1Y8QA

Sumo e1 activating enzyme sae1-sae2-mg-atp complex
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
336
structure length
313
Chain Sequence
GISEEEAAQYDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQVTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRDVIVKVDQICHKNSIKFFTGDVFGYHGYTFANLGEHEFVEEKTETTMVKKKVVFCPVKEALEVDWSSEKAKAALKRTTSDYFLLQVLLKFRTDKGRDPSSDTYEEDSELLLQIRNDVLDSLGISPDLLPEDFVRYCFSEMAPVCAVVGGILAQEIVKALSQRDPPHNNFFFFDGMKGNGIVECLGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the SUMO E1 provide mechanistic insights into SUMO activation and E2 recruitment to E1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords Ubiquitin-like 1 activating enzyme E1A
total genus 101
structure length 313
sequence length 336
chains with identical sequence C
ec nomenclature
pdb deposition date 2004-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00899 ThiF ThiF family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1y8qA00
4RORA 1ZMTA 4XGNA 1H6BA 1E7WA 1JN0A 3Q1LA 4CMCA 1U2GA 4TMFA 5DULA 5DDIP 1EMDA 4E6PA 1R12A 3DBVO 2G76A 3WJAA 1PIWA 5A9SA 3OBBA 1OZAA 2ZTLA 1ZW1A 5IDWA 1KVSA 4HBGA 2VT3A 4R16A 2HMWA 3QVWA 4IQ8A 4L75A 3GN1A 2P4QA 1Y8QA 3GFBA 4N5NA 3GK3A 4RVFA 2VNSA 5HBRA 3WFIA 4Q9NA 4BMNA 4BV8A 4IXWA 4WLEA 2X5JO 1EVZA 4R1UA 3MCVA 2ILTA 1FXSA 1PS9A 3CTMA 4IBOA 3JQDA 2EERA 1HYGA 5TIIA 4M49A 5A1TA 4G65A 3R3SA 1E3WB 3K31A 1KY4A 2RBEA 4R51A 2CF6A 3I23A 2IEDA 3LF2A 4IJKA 1ISFA 3OP4A 2DUUA 4XX0A 1GPDG 1HSZA 3TRIA 1O0SA 2PH3A 2VTEA 2X0NA 1HTBA 5JCXA 3BHIA 2GUGA 2Q2WA 4L74A 2BF7A 1C1XB 2QRKA 4NU6A 4YQYA 1PL8A 1F8GA 1D7OA 3A28A 5G0SA 1Z73A 1PWZA 3BMNB 1I01A 2D2IA 3RBVA 1WP4A 4W9NA 4JNKA 2I3GA 3K30A 3KRTA 3BMCA 4FGSA 3WGQA 3UCFA 3W4KA 3VKVA 2X4GA 3WFJA 1E0DA 3G79A 1NFRA 4IMPA 2GRAA 4YT8A 4DPKA 4YTEA 2WYVA 4Z0TA 2HRBA 4TQGA 1SB8A 5G0TA 4BO1A 4MO2A 4Q3NA 2WE7A 3I5MA 4PG6A 1UXJA 4QFDA 3RUFA 3IUPA 1MC4A 3NTQA 3QJ5A 1GQYA 1PL7A 1HL3A 2IYOA 4HNGA 1PR9A 1K6IA 3DZKA 2BRUA 4R5MA 1WMAA 4DMLA 1TT5B 4EDFA 4QECA 1A4IA 2PWZA 2UDPA 4Z3KA 4NG5A 3DHEA 5C7LO 3HDJA 2BI8A 4IJWA 2PGLA 4DA9A 3G1UA 3D3EA 3I4CA 3GUYA 3MOGA 3HE3A 1PZFA 2BFOA 2B36A 3HZZA 1Y5MA 5TT1A 3KSZO 5L4LA 3ANNA 3UOGA 1NYTA 1N1EA 4DBVO 4EBFA 1K89A 2B35A 3ZDFA 1T2DA 4HWKA 4HFJA 4R01A 2ZB7A 4J7UA 1P9LA 3K2BA 2AG5A 3NRCA 5KJCA 1DO8A 2HU2A 3COSA 2DUWA 3ONDA 2NU9A 3L4BC 5F5NA 4FC6A 1I36A 3FR7A 4HFNA 4BUCA 4CR7A 3WWZA 1SMKA 3IIEA 5GMOA 2O7SA 4BGIA 3BMOB 1R4MB 3GFGA 2JCXA 3JQGA 4BHTA 3C7DB 4YR9A 3GEMA 4ND2A 3WS7A 4IDBA 2J3KA 4E31A 4XD2A 5CPBA 3WGOA 1EVJA 2P5YA 3KZVA 1VRWA 4OQYA 2JHFA 1B3RA 1I24A 3ROKA 3UHAA 2AE2A 3ICPA 9LDBA 3BYZA 3B20A 3ROPA 4W7IA 5EINA 1NHWA 2GR9A 2O3TA 4JJFA 3KUXA 2E48A 4IQGA 3H3FA 1JWAB 4CQMA 3UCEA 5TJHA 1M2WA 1LDYA 2P2SA 3D3WA 4KDFA 1BSVA 2H1SA 4L0QA 5IZCA 2J3IA 4B7UA 4LVUA 2QYTA 3JQ6A 2FY8A 1NM5A 5CEEA 4IGEA 5IXYA 1DJQA 1EBUA 1I5RA 1NWHA 1YL7A 1ZVMA 4CM6A 1LLQA 4DVJA 3ZV5A 2ZJ1A 5AVOA 5L95A 1Y7TA 3D4PA 5JO9A 2X0JA 4R69A 3LDHA 4BO3A 4WCDA 4M87A 1ENOA 3BTSA 1VL0A 2C82A 4FB5A 4NU5A 1P31A 4UREA 4I08A 2ZIZA 5JNLA 1PZGA 2YV2A 4HXYA 3WQSB 1V3VA 1GZ3A 4MVJF 1VSVA 4O1MA 3ZWAA 4F6LA 4XYMA 2G5CA 3VTFA 1PJ4A 1ZEJA 4CMBA 1W0CA 1YBMA 4CMHA 5BSEA 4PG8A 2XPCA 1YONA 1H6CA 1IL0A 4QFCA 3TOXA 4BNIA 1SPXA 4D42A 4WEOA 3IOYA 2VZ0A 3BMQA 5BNTA 4BNMA 3JTMA 1MLDA 4CQMB 5G4KA 1N8KA 3EYWA 4WUVA 2P91A 3RCBA 1O9BA 3QVSA 2X0IA 2NLOA 3WIEA 2OBNA 4ZQHA 3RVDA 2ZQYA 3UUWA 2JHGA 4CLRB 3PZRA 5C7IO 2J8ZA 3K92A 3GEDA 1WNTA 3V2UA 4TRRA 3RROA 3DEYX 5AOVA 4Z0PA 1PQPA 4J49A 1U4OA 4XEHA 5JE8A 3UW3A 3CZMA 4AICA 2PFGA 4CM8B 5L40A 4KP7A 1NAHA 3PHJA 4EYEA 1UH5A 4HFMA 3E8XA 1RYEA 3GG9A 1MGOA 3ZNQA 2H6EA 4TROA 4E21A 1T26A 2FPGA 5TS3A 4CR6A 2IEBA 5EL0A 5BR7A 3GRKA 1WMBA 3WGGA 1J5PA 3PWKA 1YS4A 3AUSA 4GQAA 2QZZA 3UKOA 1T2EA 1IY8A 3BA1A 4A7PA 2IZ1A 4P4GA 3HQ4O 2UVDA 5JFOA 3ZHYA 3SLGA 2P5UA 2JCVA 1KIFA 3TDKA 3WLFA 4DYDA 3AOEA 3ASUA 3HDQA 1B14A 1T1SA 1ZNQO 1B8UA 1HXHA 3JYQA 5EJ2A 4CMIA 5KKAA 3IDSA 1XQ6A 4TVOA 1E7SA 1VI2A 2Y0CA 3PPIA 4AJNA 2UYYA 2QRLA 4OO3A 4II2A 1P0CA 1X0XA 3E6AA 4JP2A 7ADHA 2J3JA 3NAQA 1X7DA 2ZJ0A 3HSKA 2RH8A 3TSCA 2B0JA 4PRLA 5G4LA 3W1VA 3JCZA 1ISHA 1YGYA 3HG7A 3ZWNA 3KXDA 2IZ0A 2Q45A 1FMCA 2EXXA 4WE3A 4IM7A 3GVHA 2CD9A 4UVDA 3ICCA 1F14A 3KHUA 1HLDA 1WZEA 4YT4A 3VHRA 3X2FA 3NUGA 1HDCA 4R41A 4CM7A 1MXFA 1KERA 3M2TA 3ONEA 3VZSA 5FYDA 4RCVA 5B4TA 3AU8A 3NTOA 3O9ZA 1RM0A 1DXYA 5A04A 2V7PA 3B1JA 9LDTA 2D3TA 4J0EA 4XR4A 3I9OA 4RF2A 3GY0A 2OUIA 3BIOA 3FI9A 2GASA 3OIDA 4B4UA 3BMCB 4OSPA 3GDFA 4S1VA 4BVAA 4HADA 3W8EA 3ZWPA 1I3MA 1UDAA 3ZCXA 4IZIA 1PEDA 3DQPA 2GDZA 3DXFA 5LDHA 4BKQA 3RBXA 1K3TA 3OICA 4N54A 3OMLA 1BXZA 2GD1O 3EC7A 2VHYA 5F21A 3W8FA 1LBEA 1WXDA 1IULA 3PYMA 4E5KA 3DZJA 5A05A 4K6FA 1NQOA 2I66A 5T8KA 4P8RA 2C5AA 4WLUA 4YT5A 1HDYA 3GMDA 3VH4A 3IKTA 5J23A 1PJQA 2SCUA 4N5MA 4OYRA 1ZKMA 4O59O 2FZWA 4LMPA 3AJRA 3ZGYA 1ISIA 5T57A 1J6UA 2Q99A 4XYLA 4D0RA 3D64A 2D1YA 3KSDO 3IQDB 4RPHA 4JBGA 4BOYA 4FR5A 4OKIA 5C37A 2X9GA 1WVGA 2O7QA 4JK3A 3I1JA 1T2FA 2R2GA 4NZ9A 2D59A 3UH1A 2YYYA 1ZUD1 1LNQA 2CMDA 3WTBA 3O4RA 4DIOA 2PZMA 1K5HA 1A5ZA 1GFSA 2GZ1A 