1Y8QA

Sumo e1 activating enzyme sae1-sae2-mg-atp complex
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
336
structure length
313
Chain Sequence
GISEEEAAQYDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQVTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRDVIVKVDQICHKNSIKFFTGDVFGYHGYTFANLGEHEFVEEKTETTMVKKKVVFCPVKEALEVDWSSEKAKAALKRTTSDYFLLQVLLKFRTDKGRDPSSDTYEEDSELLLQIRNDVLDSLGISPDLLPEDFVRYCFSEMAPVCAVVGGILAQEIVKALSQRDPPHNNFFFFDGMKGNGIVECLGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-like 1 activating enzyme E1A
publication title Structures of the SUMO E1 provide mechanistic insights into SUMO activation and E2 recruitment to E1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 101
structure length 313
sequence length 336
chains with identical sequence C
ec nomenclature
pdb deposition date 2004-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00899 ThiF ThiF family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1y8qA00
4XYBA 4W9NA 2YW9A 5T8KA 2AE1A 1WPQA 1ZUD1 2DBRA 2EW8A 3FN4A 5THQA 2UV8A 4M86A 4MKXA 3T4XA 3KYDA 3I9OA 4XKJA 1LQTA 4C7JA 2FP4A 4AJOA 2R00C 4CMKA 2OUIA 1IPEA 1E3WB 4IS2A 1SBYA 2Q4BA 2XAAA 3VPSA 2NU8A 4PG4A 1I10A 4FFMA 3ZWXA 3L9WA 4GLLA 4I9NA 1UDCA 3S55A 4NJMA 2B83A 4B8ZA 2E49A 4GVLA 3AY6A 2Z5LA 5IDQA 3GR6A 3KYBA 5CEEA 2IODA 4JJFA 4L74A 4B4OA 2OP1A 2AXQA 2OORA 4RPGA 1PEDA 1WXDA 2IYPA 3VPFA 1HZZA 1Y9AA 2B4TO 3H9EO 5DP2A 4E32A 2D5CA 2FWMX 4GMGA 3E5RA 3GRPA 3LK7A 1NWCA 1XA0A 1IZ0A 3D3WA 5EJ2A 3NUGA 4N18A 5DDIP 1NHWA 3AU9A 4EUFA 5T5QA 2VOEA 3AJRA 3I9KA 1NR1A 2X22A 5L4SA 4DIBA 1PS9A 4NHEA 4BMVA 1M67A 3R0IA 2DUUA 3PFWO 2YV2A 3AUSA 3WYEA 5I7EA 3DMTC 3RKRA 3AUTA 2J3KA 4MJLA 1T25A 3S2IA 4DIFA 1GCUA 1Q7CA 3WMWA 2QRJA 3L9XA 1NBOA 1D7OA 4EZBA 