  1PRT D;  3RD4 A;  5KIX A;  1HPC A;  3A8J E;  1H9M A;  2E2I B;  4C1N I;  2YU9 B;  5CV7 A;  5IGG A;  1SAP A;  5C5M A;  1TS4 A;  1LTR D;  2WII B;  4N9T A;  1F2L A;  5JEA J;  5F2D A;  3LWU A;  4H44 C;  3P75 A;  4KHV A;  2F0K A;  2K32 A;  2RSO A;  1QNU A;  3NQT A;  1DXM A;  1B44 D;  3A8K E;  1FR3 A;  1J9O A;  4HED A;  1CA5 A;  2F0J A;  2IWH A;  1B4O A;  1HA6 A;  1PTO C;  1II3 A;  4A3E B;  2ENB A;  1KLU D;  2RA4 A;  2J0T D;  2F0O A;  2A69 D;  1O80 A;  3GP7 A;  3BZD B;  3A56 A;  1VF5 C;  1O7Z A;  1SFO B;  3PUZ A;  1ZYR C;  1RF2 D;  4TQU S;  2KHS A;  1D6E C;  3NHH A;  2NYZ D;  1CA6 A;  3AB9 A;  1TQO A;  3GO5 A;  1C8C A;  3NTH A;  5JAV A;  1VMP A;  4H7B A;  4CHT B;  1NUC A;  1WTO A;  2ZXO A;  1QG7 A;  4HMJ A;  2F0M A;  3D6C A;  1TY2 A;  4Q0F A;  3LNN A;  1B50 A;  1Q1B A;  1EWH A;  4Z9C B;  3A7A B;  4DK1 A;  1PDQ A;  5IGD A;  2DN8 A;  4MHE A;  3LWE A;  2J7Z A;  4I7Z C;  4X3K A;  1I4X A;  3H0G B;  1ESR A;  3I8Z A;  1KTK A;  1PFB A;  1H9K A;  4RFB A;  3KLS X;  2K04 A;  1AN8 A;  2F0E A;  3GTM B;  2K33 A;  2ID0 A;  5HUR A;  3PO2 B;  1K8M A;  3NE5 B;  2NVX B;  3MFG A;  3X3M A;  2A73 B;  2HDL A;  1Q3L A;  4FF4 A;  1S4Z A;  2WAQ B;  2F4I A;  2OXP A;  4DAV A;  1JOO A;  5BN3 A;  4BY1 B;  2EY2 A;  2EZV A;  4RCN A;  3BYY B;  1G29 1;  3HGB A;  2EJM A;  2KJX A;  1WCM B;  2FJ2 A;  1OXU A;  4ME5 A;  2SOB A;  4C56 C;  2N55 A;  3KK7 A;  2EVB A;  5CBE E;  1B9N A;  1S5E D;  3ITP A;  2F0P A;  3K59 A;  3DEO A;  4C3H B;  1LT5 D;  2TSS A;  4FNF A;  3RZD B;  2XRS D;  3T16 A;  3D4W A;  4RCO A;  1D1I A;  5LHY 1;  5EQ0 A;  4C1N K;  3A8I E;  1GJX A;  3TBI B;  3BVZ A;  4NP5 A;  1SYG A;  1E2W A;  4PMW A;  2VB2 X;  1EEI D;  2DY8 A;  1DOM A;  4CJ0 B;  5M5Y B;  3T51 B;  3FPP A;  2CQA A;  3JAM E;  4TRD A;  1H9S B;  1LV9 A;  2XIW A;  5NUC A;  4CKC A;  5T1I A;  2KA7 A;  4QMG A;  4NDX A;  2NN6 H;  1F2Y A;  5IT9 E;  5JPM C;  3CHB D;  2QIL A;  1QWY A;  3MXN A;  3M85 A;  2X6G A;  4UAI A;  2OEO A;  5FLX E;  4BBS B;  4K2K A;  4NW2 A;  1WD1 A;  3G6J B;  3MA2 B;  3ND9 A;  3TSS A;  3OMG A;  3C1F A;  1TS3 A;  4N9P A;  2BDN A;  4RGN A;  2G9D A;  1AW7 A;  1JB3 A;  2N88 A;  4C3I G;  2GA4 B;  1ROD A;  1QJO A;  2EYJ A;  4V19 0;  2KVM A;  3K58 A;  3PV0 A;  4XYQ A;  1TII D;  2BOS A;  1EU3 A;  2F0H A;  1TWG B;  3D6W A;  2WV6 D;  4JK1 C;  4K5V A;  3OIQ A;  3J7A V;  1C48 A;  3L7Z C;  2A6H C;  3S17 B;  4B9W A;  1S5C D;  2RQX A;  2AUJ D;  3I73 A;  1BCP B;  5C0X J;  3OOC A;  4EQN A;  3OPO A;  1B9M A;  4F7X A;  1CHQ D;  2K5D A;  2M9V A;  3TDQ A;  2KOL A;  1CK1 A;  1BCP D;  5ELE A;  5KGU A;  1KDC A;  4NKL A;  4XIG S;  3I3C A;  3R2I A;  5BN5 A;  4XDX A;  3FEW X;  4HN7 A;  4EGV A;  2PZT A;  5K36 G;  4OO1 H;  2L5T A;  3URY A;  1F9P A;  1RHP A;  1SNM A;  1G6Z A;  2AQ2 B;  5JEA G;  5G3L D;  2XRQ D;  3DWA A;  1UUP A;  3KUP A;  4BWG B;  3HKZ B;  1LTS D;  2JXM B;  5ELF A;  3NBH A;  4LJZ C;  1Q8I A;  2B2Y A;  4IUP A;  1WVL A;  5FKA C;  2C5C A;  4DGZ A;  2IX3 A;  3TP8 A;  1DCZ A;  5DAU A;  2Q8T A;  1EEF D;  3S1Q B;  5IIF A;  2MP1 A;  2O4X A;  2NWG A;  1DOK A;  1JWS D;  2Z4H A;  1EY5 A;  4CBV A;  3E5S A;  3S14 B;  5BN4 A;  3OSO A;  2PZU A;  4P2C B;  1LT4 D;  1ENF A;  2HUG A;  1DZ1 A;  1U9R A;  2NUC A;  3D31 A;  3MXU A;  4K6L A;  2IJ0 A;  4OIK A;  5DM6 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...