4RF5A 4UULA 3RIHA 1SCUA 2O3RA 3NTRA 3QVOA 2NNLD 1E6WA 2NU6A 4DPLA 3CKYA 5TX7A 5FWNA 3W6ZA 3HADA 4PLTA 1NVMB 1AHHA 4GBJA 1SEVA 1CERA 1QLJA 3DOCA 3GDOA 1K6JA 4OHUA 5T8KC 5ADHA 2D5CA 1YKFA 4YJGB 4YVFA 1UXHA 2XOXA 2AG8A 1N5DA 4L73A 1JAYA 3GHHA 4MKXA 1LXCA 1BMDA 2WTBA 2D4AA 1HYHA 3MWDB 2VHXA 3JQBA 5H81A 1ID1A 3CSDA 4AJPA 2Q50A 1JQBA 3GVPA 3RASA 1ZK1A 5KVVA 4OOEA 5ITWA 1HRDA 2DTXA 1Z45A 1N9GA 2OFPA 4IS3A 4Q3AA 3ETDA 3U3XA 2VHZA 1HKUA 4CLHA 4I5FA 3JQ9A 3OH8A 3WYBA 5CDSA 2YHIA 4XQEA 3T4XA 2OL4A 3KM0A 1CDOA 3JQ8B 5CFZA 4J1NA 5L9AA 1YWGO 4NDNE 8ADHA 5JCJA 2X8LA 3S2FA 2BGKA 2NVBA 3LT1A 1NASA 1YH3A 4WCFC 1Q0LA 4J16A 2X9NA 3ULKA 1L1FA 2GZ3A 4CODB 1UDBA 4ID9A 2WEKA 3B1KA 4J2HA 1E7MA 4F45A 3AW9A 3H5NA 1QP8A 3K9QO 2X5KO 1AXGA 1M67A 1QG6A 5F5LA 1PJ2A 2Q4EA 3LT4A 5IDYA 3ASVA 3Q2IA 2BMAA 4AJEA 1XG5A 4CJXA 2G0TA 3PLNA 2J5KA 2OMEA 3L4BA 2B4QA 1C0KA 3EDMA 5BSFA 3TZHA 2VRCA 4WLOA 2P9GA 4MVJP 2W8ZA 3OECA 2BHLA 5AQ1A 1BW9B 1EE9A 3FCOA 1TEHA 3PWSA 3GPIA 1I3NA 4AJIA 1KOLA 1VL6A 1LC0A 4UUMA 3DTTA 1SOWA 3IJPA 3C85A 3ZHZA 4XRGA 4LRTB 3BHMA 3OJOA 4CLOB 4BO6A 3D3WB 3B1FA 5A5EA 1LSJA 4CMKA 5B4VA 1GEEA 3DBHB 2VN8A 4KQWA 4E5NA 3EW7A 3Q11A 2DC1A 3IKVA 1TT7A 1QR6A 2O4UX 2X0RA 2WYUA 3JD1A 5GZ6A 5DBFA 3AY6A 3PP8A 4E33A 4P4LA 4ALNA 3V2GA 3H2SA 3LC1O 2P4HX 3ETGA 4P38A 4DYVA 1B0AA 4CM8A 3WTCA 1U8FO 1KC1A 2GNAA 4RPKA 5T64A 1OOEA 3NKLA 1WDMA 3FF4A 1LX6A 2I5PO 3T4EA 3GNSA 3QHAA 1P74A 1R6DA 3FBGA 1BTOA 1LRLA 2WJPA 3PYXA 4IIVA 2Y93A 3KO8A 1M6HA 1D4FA 1LEHA 2QG4A 3H9QA 1R4NA 3DZIA 3SC4A 1MG0A 4EJMA 3PQFA 4D0SA 2VYVD 4WNCA 1ORRA 3FWNA 2EJVA 3Q9UA 3DWFA 1R37A 1MB4A 1KVRA 3EK2A 4XGKA 1DLIA 5AXBA 3D5QA 3G49A 1J4AA 2UUOA 4I5EA 4DL9A 2HMUA 4PGFA 3CINA 4RF3A 2OO5A 2EF1A 2GGSA 3GH3A 4FFOA 3QWFA 1LLUA 2FWMX 1B8PA 3OJFA 3LQFA 4Q3DA 5AXCA 1C0LA 3DFZA 4TKLA 1BG6A 1Y81A 1QYXA 1GU7A 2FMUA 3FNGA 4GI2A 1NPDA 1EDOA 3H9JA 2WWRA 4YJHB 5A06A 3PQDA 3KBOA 1PS0A 3JYOA 1B15A 1X7HA 4MVJA 4OXKA 5JMPA 5KVCA 3UICA 1ENZA 3FBTA 3GQVA 3RC9A 4ZICA 4URFA 5HM8A 4BO2A 5CDTA 2WSBA 1BGVA 1DLJA 2Q2QA 1YB1A 5A02A 1U2DA 3PQEA 3L9WA 4ITUA 2UV8A 3QIVA 3IMFA 4FDAA 2BFMA 1Z74A 4EUFA 3UFXA 4LMRA 4DQVA 4IINA 3M1AA 3GOHA 1M66A 2E82A 2J5RA 2Q3EA 3MJTA 4DTIA 3GGPA 3IC5A 3K8ZA 4BNVA 5I9LA 3I83A 3C7CB 1P1KA 3HNPA 1F12A 1ENPA 4QQRA 1KETA 3B6ZA 3T7EA 5B1YA 1TI7A 2JD1A 3V8BA 1ML3A 1T25A 2YV3A 2HDHA 4CR8A 1YOVA 3SBOA 4YRBA 5DF1A 1EBFA 2DBQA 2AEJA 3AFNA 2O50A 1YDWA 1ZXLA 2I99A 2CZCA 4G81A 1G0NA 3JYLA 5JY1A 1BW9A 1TVEA 4KDEA 2EKLA 4IDCA 4GAEA 1QV6A 5ICSA 2V6FA 3QRWA 1X7GA 4Y6SA 5COQA 4BB6A 4Y9DA 3L9XA 1ZO8A 4D46A 3U4DA 1LDNA 3JQCA 2D5AA 2ZYGA 4WECA 2J5QA 5KIAA 4CQLA 5A3JA 1P1FA 3NGXA 1X1EA 3RWBA 5ENDA 5BT9A 1W8DA 3WBFA 2V6GA 2OORA 3AI3A 3PIDA 1ZBQA 3EAGA 4DLBA 1WDKA 4J2OA 3AUTA 3ITKA 1T2CA 3INTA 4B3HA 5JDCA 4ZQEA 1EEHA 2PD3A 1GZ6A 2PY6A 3C8MA 1D1TA 3BTVA 3H4VA 1R66A 1JW9B 2VHVA 2B5WA 1I2CA 1RM5A 3HFSA 4FFNA 2VZ9A 1VJ1A 4R3WA 4GKBA 3V1UA 4JXKA 1LDMA 3GZ4A 1Z7EA 4YJDA 3ZNOA 3TQHA 3MJEA 4B4OA 3C3XA 3C7AA 3AFMA 4TRMA 1ONPA 1OAAA 4N7RA 3F4BA 1ADCA 1N1GA 1YJ8A 1XHLA 3VAZA 1ZSNA 2W98A 4JX8A 1QSGA 3MEQA 3VDRA 1LDGA 3NDIA 3QY9A 4M1QA 1DC4A 3PXXA 3I52A 1FF9A 1AUPA 3M1LA 2X23A 4RV9A 1T4BA 1JVBA 2C7GA 1YE3A 4NPCA 1SC6A 3UF0A 3DHNA 4J0FA 4BNUA 3OHSX 3KLMX 4RVDA 3PDJA 3PK0A 5ILOA 1U7HA 1ZK2A 3ZV3A 2NACA 1IB6A 1P77A 1HWYA 2CY0A 4BNHA 7MDHA 2VUUA 4YJGA 1O6ZA 5CAEA 4RQTA 4S3MA 3WDSA 4Z0HO 1LSSA 1Z82A 4MIOA 3SEFA 4JLWA 3ZZNA 2GN9A 3RUHA 1LI4A 1UXGA 3O26A 5DOZA 3TJRA 2CSUA 1NBOA 3OQ6A 3QQPA 5A9TA 4E2ZA 2VOJA 4FIZA 3WX0A 3BTOA 1MXHA 3WMXA 1E1MA 1O89A 1R0SA 1ZSYA 2HMVA 5BNFA 4PRKA 3ZI0A 4E2YA 3TZQA 4BO8A 1O94A 2UUPA 4DRYA 4PLGA 1GYQA 2OXIA 1X0VA 3GDGA 5IN5A 1HZJA 3DMTA 3VH2A 5B4UA 4BNKA 2EP5A 1Q7CA 1LTHR 1HLPA 4ZRNA 4IDFA 1H2BA 2NU7A 4B3JA 4DUPA 2BKAA 5JXWA 1EQ2A 2XF8A 2NVUA 1E3JA 2H5LA 2X7HA 1E1KA 1PGNA 2YQ5A 3DR3A 1OI7A 5G0UA 3ZNPA 1KVUA 2JCYA 3U5TA 1CYDA 3ADOA 2A94A 4I9NA 4PG7A 4QEDA 4E5PA 2NV6A 4XA8A 3ZU4A 5HTOA 4D43A 4RL6A 3KYCB 2Q1SA 4FD3A 5DBGA 1UP6A 3A4VA 2WD7B 4O0LA 2BELA 2DVMA 4BMVA 1BWSA 5JO0A 3LF1A 4L4XA 2DTDA 5C3MA 3KEOA 4ILKA 3E5MA 2ZKLA 4IZHA 5L7YA 3C24A 4JBIA 2AQKA 3ABIA 4PLWA 4E5YA 4RQUA 5TC4A 4R5HA 3TZCA 3ZHBA 5I7SA 6ADHA 3I9JA 2IDZA 1XYGA 1LUAA 1D1SA 2ZB4A 4CUZA 1YL6A 2VNAA 3PWZA 2Y66A 4PLPA 1H6DA 3HHPA 1KS9A 3GA0A 5F1KA 3WNQA 3DMTC 3I6QA 4E4YA 2BI7A 3IAHA 4IDDA 1DIGA 1PGQA 5B37A 3A14A 5JC8A 1PGPA 1UZMA 4L4RA 4MVJG 1GUFA 1DFHA 1SZJG 1N7HA 3TWOA 4PZDA 2FN7A 5JYDA 4BO9A 4M86A 4HNHA 1YO6A 3F1LA 1Y9EA 4J7CA 5IF3A 3ST7A 2A4KA 3FSRA 1XR3A 2VRCD 5TSDA 3CEAA 2C29D 5DN9A 5TGDA 3AI2A 3HN7A 3NT5A 5KCZA 2C0CA 2Y1OA 4NBRA 3QWIA 1PWXA 1DC6A 1VPDA 4KTTE 2CDBA 4B79A 3MOIA 2V6BA 1HT0A 3F1KA 2WDZA 3GAFA 4GMFA 4XJTA 3WWYA 3GNQA 5KWEA 1NXQA 3HWRA 4H3VA 1K0UA 2DBZA 1NVTA 1ISMA 2PH5A 3V5NA 2G1UA 2J6IA 1DIRA 1NNUA 2VHWA 1TXGA 1U9JA 4ZHSA 2VOEA 3VPHA 4IMRA 4XIJA 1E7YA 4MJLA 4W7HA 1ENYA 2EHDA 2EJWA 4MOWA 2Q46A 5F1PA 2XXJA 5AXDA 4OKNA 2GLXA 4RF4A 5KTKA 2NQTA 4BO7A 4XB1A 1DJNA 4WASA 1QXSA 2X22A 4LW8A 4CMIB 5JCJD 3H5RA 5I7FA 1JU9A 1DHRA 3RJ9A 4DXHA 4K26A 3EUWA 1M75A 4P4NA 3IP1A 4MVJH 1CQIA 1GDHA 4EZBA 4GVLA 4D45A 