3F47A 1YB5A 4ALKA 4HFMA 1NVMB 1S7CA 3I9LA 2IZ0A 3RFXA 4JBGA 4J9VA 4W9NC 4E5YA 5T8KC 2AQIA 4MVJH 3DZIA 3KSUA 1UP7A 4YAEA 5TJ9A 3RUCA 5C5IA 4Q3AA 5IZ4A 4ITUA 4Q3BA 3DTTA 3SBOA 1NQTA 3QWBA 4XYGA 1VL0A 4PLTA 4TVOA 1O9BA 3R3JA 1NASA 2OHXA 2D8AA 2AEFA 3L6EA 5G0TA 1QV7A 4CLHA 1P44A 2Y1FA 3V1UA 1LBEA 2YQ4A 3LC2O 4JX8A 5ENDA 3ZHXA 4BQRA 2HMTA 1E1KA 3HZZA 6ADHA 5JPIA 4AJKA 1PWXA 1VM6A 1R4NB 1KY4A 3NGLA 2LDBA 3JQEA 1QYCA 4XGIA 1LDBA 2PZJA 3ZNPA 3DFUA 2E37A 2HK7A 2EEZA 3HB5X 4DLBA 3F5SA 2NTNA 4GWKA 3VC7A 3UXYA 1H6DA 1MFPA 3DBLB 3MTJA 3RVDA 1H93A 1YXMA 4ALJA 3CMCO 4AJIA 3OJFA 2W8ZA 3MWDB 4UUNA 1E7SA 3A9WA 2G5CA 4Y6SA 3TN7A 4GX2A 2PZLA 4ZRNA 5IDWA 5ICSA 5T67A 2OO5A 1LRJA 2UAGA 1G6KA 1VJ1A 4D46A 5TIIA 3FWNA 2QW8A 3Q3CA 4R41A 3I6IA 2NUAA 3CINA 3RC2A 1P0FA 4PLCA 5KVVA 4IMPA 1XG5A 3WBFA 2IXBA 4MOWA 3JV7A 2BELA 2PD4A 1B26A 1P45A 2VHWA 4KQXA 4ZGWA 4IDDA 2CSUA 1FDWA 4W4TA 1E1NA 3H9GA 5F1KA 2GZ2A 3LYLA 3MOGA 1D8AA 3EZLA 2C2XA 4LCEA 2VHVA 3GGGA 3WIEA 3C1OA 4QUKA 4MVJA 5BSGA 1EBFA 2AG8A 5KJ6A 5JAZA 3BHJA 2NADA 4PLVA 2D59A 1PJSA 1M2WA 4IQ8A 5JO9A 1LSOA 2O3TA 4L9RA 1CQJA 1DC5A 2WYVA 3OQ6A 1MV8A 4A5OA 2VUTA 5EQFA 2VYND 3BTOA 3F4LA 1JAXA 3VDQA 2VYVA 3FNGA 3H5RA 1LDEA 2CDBA 1DRUA 2Q46A 3D4OA 4RQTA 1KOLA 2NACA 3E18A 1TXGA 3BMNB 1E3JA 1HSOA 2A9FA 3FNFA 1HYHA 3PDJA 5CG1A 5BT9A 4IGEA 4CV3A 2DUWA 1HDYA 4GQAA 3ZWCA 4WNCA 1MGOA 4L75A 2GERA 5JLAA 3SLGA 5A3JA 5GZ1A 2HSDA 3DOJA 3NTOA 5JY1A 2Q4EA 3EAGA 1D4FA 1MC4A 1P1HA 3KYDB 3BTVA 4U6SA 2X1HA 4WK6A 2JFFA 4D0RA 1E1MA 3E6AA 3AFMA 4K1LA 4JGBA 2ZYGA 5H83A 1E6UA 1RJWA 4R9RA 4S3MA 4TRMA 2VNAA 2YY7A 3P5SA 3TNLA 2C5AA 1QLJA 2WSBA 4HV4A 2J3IA 4ZU3A 4XQEA 2CD9A 1YBMA 2P4QA 1EVYA 1O94A 3GVXA 1I2CA 2VWQA 2XXJA 4RVSA 4AICA 2G82A 4E5MA 3JQBC 1SO8A 3FF4A 1E6WA 3LT2A 4TMFA 4A27A 4CMIA 3ADOA 4OAQA 3ROKA 5JC1A 2FZEA 1WDMA 4YAIA 4DQXA 3RC1A 3I3OA 4GBJA 3I9JA 1UXJA 4J7XA 4WCFA 3AOGA 1E7QA 5KIAA 4XRGA 1EE9A 1C3VA 1I3KA 1XCBA 2NSDA 3C7CB 1VJTA 1YDEA 3LC7O 3FBGA 3OJEA 1TT5A 4Z3KA 1IB6A 3R6DA 1JVSA 4JJIA 2UUOA 2ZCUA 3GLQA 4ZHSA 1C0IA 3B1JA 4KDEA 4R1NA 3FD8A 4WLFA 4OXNA 1MB4A 1ULSA 4HNGA 1OFGA 4DYVA 1EVJA 1I3LA 4FFLA 4CV0A 1T1RA 2QYSA 3UCEA 3ZDFA 4ND5A 1L1FA 1R6DA 4IDBA 4WKGA 1ZSVA 4CM1A 2VT3A 1HE3A 2HMSA 3JD1A 4IIUA 3ZH2A 4DRYA 3OHSX 3RI3A 5JCJA 2BF7A 4RPHA 3NDIA 4IPTA 3PHJA 5IF3A 3M1AA 2PKQO 5CDYA 1ZJYA 4Y9DA 4L0QA 4AJPA 3AM4A 4PG7A 2NVUB 3VH3A 4N54A 4DUPA 2E6UX 3OIDA 1NPYA 1BMDA 4I5EA 3OICA 1PJ3A 4OH1A 3WFJA 1PJBA 3IS3A 4NFHA 4CR8A 5CDSA 3QWAA 2C20A 2QX7A 4K6FA 3RBXA 1SAYA 2NLOA 1H9AA 4YRBA 3NT5A 3PYXA 1V3TA 1ISIA 4WEOA 3V2HA 4XJTA 3PPIA 1W0CA 3U62A 5AXBA 2ZCVA 3H8VA 1RM4A 4BB6A 3F6YA 3WLFA 1EQUA 3DHEA 4GWGA 3VVBA 5L53A 1V3VA 2WMDA 2JL1A 4QO7A 1E3IA 3BTSA 3HDJA 4D79A 2IZ1A 4RJTA 3LT0A 3OFSA 1LQUA 4H15A 4OM8A 1JWAB 3IKVA 2Y66A 3QVXA 2C7GA 4GKVA 4TKMA 3W6ZA 1K89A 5T6BA 1SC6A 4OMUA 1V9LA 4J0FA 3KM0A 2VCYA 3PQFA 3M1LA 2BRUA 2VHYA 3C1TA 3DC2A 3VHRA 2ZQYA 1FK8A 3COSA 1R37A 3OBBA 3RQSA 1NFFA 1EK6A 2EP7A 1P1KA 1T2EA 3SC4A 1LSUA 3B6ZA 2G0TA 3GVPA 1C1XB 1KVRA 4YJGA 4MKZA 4NU6A 1BGVA 3KSDO 4MO2A 4CUKA 1WMAA 3H2ZA 1UP4A 1ZMTA 4B4UA 4GX0A 3GG2A 5A05A 2WE8A 4GGPA 1A4IA 4FFPA 3WQRA 2V6GA 3B20A 2ZJ1A 3E82A 9LDBA 1P0CA 3WGYA 1Z75A 3K31A 3DONA 4RPLA 4B7CA 3ROQA 1U3UA 5HBRA 1LSSA 3D0OA 3JQ8A 4BQPA 4E6PA 1AE1A 5KJCA 1GY8A 1O6ZA 2EJVA 3U4IA 1HTBA 3RJ5A 3X2EA 2CVOA 1EQ2A 1U3TA 4BS9A 5A4DA 3L6DA 3WMXA 2NU7A 3WJ7A 4Q3DA 4Y6PA 4YJFB 3ZHBA 2GPTA 2HLPA 4K6CA 4WJZA 1GDHA 4TQGA 1DFHA 1J4AA 3Q0EA 3FI9A 5DT9A 1RKXA 2GSDA 3BMQA 2CUKA 3LF2A 4NDNE 3GA0A 5EL0A 4F46A 1Q0QA 4OGWA 1VE9A 1A9YA 3CPSA 