5HS4A 2GO1A 3DOJA 2PZKA 4UVIA 5U1PA 3F46A 2X6TA 3RFXA 3A06A 3RSHA 3PJFA 4I1IA 4MKZA 3QSGA 1RKXA 4E2XA 1PJ3A 3MJSA 1SAYA 3D1LA 3GUCA 1V6AA 1QYWA 3VPXA 1VJ0A 5THKA 1E3LA 1C3VA 4NK5A 3RUDA 1WWKA 1ZMOA 1B8VA 2IXBA 4ZRMA 2QIOA 4BNWA 4YT2A 2Q1UA 3O8QA 1C1DB 5L7TA 4GX1A 5TQVA 2AEMA 4DGSA 5K6AA 1QYVA 5G2OA 4EUHA 3DO5A 4ZU3A 4Y98A 3FNHA 3L07A 3L6DA 3B70A 3KTDA 1CIVA 5ER6A 1RJWA 1V0JA 2HKIA 1IOLA 5G4KB 4L4SA 2VUSA 3BMQB 2DTEA 1PJCA 4PZEA 4W9NC 4B8ZA 1E6EA 3D7LA 1UP7A 4M55A 2C07A 3H8VA 2OHXA 2NQ8A 3GZNB 3WGHA 4OOFA 1H6AA 4CM4B 3LLSA 4YAJA 3WG9A 4AJLA 3NT2A 3RFTA 1PQUA 5BNIA 3F5QA 4YJFB 1FDTA 1U5CA 4WGGA 1ONNA 3P19A 4BGUA 1DAOA 2NADA 2CVZA 3DBLA 4BGVA 3IS3A 1Y6JA 3H9EO 5I7VA 2GSDA 1O8CA 1HDGO 3K2EA 4LSWA 1DBVO 5DCUA 1KEPA 4ZD6A 4MVJE 2YY7A 1CQJA 1LA2A 1LQUA 1DIHA 4YACA 2F1KA 5AYVA 4C4OA 1UXIA 4NJMB 1NHGA 3I4FA 1EUZA 3QW2A 4R1SA 3N7UA 4CQMD 4F6CA 4MPDA 2CVOA 3ZU5A 1LJ8A 4MVJD 3JQ7B 3BXXA 5EMHA 5IG2A 4RVSA 3ADPA 1IE3A 2BFPA 3E5RA 3GRPA 4XGIA 1QYCA 1TB4A 4CUJA 4YAGA 2F00A 3EVTA 2B4TO 2HK9A 2B4RO 1KEUA 3L0DA 5EQFA 3ORFA 1MV8A 4J91A 1ZK4A 3GHYA 4N5LA 3L4SO 4DMMA 3V1TC 3PJEA 5CHEA 3RQSA 4XKJA 1A7KA 4MDHA 1E1NA 1N92A 1P1HA 3MJVA 4RLHA 1Y5RA 2ZTUA 1HE2A 2EKPA 3FN4A 4QSMA 4YJFA 5EQDA 2JD2A 3ZV6A 1JTVA 4BKOA 3RU9A 3HDHA 2IODA 1E92A 4PN3A 4G2NA 2Y1FA 4WOKA 4CL8A 4GWGA 1DFIA 4NK4A 4WCFA 4XDZA 1ZJZA 4AVYA 3PEFA 3O38A 4RVHA 3ZN2A 3CUKA 4AJKA 4YWJA 1NWCA 1PGJA 2FSVA 3GN2A 3JV7A 3ANMA 1NTOA 4FOSA 1OC4A 1E6UA 2C2XA 4J4TA 4QX6A 4WLVA 4J90A 3L6OO 5DOVA 3L6EA 1CJCA 4CM1A 1JA9A 5JPIA 3EVNA 1GY8A 2XAAA 1KY5A 2Y99A 4CPDA 1P45A 2ZQZA 1XCBA 3U62A 4CMAA 2P68A 4ZJUA 5BSGA 5KNLA 3LYLA 1I8TA 2Y1EA 2EGHA 5A03A 1JAXA 4M89A 1PGOA 1C0IA 3JQAA 4QT0A 3RKUA 3WQQA 2QQ5A 1TT5A 4IY1A 1SEPA 1HE5A 4ALIA 5H82A 1EK6A 1KEVA 3QWAA 3Q2KA 1BVUA 3RD5A 3NEPX 5JS6A 3TL3A 4I5DA 1QMGA 2WYWA 4IS2A 4R3NA 3JQFC 1J0XO 5C5IA 2ZTVA 2EV9A 3PYLA 2PNFA 2OZPA 4E3ZA 1WPQA 3R6DA 1LQTA 3RUIA 5L53A 3DAPA 4OGWA 3K5PA 1E3SA 5A3VA 4GWKA 1UR5A 1Y8RB 3N74A 2Q4BA 3GT0A 3MZ0A 1EVIA 4CMGA 4FFRA 4A0SA 4FBGA 4ZQFA 4D3FA 2Z95A 4R9RA 4PLVA 3U09A 4TRJA 4C7JA 5CDUA 3P5SA 1GAEO 4CM5A 4MIEA 4XJSA 3NX4A 2HLPA 4MINA 2FPPA 4W6ZA 1HDXA 2HQ1A 1ARZA 2QHXA 1HDRA 2DKNA 1GCOA 5JBIA 4PLCA 4RGBA 3W4JA 5JW6A 1Z75A 2IE0A 5KJ6A 5ILGA 3RUCA 4Z6KA 4HFRA 3QV1A 4LGVA 1ZFNA 3UGKA 1Y9AA 2W4QA 3LLVA 3O8QB 1LSUA 3JQFA 4GX2A 4KTVE 1BXKA 3NDJA 5TRTA 4PG5A 5AXAA 3PDUA 3TFQA 2YUTA 1EZ4A 1LRKA 1OBFO 4I9UA 4KUEA 1F0YA 1GQ2A 2J3HA 4BL5A 3EGOA 2EW8A 4BQPA 2QRJA 4K9DA 1QYDA 3OEWA 2W2LD 4UUOA 4AJHA 2C5EA 1EUDA 5DP2A 4UEJA 3JYPA 4NIMA 2X58A 2Z5LA 2OP1A 1HF3A 3KYBA 1CETA 1W4ZA 3OIFA 1KEWA 4ALMA 4WLNA 4B7XA 1F06A 4AJJA 2YQ4A 2AQHA 1IHYA 4J4BA 4QO7A 5IZ4A 1LSOA 1Q0HA 1UZNA 4TZTA 3GF4A 4NFHA 1VM6A 5JDIA 3ROQA 4RJTA 1HE3A 4RZHA 3KOUA 3A1NA 4OXYA 4W82A 1Z6ZA 3FPCA 4UVHA 1YBVA 1UJMA 1Z7BA 2X9VA 3T7CA 1PX0A 2PA3A 4EITA 1H9BA 5LDGA 2Z1MA 1PJSA 4A27A 5TF4A 2O3SA 4NBTA 4BNJA 4ND4A 1XELA 3EMKA 4E32A 3QVXA 1XGKA 4PVCA 2GN8A 2Y67A 2IRWA 4JBHA 4L9RA 1ZEMA 4FSHA 2ZYAA 1CF2O 4U6QA 4XQ9A 3UCXA 3OM9A 5G0WA 3KEQA 3DZGA 1H5QA 3FD8A 2IXAA 4R68A 1FK8A 4TKMA 3SC6A 3JYNA 5EERA 4CV3A 3NV9A 1SBYA 1VJTA 5I8WA 4YCAA 1A9YA 2XXBA 3LU1A 4KOAA 3ZU3A 4BKRA 1WW8A 2C2YA 3WNVA 4YPOA 4EUEA 3CE6A 4JQCA 5CDYA 2VYVA 5JDIC 4M54A 1U28A 2C54A 4K1LA 4TRNA 2GYYA 4AJOA 1J49A 3TPCA 1MX3A 3DFUA 4BQRA 3ZWWA 3D5TA 3ZWXA 5KVQA 5ENVA 2JFFA 3V2HA 5ITVA 1HYEA 2FP4A 5JC1A 3GVXA 5A4DA 3TZKA 3K73O 3ZWVA 1XEAA 2WD7A 2C59A 1A72A 3KYDB 3LC7O 1OC2A 2VWHA 4GLOA 4XWYA 3KYCA 1T2AA 1GYRA 3DZHA 5CPFA 5DZSA 1GTMA 4EJ0A 3X2EA 5IDXA 4XR9A 1G6KA 4FGWA 2AQ8A 4HX5A 4RDIA 1BXGA 8LDHA 2ZCVA 5L4SA 1EUCA 3G1TA 2EKQA 2X1HA 4EGFA 4DQUA 4UUNA 2OP0A 1Y8RA 4P22A 4Q3EA 4XDYA 4ND3A 3RBZA 3WICA 3QE3A 4R54A 3DC2A 2NWQA 5LCXA 3MJCA 1ADBA 3HB5X 2JL1A 3JQEA 2YDYA 4YBZA 1PZHA 3OEYA 2QX7A 1NFQA 3FWZA 3WR5A 1QLHA 3E48A 3VVBA 2BGMA 1P33A 2A92A 1DIAA 1NQAO 2GERA 3RUAA 4K28A 1ZJYA 3EZYA 3SX2A 1DRVA 1RYDA 1IYZA 4NFYA 4NBUA 3G17A 5K6AC 3D0OA 1LDBA 1FJHA 1V9LA 3HN2A 4E12A 3QLJA 1W6UA 4CMJA 1MA0A 2O2SA 2B37A 3G0OA 3VVCA 4PG4A 3O03A 5I7EA 4XRRA 1FDWA 2DAPA 3S2IA 3ZHXA 4DLLA 1PR3A 2EWMA 3AM3A 4AJ1A 3JD3A 4TSKA 1B3BA 1EDZA 2P9EA 2NSDA 4QO8A 2RAFA 2ZATA 3DMYA 4BO0A 4GX5A 1PJBA 3CMMA 5L51A 5T67A 1I33A 2FRDA 1KC3A 3ZW9A 4XYGA 4JCOA 5HWSA 1C0PA 1GUYA 1RM3A 5I9MA 1ADFA 3PHHA 5JAMA 1KBZA 2AXQA 3AUAA 2VUTA 4WOJA 1E3EA 2PK3A 4ND5A 4WCFB 3TOZA 3RC1A 3E82A 1NP3A 3DAGA 3HJAA 3ROMA 3KB6A 4D3DA 4DIBA 3EHEA 4KZPA 4BNGA 3TFOA 4GGOA 1E5LA 2RH4A 1FDVA 4OH1A 2I9PA 1E1LA 1YXMA 1U8XX 4B8WA 4CMEC 1BDMA 1D8AA 2PD4A 5FI5A 5CEFA 2VWGA 2AHRA 4IGFA 4WEQA 5IXSA 4Y8VA 4BS9A 1X1TA 2TMGA 3H6KA 1PJLA 3I9KA 3DBRA 5CP8A 4BNFA 1Q2XA 4CLRA 2DFDA 2C20A 3R3JA 1A71A 4OM8A 1B2LA 4LK3A 3LVFO 3S2GA 2DPHA 3F6YA 1NX6A 3PJDA 1S6YA 4CLXA 3CIFA 3FNFA 3NGLA 3FR8A 1CEQA 3I3OA 5CDGA 1A7AA 2AEFA 4IUYA 2DM6A 1ZZEA 2HO5A 4I9HA 4J6FA 4UAGA 2B83A 3UAGA 4UEOA 4OQZA 3SLKA 1FDSA 1U1IA 3NT4A 4XYBA 1I3LA 2P9CA 1JLLA 3PFFA 4BNTA 5CG1A 2ZCUA 3ZH2A 2PR2A 5GZ1A 5JSFA 3LT2A 4FS3A 1T1RA 3DZBA 4EEXA 1ADGA 4KWHA 3WIDA 2GCGA 1KVTA 2O4CA 3VTZA 3S55A 1Y1PA 2VWQA 2AMFA 3ENKA 