4KDFA 4ZQFA 4WCDA 2X9GA 4R01A 3HG7A 1PU2A 1TB4A 2VTDA 4OHUA 3JQAD 4A26A 3ON5A 4ALIA 1YJ8A 2SCUA 3GMSA 2ZQZA 4CL3A 2CDAA 3JQAB 1CDOA 3WSWA 2V6MA 3K2EA 1QSGA 4KOAA 4RZHA 1M66A 3N7UA 1R0KA 1XSEA 1FDUA 3AM5A 2G76A 3IJRA 1UXHA 1SB8A 5BSHA 4WLOA 4XB1A 2EXXA 2GNAA 5IXYA 1H2BA 1IPFA 4TWRA 2NNLD 2EV9A 3UVEA 3VKVA 4FJ2A 3NJ4A 5HS4A 2JJYA 2EF1A 5TQVA 4ZVVA 4ZN6A 3P2OA 3PWKA 4RL6A 2HMWA 3UW3A 3ONFA 4TKLA 1WZEA 4CM6A 4ESOA 2BFAA 2D0IA 3WR5A 2DFVA 3VTFA 4WCFB 3VDRA 2EGGA 4UEJA 2Y1OA 1YONA 2WE7A 2YHUA 1BDBA 2D5AA 3PVZA 3CZMA 1F8FA 3V2UA 4CV2A 2B0JA 5TC4A 5ILGA 1H2HA 3WOHA 4P8RA 2Y93A 4O1MA 1N2SA 1WZIA 4YYZA 2ZYAA 5DP1A 1TT5B 3VOSA 4ALNA 1DIGA 5C37A 4I9UA 3Q9UA 4YXFA 3GDFA 4Y98A 5KOIA 1FDSA 3TWOA 3B1KA 5F5NA 3T7EA 1DIBA 2J5QA 3QE3A 1GZ3A 1H9BA 3NYWA 3DEYX 3GF4A 2E48A 1BRMA 2E4AA 3TJRA 5U9CA 3ZWBA 2B5WA 1MLDA 1ISHA 1TA4A 4L76A 4J9UE 1G0NA 1YL5A 2OP0A 3GRKA 1CWUA 4KWHA 3K73O 1E7WA 4NBRA 1IE3A 4YAKA 3MJTA 3RUIA 4CMBA 4BNWA 4J1TA 4NR0A 3OM9A 2Q1WA 1DPGA 3QHAA 2V6FA 1LLUA 1D1SA 2DFDA 1P1FA 1XHLA 4BHTA 3HDYA 1LDYA 4FS3A 3WQQA 5COAA 3UCXA 4R3WA 1HYGA 1ENPA 3PFFA 2AW5A 1TT7A 1J0XO 1D3AA 1E1LA 3ZWNA 4BGIA 2PKQP 5IXSA 1M76A 1EFLA 3HB4X 4NBWA 4E33A 7ADHA 3P2YA 2ZJ0A 1F0YA 4ALLA 5DCUA 1P1RA 1ZO8A 4JJGA 1B7GO 1QYWA 3I4FA 1R15A 1EK5A 5CDUA 5KTKA 3VAZA 1XIVA 1JDJA 3W6UA 3JQ9C 4D3SA 4BMSA 3D5QA 1SB9A 4G2NA 1V6AA 3STHA 4DXHA 2ZATA 3DWFA 1RYEA 1NWHA 4IIVA 4BIIA 3NEPX 1SOWA 2ZIZA 3HFSA 4IS3A 4BNKA 3GGPA 4FDAA 4E21A 1BXGB 3DBHA 3JQCA 1V8BA 1VC2A 4D45A 1GU7A 2BHLA 3G3EA 2GYYA 2CZCA 5JDCC 3EVNA 2I6TA 3JQ7A 4AJJA 3Q11A 1IHXA 3F1LA 4BKOA 9LDTA 4HWKA 2Y67A 4U0KA 3PJFA 1GV0A 5F21A 4BUCA 5I9MA 3INRA 4R9SA 1C14A 2DQ4A 4U5QA 1GUYA 3O38A 5CPBA 3AU8A 1H6AA 2PY6A 5TGDA 1YB1A 4XB2A 2JFHA 4J91A 3KUXA 3OA2A 5KVQA 1BW9A 4RF4A 1AHHA 2FPIA 3FWZA 2WM3A 3WSVA 4D3FA 1VSUA 5A02A 4K28A 4GSLA 4BO1A 3TSCA 1ML3A 1XGKA 1Q0HA 2FSSA 2D3TA 3IP1A 1Y5MA 4C4OA 1PX0A 1I3MA 5HS6A 1X0XA 4UREA 4LRSB 5I7SA 1GUFA 5B4TA 1B3BA 5A9TA 3W8EA 4UUMA 5FFFA 3ETEA 3IIEA 4YA6A 4GGOA 1ZSYA 1B8PA 4UULA 1NVGA 4XZ3A 2P9GA 4ONEA 5CFZA 4EEXA 5IDXA 5L3ZA 5FI5A 4J7CA 1BDMA 4DGSA 3FRJA 4Q3NA 1B2LA 2JAHA 1Z73A 3ZGYA 2PFGA 4BKQA 2YV1A 5A06A 4KTTE 4PRLA 4U6QA 4BKUA 4DWVA 4EGFA 4CQMA 4AFNA 1R16A 2DU8A 2CNBA 3FTNA 3KZVA 1SZJG 3DOOA 1B14A 3DMTA 3WX0A 3FNHA 3JD3A 4F45A 4FC7A 3HSKA 1K2WA 2HDHA 1PSDA 4BO5A 2Q45A 4CM8A 4FFRA 3OF2A 3L6OO 3C7AA 1UZMA 2E82A 3ANNA 4URFA 3V1TC 1GCOA 2AQHA 5CEFA 4TVBA 3OJ0A 1NQAO 2OBYA 1UP6A 1YWGO 2ET6A 3TFQA 4CM4A 3S2EA 5I9LA 4E5KA 1NFQA 2HRZA 2VWHA 4R51A 4EITA 1VLLA 4BNJA 1I8TA 3E48A 3OP4A 2CF6A 1DFIA 1PJLA 2CVZA 2PZKA 2Y1DA 3H65A 3KVOA 4RVGA 3RFVA 3DBRA 4NIMA 4INAA 4I5GA 2HK8A 3RJ9A 4BNIA 5A5FA 2V6BA 4YTEA 3SXPA 1ZKMA 4XIYA 1ZZEA 4FGSA 3LU1A 3JYQA 1LLCA 3H9QA 4BV9A 3OQ1A 3QY9A 2YUTA 3OEYA 5EERA 4BO9A 4DL9A 3GZNA 2HMVA 5TLSA 2P5YA 2GD1O 3JQ6A 2Q99A 1GADO 2X5OA 3L0DA 3JQDA 3ZZNA 2P4HX 3RUEA 4BNHA 1KS9A 2GDZA 4FR5A 4JXKA 1U8XX 4ZQGA 1R12A 2B35A 3Q2IA 1U8FO 5HM8A 2VWGA 4HXYA 3GAZA 1HZJA 2GZ1A 5CAEA 1ZH8A 1PJ2A 5CHEA 4YEDA 5KJFA 4DYDA 1T26A 2VRCD 4E3ZA 3JD0A 1VPDA 1G0OA 3QSGA 2EWMA 2ZKLA 3MEQA 4KMSA 1NPDA 2DBQA 5T57A 1PJ4A 2O7QA 1Q7GA 1ULUA 4BNNA 3U5TA 5DBFA 2DC1A 1LDGA 3DZKA 1GQQA 4BNTA 5H81A 2GGSA 3DHYA 1YGYA 1I2BA 1FMCA 4I08A 4IQGA 3VH4A 1U7TA 3C1AA 4ID9A 4ND4A 4PLGA 3Q2KA 5TJHA 4CM9A 5JFOA 3ZV5A 3BMOA 2P9EA 4IJVA 4CPDA 1CJCA 4O63O 4OIMA 1TEHA 1NQOA 4YJHA 3EW7A 1W6UA 3T7CA 4EJ0A 2JD1A 4YQZA 4YT5A 4NG5A 4GX1A 3DQPA 4M87A 3RD5A 1EDOA 1EUDA 4K26A 3DOCA 3AK4A 3ST7A 2AQKA 3H5AA 3E8XA 2TMGA 4J6FA 1PS0A 4WOJA 2YHIB 3GFBA 4BL5A 1Y7TA 