3AI1A 4GX0A 5MDHA 3IP3A 4LCJA 1DC3A 2Y0DA 4FJ1A 4CM4A 2BLLA 3E1KA 3VPSA 4NHEA 4D3SA 5IN4A 2JKVA 5JAZA 2C7VA 1BVRA 3DHYA 4NR0A 4MP6A 1RWBA 1DRWA 3RJ5A 2ZTMA 2YFQA 2Y05A 3PRJA 4CLEA 2HSDA 2YFHA 3WSVA 2FHSA 4NQZA 4HV4A 2DBRA 1M6WA 1JKFA 4FPXA 4BNXA 1C1DA 4FFMA 1TLTA 4MP3A 2G17A 1NR1A 1PU2A 1RPNA 5EN4A 4BV9A 2O23A 1HETA 4H16A 1DDOA 3DB2A 3PLRA 3GR6A 1T4DA 1YB5A 1KYQA 3ZWYA 1JKJA 2Q1WA 4YQZA 1UAYA 1GR0A 1KVQA 4YAIA 4WKGA 2X5OA 3Q9NA 4B7CA 2O48X 2JAHA 1U4SA 2Y1DA 3NDRA 3WBBA 3GLQA 4BNYA 1WDLA 5JY6A 3U4CA 3PTZA 1MFZA 4CV0A 1VC2A 2H63A 2I3AA 2PZLA 3DBRB 2FR8A 2HCTA 1E3IA 2D8AA 1JVSA 3FHLA 1EQUA 2WD8A 4GVXA 1H9AA 4UVGA 1ISGA 4UUPA 3LSYA 2PKRA 1I0ZA 2HAEA 4ALLA 4IDEA 1H0KA 3VZQA 3IUSA 5ICMA 2YW9A 4UEKA 2CDCA 5CEJA 1H93A 4D44A 3Q6IA 1ZK0A 3W6UA 4GSKA 4Y67A 1ISJA 4A03A 4CUKA 4TWRA 3I9LA 4BKPA 1YJQA 1R4NB 3ETEA 3E9QA 3WGTA 2V6MA 4GGPA 4AG3A 3I9MA 2Q1TA 2V65A 1AGNA 4A2CA 4AFNA 3F4LA 4YAEA 1DB3A 5U9CA 3EY4A 4FFPA 3IL2A 3AY7A 3RC2A 4I5GA 1B7GO 3H3JA 1EVYA 2R00A 3HUDA 1UP4A 2JFHA 4O6VA 4RPJA 5TJ9A 1BRMA 1WLYA 2I67A 2Y1GA 4O5OA 2FR0A 4NBVA 1GD1O 1K6XA 4EJ6A 2YJZA 4HUJA 4J9VA 5GZ3A 1PZEA 4YXFA 3DBHA 3DOOA 4H15A 1N9GB 1HDZA 3OQ1A 1B26A 3ZWCA 2YDXA 4RO0A 1ZXBA 4B4WA 4RDHA 1R15A 1TA4A 1C1XA 3GEGA 4IIUA 4JROA 5U4QA 4B3IA 4KUGA 5K9ZA 5I9NA 4ZVVA 4CV2A 3Q0EA 4ALJA 4II3A 4PFJA 3NJ8A 4F46A 4YB8A 1IZ9A 4PLFA 3VZRA 1NR7A 3U4IA 3TNLA 3HB4X 2B69A 1QRRA 1BXGB 3DDNA 4RPGA 2PD6A 2E49A 2WM3A 2CF5A 4J1QA 4AL4A 5JLAA 4A5OA 4CV1A 5KJ1A 2EP7A 4DWVA 2D0IA 1UAGA 5COBA 1NVGA 5I8ZA 1Y8QB 4LCEA 2Q2VA 2WE8A 3S8MA 3Q3CA 1OFGA 5IFLA 1XSEA 4RVUA 3KYDA 3K96A 4B4VA 4GMGA 2E4AA 2EW2A 3ZNNA 1YQGA 4LN1A 3HFGA 1F17A 5A9SB 3AOGA 2FR1A 3N58A 3STHA 4KMSA 2I65A 4JIGA 4A73A 3C1OA 2E6UX 3LC2O 1DIBA 1YVEI 4I8XA 3ITDA 1HEUA 2VYND 3H65A 4X54A 1V3UA 3HDYA 3E03A 3MTJA 4INAA 1YL5A 2VQ3A 3WLEA 1XIVA 1AXEA 4EI2A 1LLCA 4FOOA 3JQBC 4U7WA 2BH9A 3H2ZA 2NM0A 2YHIB 3WGIA 1EE2A 4OL9A 4Z3DA 4OJNA 4CLDA 3WYCA 2PGJA 3F47A 4FJ2A 3RKRA 2RCYA 3KLPX 1Q0QA 3GGGA 5A9RA 3LT0A 1DOHA 1FDUA 1GCUA 1XU9A 1ZCJA 1LRJA 1C14A 1NFFA 4ROSA 4OIMA 3GC6A 4XYEA 4NNJA 3I9NA 4BNNA 4Q3BA 3FPLA 1PQWA 3KVOA 3BHJA 5KJFA 1P1JA 3P2OA 4JJGA 3H5AA 1R16A 3PJGA 2HRZA 4JJIA 5FFFA 1XU7A 5BQFA 2NU8A 2FSSA 2Z1NA 2CUKA 2EIHA 3LK7A 3PZBA 4BB5A 1ULSA 4BGEA 1X15A 4D79A 5KVSA 1BHSA 5L4NA 3H7AA 3TL2A 1PL6A 2NUAA 3C1AA 4QXMA 1GV1A 1E77A 4MVJM 1VSUA 4PLYA 4W4TA 3U9LA 3PI7A 1PS8A 3PHIA 2TMDA 5JAQA 2AQIA 3GPDG 4J43A 1JDJA 5H83A 4F3YA 3FNEA 4R9SA 4JP3A 1I10A 1HSOA 1O5IA 1YDEA 3WXBA 5A5FA 3M6IA 4IPTA 5COAA 3NJ4A 1NPYA 1SB9A 2DBVO 4GSLA 2W2KA 3ONFA 4LSMA 3SVTA 3OJLA 4LRSB 2O3UA 2RIRA 1UUFA 1PSDA 1U3WA 2LDBA 4GKVA 3PHLA 3CH6A 4WLFA 4HKTA 1ZSVA 4MIYA 4NJOA 1G0OA 5EIOA 1K2WA 5HA5A 3MJ4A 2PV7A 2GPTA 1DAPA 1I3KA 1MC5A 1UXKA 2ZB3A 3VPFA 4YDRA 2CDAA 1V3TA 1NQ5A 1VKNA 4U8GA 4PVDA 4OSOA 5THQA 3FTPA 5T6BA 4DQXA 2CFCA 3PGXA 3WQRA 3C1TA 1GYPA 3FRJA 4JN6B 3QP9A 5G0VA 1ONOA 4YEDA 4E0BA 4XCVA 2JAPA 3VKUA 2AW5A 2WMDA 1VE9A 2DU8A 3LZ6A 3JD2A 2AE1A 2A35A 3ZWMA 4NH4A 4YA6A 1E7RA 2DFVA 3DAFA 2NTJA 2EGGA 1H94A 2NVWA 3WYEA 3ZWBA 4L76A 1ZH8A 3D4NA 4OAQA 4ZQGA 3SJ7A 3GG2A 4Q3CA 4L8VA 1P1IA 3WMWA 1XKQA 2HJRA 4AJ4A 3DZFA 4FJ0A 3AM4A 4QTZA 5F3RA 4MP8A 4Q39A 4RLSA 4J1SA 1U3UA 1WZIA 3E9NA 5F1OA 2BD0A 2CNBA 4WK6A 3GAZA 1I30A 1U3TA 1E5QA 3V1YA 5JYEA 3VH3A 4DC1A 3AOEC 2FZEA 2RHCA 1ULUA 3ANLA 3CZRA 1LU9A 3H9GA 3JQ7A 4IQ0A 4DC0A 3MTGA 4PIVA 3GVCA 1GV0A 4KWIA 1YQXA 3DONA 4R4JA 3UN1A 3R1IA 1DRUA 4NJMA 1JWBB 1H2HA 3OJEA 3JQAB 4RZIA 1P44A 1A9ZA 2DPGA 4BO4A 1MP0A 5ER9A 4CQLB 1VL8A 3RU7A 3UVEA 4BO5A 2PKQP 2HUNA 4M8SA 2VRBA 1R0LA 2BGLA 4HY3A 3BAZA 4NBWA 3ZV4A 3DBLB 4YRAA 4IJVA 5EESA 5KJEA 3WSWA 1AE1A 3E9MA 4PLZA 3EZLA 3KSUA 1I32A 4U6SA 4CL3A 1SNYA 1PJTA 4GL4A 2QW8A 3BTUA 3GMSA 4JGBA 2VCYA 3QVTA 3OIGA 1U5AA 4LVCA 3F9IA 1YOVB 3H9UA 4PZCA 5CG2A 4AJ2A 1HE4A 3GZNA 4NFSA 1I2ZA 4DLAA 2I76A 3SXPA 1U7TA 5KKCA 3R0IA 3VOSA 4EEZA 3DTYA 1GPJA 2RHRA 1BDBA 4J7XA 3VZPA 5JMWA 1SO8A 1EK5A 4NMHA 3I6IA 4E30A 1L7EA 2I6TA 1P3DA 1L7DA 3RI3A 1GEGA 3TZ6A 4E13A 2PGDA 1DEHA 3OJ0A 2HK7A 3D4OA 4E5MA 1HDOA 3AM5A 4A26A 2GN6A 4QUKA 2LDXA 3OSUA 4TZKA 1V35A 4FN4A 1SOVA 4U5QA 5GY7A 4EW6A 2ZYDA 3NYWA 5K0ZA 1WAMA 1E7QA 1IPEA 2EEZA 2POQX 4C7KA 4XQCA 3S1LA 3P2YA 3RC7A 3JQGB 1N7GA 1GUZA 2B5VA 3IJRA 2GF2A 3GVIA 4ND1A 3ZWOA 3BMOA 4Y6PA 5C7OO 5IJZA 1GQQA 1N2SA 1LLDA 2HMTA 4CLOA 2X86A 4PCVA 4YJHA 4IDAA 1QORA 5LC1A 1LC3A 5JAIA 4BMSA 2PZJA 1QKIA 4XIYA 4ZQBA 2NTNA 2HK8A 1PTJA 1RM4A 2ET6A 3CPSA 4KQXA 2O2YA 5JDCC 1CWUA 2W2LA 4U0JA 3WOHA 5IZCC 4E2WA 5TLSA 3CXRA 1GZ4A 3OA2A 5DCYA 1P1RA 4Z9XA 3U4HA 2O3QA 2HMSA 4J9UE 3L77A 2DT5A 4R1NA 3WGZA 1V8BA 4FQ8A 4J4HA 1U3VA 3JD4A 2PLAA 2JD0A 4KUHA 1F8FA 1GL3A 1IUKA 2R6JA 5L3ZA 5DBIA 4RPLA 1R0KA 2R00C 4CM9A 3KETA 2FOIA 5MGBA 4CM3A 2A9FA 2YZ7A 5L7WA 4D41A 2IYPA 2ZB8A 3E18A 2BFAA 3RFVA 1JKIA 3KV3O 3OETA 1P0FA 4FCCA 1T24A 1CRWG 2GZ2A 4WJZA 5B12A 3AWDA 2VZ8A 2DQ4A 5FEUA 2HJSA 2CVQA 4O63O 1IZ0A 4W99A 4FW8A 4ALKA 4CMEA 3RAJA 4DBZA 4ESOA 1ZK3A 4YYZA 3TF5A 4IJUA 3PGJA 3BMNA 1XQ1A 1YRLA 2W90A 4WPGA 5HS6A 1AHIA 1R4MA 4BNZA 4UVEA 3INRA 1A27A 4DIFA 5TT0A 1YBAA 2JFGA 