1ZMOA 2LDXA 3M6IA 2RCYA 4GVXA 1C0KA 1OAAA 4W82A 4IDCA 2DVMA 3M2PA 1JVBA 2W2LA 2G1UA 4M8SA 4D7AA 2VNSA 3AUUA 4YJDA 1UDBA 3I9NA 2VZ8A 3ZV6A 3DBHB 3Q6IA 1Z7EA 2EERA 2FZWA 1GYQA 1EFKA 1GZ6A 3JQ7B 4FIZA 3OIFA 2Y0DA 1HSZA 4JBIA 3RIHA 3WTCA 5A1TA 5AYVA 3KYCB 1U3WA 3FPLA 3O4RA 3ASUA 1SEVA 4XYMA 1DFGA 3ONEA 4NK4A 5C7IO 1F8GA 1T4BA 3OH8A 3ZW9A 3FR7A 4CLRA 5JAMA 1P31A 5TS3A 1UAGA 2FN7A 5CDTA 2Q2QA 1K5HA 2EHDA 1U4SA 4PZEA 4ZJUA 4HX5A 3QVSA 4J43A 4E2WA 2NTJA 1GUZA 1E3EA 4EEZA 5COQA 3JD4A 2VQ3A 3GUYA 4J2OA 5L95A 5TT1A 1T2DA 3FTPA 1YOVA 4MVJG 1PIWA 1N9GA 3JQBA 1I2ZA 1I5RA 2O3JA 1JKIA 4H7PA 4HNHA 3JQGB 1DIAA 1MP0A 4XYLA 3HJAA 3CIFA 5LDGA 1VJ0A 2Z1NA 3KO8A 4LVCA 4EI2A 1HDRA 4YWJA 2I66A 4RORA 4BOYA 3OSUA 3AUAA 1DB3A 4BMNA 3KV3O 1DIHA 4PLPA 4DBZA 3ZWPA 4XCVA 5C7OO 2C5EA 4CMCA 1VKOA 3HHPA 1ZIDA 4RF3A 1WW8A 4CQMB 2DTEA 1ARZA 4IXWA 1N7HA 1YRLA 2AEJA 1NXQA 2O3QA 3JQFC 1KERA 4R54A 3DR3A 3V8BA 1C0PA 2QQ5A 3DZGA 1ID1A 4CM8B 2XXBA 4UUPA 3IDSA 4IZHA 1E0DA 1H0KA 4KZPA 3SLKA 4E31A 4GSKA 3HDHA 1UXGA 1YH3A 2WJPA 5KKAA 1PZGA 2J5RA 4KTVE 5U4QA 5BSEA 4CM4B 4CODB 1PQWA 1F17A 2JCYA 2GF2A 3JYNA 4FW8A 4Z0TA 4B7UA 3AW9A 3P19A 4EYEA 3U9LA 2JKVA 3GC6A 4Z3DA 4BNFA 1LA2A 3AI2A 3DBRB 2C07A 5JCXA 1U1IA 4P38A 2BFMA 1E7RA 4M1QA 4NJMB 5GMOA 3JYOA 2C59A 1LUAA 2IDZA 4L4XA 5JO0A 1PGPA 3RUHA 4PVDA 1ENZA 2ZB8A 4UVHA 5B37A 3HN2A 3GPIA 4IMRA 3ZV4A 3LZ6A 1QXSA 1MA0A 5L51A 3F5QA 1WLYA 4GAEA 1O0SA 1W8DA 3HQ4O 3D3WB 4PLFA 3QWFA 4K9DA 1ADCA 3TZKA 4WLEA 4DQUA 1XYGA 4DPMA 2QRLA 3K9QO 5IDYA 1UZNA 2OGUA 3B70A 3FPCA 4FFOA 2Y1EA 3GAFA 3ULKA 3PYMA 3O03A 1E5LA 2I9PA 2O50A 3L4BA 3WTBA 1P3DA 3K92A 2GCGA 1A5ZA 2PH3A 1IULA 4IM7A 3GFGA 4J1QA 2PTGA 4F3YA 1FJHA 2P91A 2QZ9A 4ND3A 3MJCA 3GNTA 3IQDB 3UFXA 1X0VA 3CMMA 5G4KA 1R4MA 5AOVA 2DT5A 2RBEA 3JCZA 5LCXA 