1YB4A 1I2BA 3P7MA 3VDQA 1M76A 4Y6RA 4PLHA 3JQ9C 3VC7A 3OA0A 5BSHA 1DFGA 4FFLA 2E37A 3SJUA 2VTDA 3W4IA 3WGYA 3U0BA 3F3SA 4MVJI 4NI5A 4Z9YA 1D3AA 3ZW8A 4ZN6A 5KOIA 1MFPA 4RVGA 1MUUA 3ENNA 5EPOA 3ON5A 4K6CA 1XWFA 4CM9D 5IAAA 1VKOA 1YQDA 3JQAD 3FTNA 4ZA2A 2QZ9A 2EG9A 4FC7A 5L45A 2Q49A 5IDQA 1UDCA 4OXNA 3GNTA 2NVUB 2QYSA 1O95A 4MKRA 2UAGA 3AY3A 5DT9A 4U0KA 5FF9A 1XA0A 3OQBA 2YV1A 6LDHA 5HRUA 5TNXA 1X14A 4J3FA 2AA3A 1LDEA 1QV7A 2Y1CA 2W2KB 1GADO 2IZZA 3QA9A 3UXYA 2Y68A 3PHGA 1OMOA 4ZGWA 1X13A 2O3JA 1NAIA 1Q7GA 2DLDA 2ZK7A 3BZUA 3U49A 1DPGA 4HP8A 3JSAA 4XZ3A 1HZZA 5ES3A 1AN9A 3JQ8A 4XB2A 4BIIA 3AU9A 4J1TA 2VT2A 1NQTA 1DHTA 4IDGA 3GGOA 4WNIA 4GPD1 1EFKA 4TVBA 1ZIDA 5DCWA 3INGA 3A9WA 1B16A 1IHXA 2OOSA 4YRDA 1Q1NA 4H7PA 3MWEB 3QWHA 1DC5A 5T5QA 3DL2A 4G5HA 2OBYA 2Y0EA 3CMCO 4R1TA 3K6JA 1DSSG 2NTVA 4GH5A 4Z9FA 5FI3A 4BNLA 1NPTO 3OFSA 3AK4A 3VH1A 2FPIA 2GN4A 1E3WA 2H9IA 2JJYA 1A4UA 1MG5A 1VLLA 4DREA 4N18A 3VPGA 1Q7BA 1EFLA 1UZLA 1W73A 1XLTA 1G1AA 3G3EA 3AUUA 2YHUA 3OF2A 4ONEA 2OGUA 3PVZA 4DPMA 1IPFA 3WB9A 3ZU2A 1S7CA 3PIIA 4GLLA 4BKUA 3JD0A 5DP1A 2PKQO 2VWPA 3W8DA 2G82A 3S2EA 4YAKA 3PFWO 1XDWA 3RUEA 4A10A 5DNAA 3TN7A 3F5SA 4XQGA 4IXTA 2PTGA 4D7AA 3M2PA 3QWBA 4LISA 4OMUA 3WJ7A 2VYNA
chains in the Genus database with same CATH superfamily
3BILA 4YDHB 5JSKA 4XGNA 4YRNA 1RI3A 5HCUA 1NQUA 1TC2A 1NKTA 1U2GA 1RQNA 3JW8A 4XGIA 1EMDA 2I78A 3DBVO 1C7FA 1DINA 1X8JA 2OO5C 5A9SA 1OZAA 2QYHA 3TK1A 5IDWA 3V33A 1G2PA 3MLAA 3NBFA 1BEUB 2QUHA 4NJEB 1N2XA 3QVWA 4IQ8A 3GN1A 1BX3A 3GFBA 4WVLA 2NSHA 3EPPA 2I87A 3N6VA 2I6GA 2G80A 4HS4A 3MIIA 3P26A 3MCVA 3NTXA 4MUXA 4X0EA 1OLXA 1FXSA 2IZ7A 4WZZA 4YP1A 4DLTA 3SR0A 5TIIA 5EZ6B 4OH7A 3DXXA 3VR5H 1ZMRA 2GPYA 3R3SA 4LC0A 1E3WB 5LUAA 3Q72A 4RZSA 3O92A 5IT5A 2JI8A 2RMKA 3OCZA 1SVNA 4JHLA 4L28A 5GP1A 1PK7A 4YFVA 4ZEXA 1CIJA 4DLNA 3RT7A 1CNMA 2PH3A 5IYZA 2X0NA 2GUGA 2Q2WA 1JLSA 2QUBA 1F8GA 3A28A 3ND9A 5G0SA 3RIYA 5ARCA 5EIHA 3UHPA 1GTZA 1TIBA 1Z73A 3GGJA 5LB2A 1Y7HA 2GPAA 1PWZA 2ORWA 3FZGA 3I1IA 2C61A 4FWIB 4G1VA 4FNGA 4ZAGA 4B09A 2QTGA 2CLKB 1V11A 3SKXA 5KNCH 1AD2A 5EJ9A 4FGSA 2Z9DA 1XEWY 3BMCA 3STYA 2MDTA 3BSSA 1RSZA 4RMJA 3VKVA 3NM6B 4QKQA 3EFBA 2X4GA 5KOYA 3WFJA 4RJLA 4YS6A 1M6NA 1CVRA 5C53B 3D6NB 1AKNA 1XWIA 5IAGA 4G0UA 1TMYA 1L4YA 5E4JA 5AOAA 1ZN2A 4DPKA 1NF2A 3FYHA 3WP1B 3D8RA 1G38A 1JEYA 4Z0TA 2XTNA 4REQB 5JWOA 1J06A 3I5MA 3L8HA 1U5BA 1UXJA 1CY6A 3HCWA 2G40A 5BXYA 2CV1A 1P5ZB 1EDDA 1PL7A 1T4CA 1KO8A 5LZ8A 4DM3A 2CFOA 2IYOA 2ZSHA 3C41J 4HNGA 3L93A 1J0CA 1CUGA 3DZKA 4FLEA 1WMAA 2H52A 4PSDA 3U3RA 1L3BA 4XLZA 2CEKA 4EDFA 3PLAE 4BJ1A 4IIEA 1IUPA 4B3BA 5LN1A 4G89A 2BZSA 2ZRMA 4F11A 3UC9A 4CIWA 1GVHA 2BFBB 4QG7A 2JBWA 2BGNA 2PGLA 1F9EA 1U6KA 3SP1A 4DA9A 1KOFA 1GQFA 3I4CA 3KQYA 4JYCA 1E61A 2FVYA 3DTVB 4LXTA 2ZVQX 1OXTA 3RO7A 1EE1A 4KFTA 3QENA 1Y5MA 1ZHOA 3CPHA 2XRMA 5FOXA 3ANNA 5DYGA 1WUHS 4OLJA 2ZJ6A 1SZCA 2H48A 1V16A 5H9VA 3VYVA 1T2DA 3SOZA 5K6TA 1HQKA 3K15A 2YN4A 1TYDE 4J7UA 3AEXA 16PKA 4UCFA 4BUJA 2ZXFA 1RXIA 3FPAA 1IXZA 3K2BA 1X3SA 3N5KA 1IQ0A 1OBVA 5CYPA 4YRRA 5KJCA 5L3SB 1ADYA 1GA1A 1FFHA 2VCEA 4FC6A 1I36A 3H16A 5F5NA 2C8KA 4JKOA 4M21A 1R0XA 1KGSA 3V2IA 2Q8QA 2OV8A 1T9KA 2E87A 4I9GA 3I72A 1N7JA 3BMOB 3VOAA 3WK6A 4O4LA 5G1NA 5BP7A 5CA0A 3C7DB 4RTQA 2HF8A 3FMVA 3BE8A 1SUSA 1K5DA 4KAJA 2G0AA 3DMPA 1Q1ZA 3DYBA 4N0MA 2P35A 3N3AC 1EZ1A 3EA4A 3OZVA 4AUKA 2KYRA 4DNOA 3DLAA 4JKYA 4CF7A 2BKLA 3O8DA 2X3FA 4NPHA 3GBSA 1I24A 3ROKA 4CIAA 1EA7A 1E1CB 2A3NA 3PCTA 2JAQA 1MVNA 3TLAA 3E0XA 1G8GA 3BWVA 2G9RA 3ICPA 4DDVA 1XTTA 2IHZA 4L5JA 1YCDA 5EINA 2O3TA 2P2YA 5HPYB 4IQGA 1XCJA 2PRZA 1C7RA 1X9GA 2RHTA 3QKRA 1K06A 3R8XA 3WNDA 2AJCA 4O2BB 5F9MA 4BYGA 1X80A 3UCEA 2BFDB 3MTBA 3B2QA 1CUJA 4I1RA 1EUYA 4HDAA 4ZHQF 3VR6A 4RJJA 2P2SA 3D3WA 2G06A 2BHRA 1BSVA 1QH1A 1TZMA 3QOYA 4UASA 4ZCQA 3SF8B 2C95A 1NYRA 3EQ8A 2QYTA 3DTNA 3SHOA 1YE5A 1NM5A 1S89A 3RSZA 4IGEA 1ICEA 1YL7A 1DJQA 4TLCA 4DVJA 3ZV5A 1JJAA 2P40A 2R8YA 5AVOA 2Q62A 3K71B 1JYSA 1W5SA 2DKOA 4L4UA 4TOIA 5ABPA 1H65A 2EL7A 3HYRA 3OTIA 3GJ3A 1XALA 3QHPA 3HYNA 4XVRA 2BBOA 3WO1A 2D0PB 4QHYA 4OB6A 1HY3A 4N0DA 1T5IA 1YUNA 2INGX 1WUYA 1Q5PA 3Q8LA 4D1YA 4HXYA 1CUVA 5LA6F 4H7IA 2X4IA 1JKMA 2I3BA 4P93A 4PO3X 4JX9A 3NS7A 3RJZA 4CMBA 5LQJA 1JWLA 3HCNA 1KJ8A 1R3DA 1KP3A 4Q4LA 4WBNB 2ZU0C 1AF7A 4LHSA 3TOXA 2XCLA 3F2IA 3PEWA 4C3VA 2JH3A 3IOYA 3JAWB 3D2AA 4BNMA 3QFRA 2C92A 2UVPA 1N8KA 2PL1A 1U9CA 2RGCA 1TEXA 3IBFA 4P53A 5ALGA 3QVSA 3ZOZA 1L5ZA 4Y6QA 3UUWA 4MWEA 1OE0A 1P7PA 2YTZA 1YVDA 4M9ZA 2HXYA 5AOVA 4Z0PA 1Q0PA 2I2DA 1PQPA 1AKVA 2GCOB 1NQVA 2MSWA 1YR6A 2Z9CA 3CZMA 3K1AA 1D6MA 3PNVA 4JA0A 5AW3A 1G9SA 4C20A 5IJXA 1O6CA 4ZI2A 5HK9A 4WH0A 1XZJA 4I9FA 4HFMA 4K40A 3UOAB 1NXVA 1KYYA 5M7EA 3IT1A 2XB2A 1QAQA 2QZ4A 2AN5A 2H6EA 5KB3A 2A0KA 4MMZB 1N9KA 3DQQA 4LRWA 2HPZA 1TAHA 2O8EB 4RY2A 5EZQA 4GQAA 5KTSA 3HVRA 5AI5A 3REFA 3IEXA 4P4GA 2G67A 2I29A 3HP1A 3GP8A 4TMZA 2VP2A 1X7WA 4YMGA 3ZHYA 3SLGA 3FOFC 2EDAA 3IKLA 3NH9A 3WLFA 4PC2A 3VV3A 4CEJB 3FY4A 1B14A 5ETJA 1KFCB 3D6JA 2O0HA 4N7JA 1IHDA 5A4AA 2PLNA 4BFZA 4S05A 1GXSB 3M6XA 3D3QA 4XM1A 5C4MA 1LV7A 1MOPA 4AYXA 1WKVA 3L0IB 