4DC0A 1K6IA 2VZ0A 1DRVA 1B0AA 1O8CA 2BGLA 3ANLA 3PHGA 4TRRA 1PJQA 2AMFA 1KC1A 3I52A 5DCYA 3UCFA 1BWSA 2HJSA 5DCWA 4PN3A 1ISJA 2Y05A 4BV8A 4E5NA 3ZWVA 4XYEA 1B16A 4XDZA 4XEHA 4AG3A 4WLVA 5G4LA 1KEVA 1PZFA 3ICCA 4CM5A 4S1VA 5KWEA 4BNYA 4DPKA 2GUGA 1O95A 4OXYA 4C7KA 4W7IA 5FWNA 1T1SA 4OSPA 1LRLA 1SOVA 4QSMA 1PJTA 3SJ7A 3UH1A 1K6XA 3VZQA 3UAGA 4FCCA 2VTEA 3WGZA 2DBZA 2X4GA 3ITDA 4D3DA 4BKPA 4AL4A 1Y8RA 1P74A 5TSDA 2C7VA 1TI7A 3QWIA 1H6CA 2HO5A 3NX4A 4QO8A 1CERA 5A03A 2C2YA 1XELA 1OC4A 2QYTA 4WOKA 1QORA 3RU7A 4Y8VA 4WUVA 2J6IA 3I23A 1NPTO 1DC4A 4RVFA 4Z0HO 1SEPA 4AJLA 3EZYA 3D4NA 1KVTA 3ICPA 4YRAA 5JMPA 4QX6A 1DBVO 1JWBB 3L4BC 2PGDA 3KXDA 4QECA 4XWYA 2H63A 3C7DB 1QG6A 4YVFA 5K0ZA 1UAYA 4HP8A 3QW2A 4CLRB 1X7HA 3TZHA 3BIOA 4DA9A 3VH1A 3FHLA 1E7YA 3F3SA 4B4WA 5GY7A 3W8DA 2BI8A 3OETA 3R3SA 1DEHA 4BO4A 2P5UA 1YL6A 1BHSA 5L7TA 2RH8A 2O4UX 1R0SA 2V7PA 3NT4A 4L73A 2FRDA 4AJ2A 4YCAA 2X0IA 5THKA 4F6LA 1IUKA 1X7GA 2WYWA 3ZNQA 1YOVB 5AQ1A 3O8QA 2HKIA 1YDWA 3H2SA 1R66A 1LC3A 2FR0A 3H9JA 4CMJA 5KVSA 3PQEA 1N9GB 5TRTA 3VVCA 3K5PA 4J4BA 1P77A 1A9ZA 3D1LA 3CEAA 3JD2A 1GYRA 4BNUA 3LLVA 3TOXA 4MVJD 4MVJI 4N5NA 4ND2A 5F1PA 3TRIA 3PLNA 1GZ4A 1DRWA 4HY3A 1KEWA 4JN6B 1NNUA 1VSVA 1F12A 3QV1A 4GI2A 4IJUA 3RC7A 2VYVD 4CL8A 4F6CA 3GY0A 2GN8A 3GDGA 1HE2A 1GR0A 4II3A 4PLZA 3G1TA 4MVJM 4BGVA 4BO6A 4ND1A 1KY5A 1PL7A 1LC0A 2C82A 3F46A 3RC9A 2FOIA 3PLRA 2QHXA 4M55A 3OJOA 4NFSA 2BGMA 4NBTA 4PIVA 4OKNA 3LQFA 3KHUA 3RROA 4D0SA 1E3SA 4WLNA 4CLOA 3TL3A 3D5TA 2OL4A 4FN4A 1ENOA 4XIJA 1QYXA 4JCOA 2HCTA 3PWZA 5EN4A 4RVUA 3CZRA 2RHRA 4E2XA 1MUUA 2RH4A 3GHYA 4YT2A 4GL4A 4JROA 1H6BA 1YQDA 3CXRA 4U8GA 2I65A 1NHGA 1PQUA 5TF4A 4PGFA 3W8FA 4J16A 3AY7A 2Y99A 1BSVA 4CMEC 2IE0A 2VRBA 4QFCA 3TZ6A 1RM0A 3GEGA 5AVOA 1SCUA 4WECA 5CP8A 