4M98A 2NO7A 1FRQA 1Z5OA 4NV1A 3D0RA 3RANA 1E7SA 1VI2A 2XYRA 2OC9A 1GILA 3WHLA 1QIIA 3R40A 7ADHA 2R96A 1GPLA 1RMTA 2J3JA 1F1BA 1X7DA 2QUZA 1PFKA 2RH8A 3HSKA 1G8HA 1JHQA 2B0JA 2BEVA 2ZIXA 2ZUBA 2ZI4A 4JP5A 4PYOA 1EK0A 1BS2A 3JCZA 4PE5B 4C7OA 1ISHA 3HG7A 2G8LA 2NU6B 1TQ2A 4PIPA 1FFBA 3SJZA 1DJOA 2IZ0A 2XKAA 3A10A 4RKFA 5AI0A 5JH7B 1FMCA 2XADA 2FWJA 1ZVVA 1BE0A 1SURA 4WNYA 5AVZA 2QDKA 3FJOA 2R8EA 3KHUA 4O4JF 5TVGA 3VHRA 3X2FA 1HDCA 4CM7A 5DTEA 3VZSA 3M2TA 1YUMA 3QXGA 3V9PA 1AQUA 3R5TA 1W4CA 2H2WA 1JDUA 4WW0A 4C03A 1DBQA 2A5GA 1X92A 3AU8A 4TWZA 1OU4A 2CJYA 2P3QA 4JS0A 3IALA 1DXYA 2DETA 5A04A 5LOVA 5IULC 2V7PA 4F12A 1GAJA 3GUUA 4M0CA 9LDTA 1C50A 1NU8A 5HIIA 5FOSA 4AMGA 4PXAA 2GBCA 1C1HA 2SCUB 3TW4A 3CWCA 1O9HA 2OUIA 3EIXA 3OIDA 3KWLA 2I33A 4UNPA 3LY7A 4OSPA 4X6LA 1P91A 3NWOA 4R71A 2UZ4A 1Z6GA 1Z0FA 4HADA 1I3MA 1Y3AA 3D8HA 1PEDA 3QOXA 1DAIA 2GDZA 3D7KA 1YDGA 3BA6A 1YIAA 3FYDA 3I2KA 4WX2B 4CDGA 3LUJA 1XLTC 5ALYA 4B75A 4G9EA 4YAWA 1N2ZA 1NJ8A 2WZBA 3HZRA 5A5GA 1FFYA 3ETCA 4QM6A 1QU2A 2I80A 1AB6A 2H5JA 4U9IS 5KX5A 3FMFA 3KKPA 2Y8EA 2H4HA 3U60B 3PEUA 4E1VA 1IEQA 1K7YA 1O96A 4UE2A 5T4EA 3WA7A 3TUJC 2IYNA 4X62B 1SUBA 3DZJA 4K6FA 1LD3A 1ZX1A 2J3QA 5E7IA 1R18A 2I66A 3JWJA 4JVNA 2GN0A 2RHBA 3VBEA 5FA5A 4P8RA 4IX1A 5EOVA 2JK1A 3VNVA 3G68A 4ZT2A 3JPYA 2X2OA 2QN7A 3O8NA 1WD7A 4MA5A 2JFXA 3B2NA 2NZ2A 3IKTA 2D4HA 2PO7A 3L79A 5I7AA 1ETUA 4JLVA 2SCUA 5JEDA 4GPIB 4OYRA 1EGAA 2VL7A 3TW0A 5TGZA 5T57A 4MQLA 1JSZA 4D81A 5LOVB 4GPAA 3SFZA 1GKLA 2GB4A 2PVPA 2ZJ4A 3K0CA 3OQVA 3UJCA 3IQDB 5C35A 4JBGA 4ER0A 4KGDA 4LXXA 3MFYA 1KR5A 1UCFA 2EBWA 3NM5A 2YYYA 4OFXA 4MYCA 3GX1A 2PZMA 2J7PA 2VDKB 3B6MA 4DQ0A 1KKLA 5IVPA 5BSVA 3QMPA 4OXQA 2GZ1A 4UULA 3RF7A 2P11A 2R7KA 2PMFA 1QHXA 3JSXA 3BGVA 1KL7A 5EIBC 3EZNA 3ISJA 2NU6A 4DPLA 1XCGB 3TQIA 1BWRA 3K0FB 5TX7A 4BPRA 1JB9A 2HPAA 2C2BA 1W35A 1CERA 1QLJA 3DOCA 2BUAA 1K6JA 4OHUA 2G8NA 5T8KC 2FRVA 5ADHA 3ZDDA 2F4VB 3IAAA 5EP1A 4U2KA 1J1ZA 1KHTA 4ZVSA 3N8HA 4AM8A 2QTTA 1IBKB 4ZAZA 3VR2D 3AF5A 5T4BA 2DERA 4G36A 3R8CA 1IRIA 1N5DA 5ESRA 3R24A 1JAYA 1HMYA 1SXHA 4WDQA 1H3FA 1EM8B 1LXCA 1BMDA 2WTBA 3IT3A 3USZA 2VHXA 3ETLA 3RSLA 1TYBE 3BL8A 3G7NA 3N5CA 1ID1A 1UC5B 4H1VA 3E1SA 4MRVA 4YV0A 1JQBA 1ZK1A 1X7WB 3GFVA 4OOEA 4RJKA 4I36A 2JFQA 2FPSA 2AGVA 3PTLA 3EG9A 3DE2X 3SE7A 3ZQKA 1T0UA 4Q3AA 1ZL0A 3ETDA 2ZM5A 3WKDA 5A3RA 3FPJA 1KMQA 5D1NA 2EYQA 1Z88A 2X1LA 4E7PA 2XUJA 2JNWA 4XQEA 2VSNA 2LE0A 1RWQA 1E9DA 1CDOA 3KS9A 5D7BA 1U8UA 4J1NA 4OGLA 4KI7A 2F2TA 3T3PB 3PC8C 4E46A 3NYIA 1B1CA 4DA0A 1WCWA 2BUCA 3LPLA 4OQPA 2NVBA 3VAYA 3WAJA 2IJGX 2FWNA 4JEHA 1AQIA 4A8PA 2QW0X 3PQ6A 2E5FA 3QX3A 1SIWA 3I58A 4WFQA 3NHZA 1GUDA 5DEOA 10MHA 3ZTTA 1PF7E 4P3KA 4KQ6A 2ILVA 1AMUA 1RC0A 4RS4A 2HR1A 3ZCSA 3GRAA 1EI9A 2CD7A 2M1ZA 3FYSA 3B1KA 3HU2A 4OI4A 3BICA 4UQOA 4EHIA 4D6PA 4RBNA 2RB5A 4NOMA 2FFHA 4OCZA 1OGIA 3AW9A 3H5NA 1GVNB 3O7MA 5EUBA 3D1JA 1SXJE 3OAAA 3V4FA 4C5CA 4OXIA 5A0TA 1M67A 1UJ4A 2OILA 1QFJA 3LT4A 2Q4EA 3GJ5A 4MS1B 3Q2IA 3B38A 4F3RA 4AJEA 4M1EA 2WWGA 3T06B 4J2TA 3QEKA 1JFTA 3L4BA 1USKA 3EHDA 4DDHA 1VA5A 1XLWA 3BVPA 3TR5A 3TECE 1C0KA 3EDMA 3VR3A 1RWKA 2P9GA 3DR5A 3GCDA 1C9KA 4BMDA 1Z4IA 3CN7A 2HRCA 4Q48A 2G4CA 1BW9B 3FCOA 3KKOA 2QN2A 2G0NA 1E64A 3MB8A 3X2SA 1I3NA 5KOJB 1PNVA 1XNGA 2D3WA 3DAOA 3DV0A 4RHUA 4UUMA 1G20A 3EQZA 3IJPA 3C85A 3PXEA 1F2DA 1ZAYA 4OJYA 3DUFA 3I6YA 2Y27A 2AD5A 3D7MA 4LRTB 3U2QA 1BE8A 3OJOA 3KU1A 5E6UA 1JT9A 3D3WB 1ORIA 1FVHA 3A1FA 1F48A 3GGSA 3HA2A 4K6MA 4PSKA 1JR4A 3KKKA 3O73A 4JT8A 5G02A 5B4VA 1TA0A 2VTVA 3DBHB 3N59A 4UTRA 4GIBA 3FWPA 5GZ6A 3KZXA 1G4AE 3FCSB 4P4LA 1JKJB 2ICAA 3PG5A 4Z2YA 4M4SA 2D2XA 4AZ3B 5B7GA 3MD9A 3FVVA 1DT5A 3PGMA 4P38A 4INPA 1OD6A 3RGGA 4KQFA 3UFBA 1KP2A 2BZ0A 3MMPA 4CETA 3IIMA 3DAYA 1XZHA 1KWKA 3N76A 3H1FA 5ADUS 1XP5A 1OOEA 3QEOA 4K87A 4XB6B 2OZLA 1B8NA 1XKLA 2DWCA 2I5PO 3EMBA 3T4EA 3E9ZA 1R4AA 1R6DA 3ECAA 5KYWA 5KWJA 2COEA 1I7DA 3N0RA 3SHFA 2WJPA 2HU5A 1E4EA 3PYXA 5CM9C 4ND6A 1OFHA 2H2IA 2AX3A 1LEHA 1G8KA 2AXNA 3DZIA 5I5EA 5IASA 3AQIA 1MJFA 4LX8A 3BULA 4NZZA 2VYVD 1IG0A 4LFCB 1ORRA 3FWNA 3NIDB 4L0MA 3Q7SA 4X94A 1QF7A 3W05A 2XUZA 3FWHA 4US1R 3GYGA 1T2UA 2QX6A 4PV7A 4XGKA 6REQA 4KXLA 4KSYA 1W4LA 1J4AA 2BZGA 2O5RA 2UUOA 3IVMA 1PJ8A 3CINA 3P4YA 4ZVOA 3TDMA 1SBHA 3G9XA 2VJMA 2YR0A 3GH3A 3P4UA 4FFOA 4M9SA 2O19A 1LLUA 1IH8A 3STUA 3OJFA 4E5VA 1ULAA 2R6DA 2QJOA 4D0NA 3HUEA 2PKWA 3C6KA 3DFZA 1BG6A 4ZEWA 2FMUA 1DL5A 4JYMA 3DTVA 4KPGA 4KO3S 4BQOA 4GI2A 4UOZA 1BDJA 1NPDA 4KQKA 4NC9A 3H9JA 3KSMA 4KXQA 5FTKA 1YQWA 2D06A 4LBYA 2AKEA 1YHYA 2VHJA 2YXEA 1Y5IA 4PU0A 2FP3A 2A14A 5G53C 2O8BB 2QVZX 4Q37A 3D3NA 3GQVA 4YAFA 1LS6A 2Z58A 1AS3A 5FBHA 1WP9A 3SHTA 4ZICA 3SYMA 4U7JA 3SNKA 4YV1A 1I0IA 1KS2A 1DLJA 1ZOIA 3CRZA 3MUNA 3FVQA 2Q2QA 2WOJA 1E5TA 3G7UA 3HDGA 3PQEA 3ZDXB 2BHTA 5AKKA 3F2VA 3PENA 5AVKA 3P20A 3VHXA 5DCLA 1JEYB 2B1RA 1M1UA 1I51A 1V47A 2O2JA 2YVLA 3LSTA 4MUHA 5E1DA 3Q3VA 4DQVA 1TGVA 3TM4A 4B34A 2E82A 1VLHA 2Q3EA 2R8RA 3MJTA 5CYOA 5DHAA 3T15A 2BUBA 2J46A 3GW8A 4BN0A 2IS4A 1AQYA 1T9DA 5I9LA 1Y4SA 4FB4A 3C7CB 3HNPA 2R6ZA 4PSCA 3RYFB 1DV2A 1YR3A 3GAAA 3HCRA 3LQYA 1OROA 2V96A 2GZRA 1MQAA 4R8MA 1TI7A 5EFOA 1J1UA 2P1DA 2IUUA 4C3UA 1T25A 2PRSA 2QPTA 1KZ7B 3IAM1 4JFRA 4UPDA 1UL1X 4YP7A 4CR8A 2A9JA 2EJUA 2JLUA 3TJZA 2Z83A 1XDZA 4NECA 2QBYA 1KDRA 3SLRA 1YDWA 1OVMA 2NO4A 1GGVA 3C3EA 3FFBA 3GUHA 4I1OA 3USCS 3E9YA 3QXHA 3B82A 5TQ2A 5CW2A 1H0RA 4G67A 2XA9A 4BBZA 1L7BA 1WEKA 1XZNA 2AF4C 1OXBB 2ZIGA 5F78A 1GARA 3NEYA 4OD0A 4YP5A 3LQ1A 3ASYA 4GAEA 5ICSA 3NNSA 5LBUA 2QSUA 1MO6A 1JQLB 1M2FA 3CRQA 4Y6SA 4Z8XA 1WU7A 3N2KA 5FUMA 3DW1X 3G2QA 4PAGA 4QGFA 3U4DA 4D46A 2Q1XA 4OAPA 5BQPA 3QPBA 4C7MA 3PTAA 1A9SA 1XA4A 3UAWA 1JEEA 1QTNA 4GXTA 4G4GA 2XGOA 1NVDA 4PTYA 5A6SB 1IXYA 5KIAA 1KI8A 2REBA 2VBFA 5A3JA 5JCOC 1X1EA 3RWBA 1JH9A 4KACA 1UKVY 1BHQ1 1W8DA 2V6GA 2XECA 5JWHA 1TIPA 2OORA 5KQMA 3PIDA 2FV8A 3EAGA 4YCNA 3EMVA 1GGNA 1XV5A 1Y34E 1PKXA 1YFJA 1ODIA 2WF5A 1ZR2A 1U0FA 3ORHA 2AC2A 3B3JA 4AP6A 4MS4A 1H2XA 4P4UA 4ETIA 3BGSA 3QLUA 3CH4B 3VNBA 1R66A 1YZLA 2VHVA 3DUWA 3IBSA 4D4LA 4YUWA 1QNLA 3DE0X 3TXYA 3ZKWA 4IFTA 3HR4A 4R0NA 3E9EA 4GKBA 4N3GA 1GAXA 1FZTA 4JXKA 3GZ4A 3W5IA 4RIHA 4YIKA 2ATEA 3CF0A 4QPDA 1E18A 3C7AA 2NZYA 3AFMA 1XVAA 2YJNA 4X3CA 4N7RA 4BKMA 1OXXK 1WS6A 1RXSA 4PHFA 1XU4A 5KC9A 3W3AA 3U26A 1C9NA 3IP7A 3ZG6A 1E2EA 1XHLA 4BMZA 1ZSNA 4OMCA 4TXJA 4JX8A 3KQKA 4RHXA 4HRXA 3KR1A 4ZOQI 4HLUC 3PNSA 3NDIA 5LP6F 3QY9A 1ND5A 4XUGB 3PXXA 5FB3A 1QVVA 1EFHA 1WX1A 3DWGA 3I52A 3LYUA 4R9UC 3RM3A 3PNKA 2ZSDA 4RV9A 4ACBA 2C7GA 2OV6A 4NPCA 4AY6A 3F7TA 4CNQA 1M72A 2R4QA 3DHNA 4UQPA 1JHAA 2GH1A 3KEFA 1ZM2A 3BD7A 4BNUA 4RVDA 4BMYA 2UZIR 3OLXA 2PAAA 1U7HA 1ZK2A 3R77A 2OHGA 2NZXA 3E3MA 2DUMA 4HQRA 5JH7F 1P77A 2PEYA 1QVAA 1PR6A 1QIHA 3PGKA 3W9BA 2BN4A 7MDHA 5CLGA 4URWR 2EP8A 5CAEA 3WO0A 3CYFA 5CLIA 1QYIA 3QVGB 1GITA 1LSSA 1Z82A 1Z6QA 4MIOA 3BEOA 1RCUA 3KJIA 4UM9D 2Q3HA 2XX3A 2C7OA 3A26A 1U6IA 3ZGNA 3HFJA 3NNDA 1UXGA 4EY3A 3CR7A 3TJRA 4Z1MD 3A2MA 3NTUA 1X9IA 1NQXA 3ZH9B 3OQ6A 3EVCA 1OILA 4CG1A 2J7PD 2GWHA 4NFLA 1VKRA 1E1MA 3C39A 5ECYA 3HWSA 4AY2A 1DT3A 2ZW9A 4PRKA 2W70A 4B85A 3FZYA 4FN5A 2D6FA 4E2YA 1KSFX 5D5QA 3NVMB 2EU8A 2C88A 3DW3X 4JKIA 1MC8A 2OXIA 1OYOA 4DXAA 5P8WA 5IN5A 3GDGA 4GI5A 1J5XA 2H1WA 2ZBUA 3EQ7A 5B4UA 4ZO6A 1Q7CA 3P4XA 2DZDA 2A6PA 3PBKA 4KSBA 1H2BA 2NU7A 4OHYA 2OCPA 2BKAA 4IP0A 4KQ2A 1FU7A 3A9UA 1WE2A 2H5LA 1VXOA 1URPA 3KT8A 4OUDB 2GNOA 1XNQB 4PBTA 1H8HD 1WULS 1XK6A 2YQ5A 3H97A 3I0MA 3MWYW 3RVNA 4HWRA 4GZ6A 1KVUA 3DVAB 3EUEA 2NUAB 4CHGA 3EIWA 3U5TA 1Q0SA 1TF7A 2MSLA 1NC1A 2BEUB 4PG7A 4N5IX 1YR1A 1TK3A 1ZONA 2NV6A 4R6WA 2WNHA 5AVYA 1UWCA 4OGGA 5CDFE 1QQ5A 5JXGA 3FVRA 1DQPA 3OF5A 2WM9B 4JLDA 3A9SA 1VIVA 1GLVA 1K6MA 3G13A 1CJVC 1JU4A 1GSOA 2MSNA 2WD7B 3JS5A 4KB5A 1Z4KA 2BELA 4NV0A 5EHNA 5T4FA 5JASA 3LF1A 2VNHA 3P2KA 2BJWA 4DQKA 4EGSA 2AZTA 4P54A 3E5MA 2ZKLA 5L7YA 3C24A 1UBKS 4I2VA 4LSZA 4R2HA 4E5YA 5I7SA 1CF4A 4IW3B 4Q7EA 3I9JA 4UARA 3HO6A 5L3QA 1K2VN 3LPNA 1LUAA 2GVDC 2VQSA 3QE4A 1YL6A 2VNAA 4KWCA 5KTYA 4H6WA 1X7YA 2YJ5A 1H69A 2Y66A 5B3JA 5F1KA 1DDIA 1Q22A 3WNQA 3RAEC 4AKSA 1U2ZA 1JFSA 2HJ9A 2H9AA 4HYYA 5B37A 4BZXA 1XTQA 2V8BA 3OKCA 1RTTA 4LZLA 1PGPA 2N1BA 5E6RA 1BXRB 1Y1KE 4JP8A 1DFHA 5BR1A 1XTUA 1N7HA 5F3DA 3TWOA 1QGOA 4CCAA 1AN0A 5BWBA 1WSBA 2FN7A 3LX6A 4PZDA 2H3HA 4WHMA 4YX9A 4KIWA 4M86A 2VJLA 4UEQA 2IOHA 1CVIA 1ZRMA 3T9CA 4A8HA 4J7CA 2ORYA 5IF3A 1TCCA 3MGAA 2AKYA 3P0JA 3G5MA 5AJZA 2A4KA 1COWD 1SGWA 1X42A 2HBRA 3CZ5A 3OE4A 4FK8A 2QU8A 1VI6A 2D1SA 4F56A 3OX3A 3ESBA 5TGDA 1Z0ZA 4HLQB 3AI2A 4QXPA 5E95A 1ZUNB 2C0CA 1GHTA 3H18A 3NBAA 3AKDA 4NBRA 5E7JA 1UDWA 5A71A 3VZDA 4BFUA 4EWLA 3ED1A 4B79A 3MOIA 4JDPA 4J0HA 3NALA 1HT0A 1N6PA 1Q17A 3CE9A 3F1KA 2WDZA 4TUYA 3MHTA 4TXLA 3HUUA 3D8UA 4K46A 3SSMA 3UMGA 4U2CA 4GUAA 3HWRA 4ASUA 4XW2A 3FHOA 3I8XA 1NVTA 2HJGA 3JALB 2NO1A 1UANA 4KR3A 3PR3A 3FETA 2VHWA 4U7TB 1U9JA 3T54A 2GEFA 2VOEA 4EZIA 3VPHA 5JFTA 4XIJA 4W7HA 3QXJA 4DA7A 5K0EA 4RV4A 3KJZA 4G4SP 1SULA 5LWHA 1ZISA 4Z8YA 3VVLA 2GPNA 5AXDA 2JG3A 3VRHA 1J24A 2GLXA 4GKKB 3S1AB 2Q7DA 1UOEA 5BW4A 5D85A 2IV3A 1K68A 1QXSA 1TPZA 2P6RA 1WL8A 2PR7A 2QN1A 2RJOA 2QWXA 5DLPA 3V1MA 2Z2ZA 3LZCA 3NPAA 4CMIB 2IZ5A 3QE9Y 4UJ3A 5I7FA 1XK7A 4YDSA 1WW2A 1E9RA 4ARUA 3PEEA 1DHRA 3DKPA 5BV8A 1RP7A 2A9QA 3IP1A 1J2JA 1LPSA 2A0UA 1IMOA 4D45A 4ER6A 3DOJA 3GLHB 3VR3D 2Q6LA 3NPMA 4P4SB 2X6TA 2ACKA 2DFPA 1X9HA 4KLAA 3RFXA 1RAAA 5CURA 3LPAA 5E4TA 4NOJA 4OV6B 4C07A 2ZG6A 3KVVA 2GM5A 3D1LA 2IKSA 1JG6A 1QFXA 5B2ZA 4AY4A 3HCEA 3MBIA 1QG4A 4UHEA 1OV4A 5HE8A 3IHTA 4L3VA 2XUQA 1L5LA 1ZMOA 5FBLB 3TJMA 4PS1A 2Q1UA 1C1DB 5FWYB 4IIFA 2XZPA 2AEMA 2RJNA 4QLAA 3UMYA 1NMZA 3GEEA 4EUHA 4YV7A 3VISA 4RK0A 4JXXA 4WY2A 1P2TA 2CJWB 4EHKA 3B70A 2CXHA 2BFFA 1XPRA 1V0JA 1XZKA 3FFTA 5G40A 5EP3A 2HH9A 2VK4A 3DDSA 1T0PA 3HA3A 2H5IA 3JRXA 2VUSA 4HQOA 4KKVA 4L4SA 3RVQA 4B8ZA 4CQNA 5KWSA 1E6EA 2YWHA 3HJTA 1UP7A 2MYNA 5AKIA 1RPTA 2C07A 4OHKA 2V7EA 5FD8A 2NQ8A 4Z86A 5BN4B 3ZR4B 3WGHA 2FJUA 1TRKA 1SVUA 1P2DA 1H6AA 3DEKA 3PRHA 1BS9A 2P9HA 4PM4A 1NJFA 1V7CA 3AJ9A 3FPFA 2L19A 1KK2A 2ZR8A 1K86A 2ZUSA 2ETVA 3QF4A 4AJLA 5ALUA 2ADMA 4IXMA 5DO9A 1PQUA 4EMSA 4HVCA 4G4SO 3OQPA 1FDTA 4YJFB 1CKEA 2A88A 4X95A 3ZLTA 4LZZA 5E3HA 4EUNA 3P19A 3TI9A 1WSAA 2IBSA 3U7EB 3EN0A 1DAOA 5AVXA 2NADA 1QHHB 2CVZA 2QLBA 4QYXA 4W1RA 4YJ3F 1L8AA 1X7ZA 3STWA 2H1FA 3G8YA 4NCKA 4A6EA 3T1NA 3C3AA 2L17A 1O8CA 1HDGO 1T36B 2C97A 1DBVO 1FFGA 2IY7A 3JX9A 3K2EA 3A05A 4PCAA 2ZFUA 3GCZA 3RGWS 4PZYA 1M2OA 3QPCA 1Q0TA 2YY7A 1CQJA 4OHVA 4MQ6A 2NW6A 1U2DC 1R1DA 4TL6A 2Q0QA 3DDOA 4YACA 4AP9A 1XEXB 1QZUA 4KREA 1RS0A 2WU8A 2PJRA 2G4VA 3KB2A 3I4FA 4AIRA 4K3UA 3N7UA 2CVOA 4HRYA 4JBYA 1SHZA 4F91B 3ZU5A 2UXDB 4MVJD 3SOPA 4HAWA 5LKAA 4R83A 4DMHA 5TV2A 3I5YA 1T9GS 1TX4B 2ZWVA 1TZBA 4I8DA 4UDXX 3QA3E 2A1UB 2O8VA 1ZGBA 2F00A 4IGIA 2RHMA 2OLKA 3ECCA 3EVTA 3ROFA 5ALTA 2PUFA 2A0XA 1N8TA 2QE6A 4DZZA 4KR7A 1X7XA 3L0DA 3RK1A 1VJCA 1HG0A 4HNSA 2REOA 4E5DA 1HA3A 3TG8A 5CHEA 4HR7A 1JI0A 3ORQA 5E0KB 4UBKA 1UPFA 1P1HA 4RLHA 3MJVA 2PS0A 2VJOA 2OHVA 3LT5A 1XRSB 2NUPA 3NDPA 5THXA 2D0DA 3UPUA 1NW3A 2JD2A 1JTVA 3M83A 1QQTA 1XJ0A 3AF2A 4P5PA 3A7DA 4XTCS 3RU9A 5DGCA 1RQRA 5FUWA 3HNOA 3SM3A 2ZAMA 1QE5A 4FSDA 4PN3A 2PUAA 3QI7A 3VR1A 2O52A 3A1VA 1AIPA 3EXHA 4GWGA 1TKAA 1R0ZA 3FUUA 2PA0A 2E1RA 3G23A 3PQ3A 4AVYA 1IUNA 6CHYA 2EQBA 1DARA 1V2GA 4IZ6A 1SCNE 2WWXA 1Z25A 3UH0A 3M5WA 4C2BA 2CLSA 3IODA 2JJ1D 2WJZB 4EHJA 1MW8X 4YWJA 4X91A 1PGJA 4AROA 1VE1A 4QYIB 2YMPA 4H1TA 3BWYA 2C2XA 1E6UA 5F1PA 3PEYA 3D0KA 1D9XA 3RYCB 5IH3A 5I47A 2HOQA 3V9AA 5I9TA 4N03A 4AUNA 2J9GA 2JAOA 4LOAA 2BCJQ 2DCUA 4RESA 3UW1A 1CZHA 3LHIA 3TZEA 5I3ZA 1QK5A 1F4PA 1P45A 3V8MA 2PGAA 3U62A 2GBLC 5LFAA 2P68A 4WXMA 4ZJUA 1HNXB 3U4QB 5JSQA 4YJ3A 2KM1A 1EGVB 3AXTA 3LYLA 5KNLA 1I8TA 3FFAA 2OA0A 2J0QA 3ZCUA 4Q7MB 3JQAA 1T91A 1ESNA 2ZWMA 2B1JA 3MVEA 3QYFA 2FSFA 3Q2KA 2J67A 3RD5A 2G9UA 2WKPA 2WUFA 2FN9A 2ZIAA 3CG4A 1JIUA 3OFKA 3W7AA 1TECE 2IT1A 3QELA 5C5IA 1FTQA 4M9RA 3A4LA 3PYLA 2PNFA 4DYVA 1WPQA 2JJ2A 1K3UB 1TUBA 4ENTA 2DWUA 3D2CA 4LJRA 5CNIA 5E7MA 4OGWA 1FZQA 4JDUA 1A7UA 5FTJA 1J0AA 2Q4BA 3GT0A 3MZ0A 4DV7B 1JALA 2X8BA 3OX2A 4AG6A 3FM9A 4FFRA 1V8OA 1TOAA 2PH1A 4FBGA 3UJDA 4ZQFA 4A0SA 1X8KA 4BVHA 2XXAA 2QRZA 1SUPA 4C7JA 3OLZA 2R1UA 2C99A 5CDUA 4CI0B 3LYHA 4HH0A 5LYJA 2O1EA 5LBTA 1WXIA 2FE4A 2GBLA 3DO6A 3THSA 1P17A 2C2WA 5EXDA 4MINA 2K7ZA 4MEJA 2MOKA 2JGEA 3HGTA 1WB5A 1P4RA 3FSJX 2FPWA 3N8DA 1DE0A 4HB0A 1HNZB 1HDRA 4Z7QB 1JG1A 1GCOA 3IQWA 5CM8B 5TDHA 2W8BA 4IIXA 4UM7A 4BN4A 5EWJB 2GXUA 3RUCA 3T3IA 3HYTA 4HFRA 1L8XA 1F8XA 3L0PA 4Z6KA 3WB2A 3WLSA 1XJWA 3IIKA 3JQFA 4K81B 3RE1A 3B7GA 4A0GA 3PVSA 4X24A 3THWA 1PD0A 2J59A 1I9CA 1Y3IA 3VNRA 1VCHA 2KLBA 2QMYA 4CL0A 2QU7A 3A4IA 5AI9A 3VYRB 2VXYA 721PA 3LQRA 4RD2A 3KT0A 1J8VA 2EX4A 1GQ2A 2J3HA 1RQLA 3BIXA 3EGOA 3OZFA 1JP7A 4E15A 1TKRA 2F43A 3COJA 1V6SA 1GQRA 4BQPA 1L7QA 1M5RA 3ECSA 3RYHA 2EAUA 1K5PA 2QJRA 1NOJA 4XCQA 4Z9AA 1XQ9A 1OY1A 1QYDA 2CKMA 3CUYA 3A6HA 3PPYA 3OZAA 1NI3A 1SY7A 5MGNA 3EVAA 4H0NA 1VIMA 1T2NA 3H1AA 4G24A 4NABA 4EB6B 1IBLB 2Z5LA 1I7LA 4AIIA 2ZYTX 3KYBA 2DR0A 1WHTB 5H02A 1P3Y1 3P52A 5EY5B 2MSEB 3KQPA 4WLNA 1FEZA 4L6AA 4B7XA 1F06A 1A1SA 2XCQA 3JZAA 4HWSA 3RREA 1FP1D 2YH2A 1KORA 4RDCA 3KVRA 2GAAA 1AY0A 1Q0HA 1E9EA 4TZTA 5TGTA 3VR6D 5CNJA 5JDIA 3IOMA 1GRRA 4LTMA 2O07A 4RZHA 3LRPA 1IWBB 5HM6A 4ENPA 3BZWA 2R1VA 3RODA 1FS4A 1FLVA 4Q15A 4UD2A 2GN2A 4B6RA 1ZA1A 4I50A 5LMUB 1DTSA 4FEAA 5FTMA 3T1OA 1GQOA 1PX0A 1SUFA 2PA3A 3SF0A 5LD2C 1H9BA 4LDPA 4E5SA 4RFVA 3NOQA 4P7JA 5AJUA 5TF4A 2A9RA 1QE0A 2TMYA 4RTMA 4LJ9A 3P2JA 1O3YA 1XELA 4EMBA 2PS1A 1XGKA 1ZCFA 4PVCA 1X1DA 2Y67A 4L9RA 5IKMA 1NLFA 1ZEMA 2ZETA 2ZI9A 1M73E 3ESQA 4XQ9A 2OE2A 2WVJA 3ZS9A 2ZYUX 3HCFA 4V2IA 5FL7A 3O75A 5BQOA 4PWYA 1IM2A 1OFVA 4R68A 3DEIA 4YFYA 1FK8A 1RACA 3SC6A 4H3SA 4O4IB 3VR6H 5JHHB 1Z0DA 5EJ7A 5BSWA 5I8WA 4BC1A 2ZJ7A 4BKRA 4W5HA 3EXFB 1A69A 3I04A 4JB2A 1QTRA 2QMZA 3H13A 3RAGA 2YWJA 1IJFA 4RKRA 5EJMA 1UBFA 1LK5A 3WNVA 4C0XA 4EUEA 1P5JA 4QZVA 2YIMA 1EYZA 1WB9A 5JDIC 3B5JA 1JBEA 3ZLUA 3UGJA 3QBDA 4QLBA 5E2AA 2R84A 1UQRA 2W2TA 3OM8A 2P9TA 1DAGA 3TPCA 1SHJA 2OQVA 1YZKA 2RCNA 4MUMA 3AHDA 1WBDA 1A0OA 4C06A 2A84A 2JIRA 4OHPA 3RKSA 5ENZA 4N6NA 5KVQA 2C96A 4HQ0A 2SECE 3SHQA 1ZGHA 3GVXA 5FPYA 5A4DA 3U5ZB 1LBHA 3RVPA 3ZWVA 2YL2A 4OQDA 1XEAA 1ZIXA 2C59A 1IHUA 4AMBA 1A72A 3DB1A 1MIHA 3LC7O 2FDXA 3ODGA 5CPFA 1XNHA 2E85A 3MRVA 2X5NA 5K0NA 1SHUX 2GWRA 2YVUA 2PBZA 2GA8A 1CRLA 1SA0A 3D6VA 2XUOA 3DC7A 3IAS6 3KZCA 1G6KA 4FMPA 4MWTA 2XMPA 4IQFA 1ZI9A 4FGWA 5SZHB 3T35A 4DY4A 1BQEA 3SM9A 5A6VA 1BXGA 5KAPA 4FWTA 1OUMA 2IYUA 4JVOA 2EKQA 1MNQA 4B6SA 2OP0A 3M1YA 1MIOB 4NMXB 1MO4A 2PT7A 4P22A 4X6UA 6Q21A 3M6FA 4CKWB 3Q6MA 5AVTA 2EDCA 3P9QA 1MO5A 3OIWA 4LXGA 2H51A 4DJEC 1ADBA 3Q15C 1J39A 2B2XA 3UJNA 3JQEA 1NF8A 1PVDA 2YZMA 2ZAYA 3ZW7A 2QX7A 3VO8A 3WR5A 3M89A 3K8YA 1J90A 2A92A 3NHKA 3TEMA 1F8YA 2QB5A 1WO8A 4UPEA 3CNBA 3RUAA 1ZJYA 3EZYA 2QTVB 3RRYA 3SX2A 5K7SA 3GLIB 2C8VA 4LEIA 5BORA 4ZODA 2X8JA 1E89A 2MU1A 4E14A 1W0KA 2P9ZA 2FX3A 2AFRA 3D0OA 2W2MA 4GYWA 4RLQA 4ZANA 2WPDD 5M29A 1RAIA 1V9LA 1Y6ZA 4OHOA 4ZWNA 4TYNA 2EX0A 3B1YA 4R1MA 1GM5A 2WFLB 3CF4G 5LZ9A 4GZLA 1GZ7A 4OFWA 1I7PA 4C1BA 3K53A 3G0OA 3VR4D 5ICFA 4DYHA 1MTZA 4UE6A 2FFAA 1KZ4A 4JU8A 5AOCA 3S2IA 2DAPA 1OIWA 5U4XA 1RYHA 4D26A 1FSPA 1SCDA 4ZKDA 1QPBA 3ELWA 4EENA 4AJ1A 5J5VA 1P1BA 1WETA 2ZWIA 2B4AA 1QYRA 2H7YA