3LF1A 2VZ9A 3DXFA 3ZU5A 5DZSA 4PZDA 4LSMA 4UEKA 4A2CA 4BNZA 3WQSB 5JSFA 1OZAA 3L4SO 2NU6A 3ZWAA 3TFOA 1EZ4A 4CMIB 5JXWA 1PZEA 2EW2A 5I9NA 3BHIA 2PKRA 4GKBA 4PG5A 1LEHA 2GRAA 4BGUA 1HEUA 4IGFA 4FBGA 2AE2A 3JQ9A 4B8WA 3EC7A 5ADHA 1IL0A 4G81A 4I5FA 2GR9A 4O6VA 3AWDA 1UR5A 3EDMA 3WFIA 5ITWA 1LX6A 1WDKA 1CRWG 1X7DA 3WXBA 1V35A 1VL8A 5BQFA 5JDCA 4XQCA 1DC3A 2UVDA 3GVIA 3KETA 2UDPA 1EUCA 1N8KA 1P1IA 2DM6A 4GX5A 1LRKA 2BLLA 1LTHR 2DLDA 3EYWA 4JK3A 3U3XA 5CDGA 4PCVA 3S2GA 4OSOA 4XJSA 4Z9YA 3H4VA 1FF9A 3DAGA 5JCJD 3WGQA 4IUYA 2Z95A 3GNQA 3ZU4A 3H6KA 5G4KB 1N7GA 2EKQA 1ZK1A 2PD6A 2ZB7A 3WNQA 1F14A 1JKJA 3PK0A 1GV1A 3UHAA 4RV9A 4YDRA 1NVTA 1I33A 4IDEA 4LGVA 7MDHA 2X7HA 3ANMA 3WGTA 3GHHA 3IMFA 1JU9A 3EGOA 3FBTA 1I3NA 4MIEA 5IFLA 1P33A 3KRTA 1MX3A 4TZKA 2CMDA 4AJ4A 2AA3A 1ZFNA 5KVCA 3MTGA 4IJKA 2PLAA 4OQYA 1Y5RA 4Q9NA 3ZCXA 3HUDA 4N7RA 4DMMA 4D43A 4WGGA 2YDYA 3D64A 4XQGA 3GOHA 4AJ1A 4KUEA 4L8VA 2A94A 1I24A 2JCVA 4Z9FA 5CG2A 2IRWA 8LDHA 1U2DA 4LSWA 1Y8RB 3WLEA 2BMAA 2JCXA 3AOEA 1JW9B 1E3LA 2DTDA 3KTDA 2Q2WA 3PXXA 2V65A 3C3XA 5ENVA 3IJPA 4YACA 5KKCA 3RKUA 4ROSA 5IAAA 3GT0A 5LDHA 5G2OA 4CQLA 3S1LA 3GDOA 1HDXA 1ZCJA 4BB5A 4LCJA 1N1GA 4DPLA 4CMAA 5HTOA 4PLYA 3OIGA 4UAGA 1J6UA 3E9MA 3OJLA 4RZIA 3PIDA 1PGQA 1OOEA 4DIOA 2PGJA 1U5AA 2QRKA 4HFNA 1MFZA 4KQWA 1ENYA 1U9JA 5H82A 4Z6KA 4NQZA 4WLUA 1C1DA 2D4AA 3N58A 2X58A 4LVUA 2OZPA 4DLLA 4E13A 3I1JA 3T4EA 1OC2A 3VPHA 4LMPA 1EVZA 2Q49A 1LDNA 4YJGB 1DLJA 4DTIA 3HN7A 4XX0A 3QP9A 3Q1LA 3EVTA 1IOLA 4MVJP 3UUWA 1UZLA 2YYYA 4TRNA 4RPJA 3K30A 3TZQA 3WDSA 3DBLA 2PWZA 4JQCA 5EESA 3S2FA 2JD2A 3UICA 4M89A 3CE6A 1OI7A 1V0JA 3IC5A 3HFGA 4J4HA 3PJEA 3JQ8B 5DN9A 3WGGA 2X23A 3E1KA 1XU9A 1WDLA 5IN4A 3EHEA 1JQBA 1K6JA 3HWRA 3NTRA 4HFRA 3PHLA 2J3JA 3DL2A 5EIOA 2FR1A 3ENKA 4JLWA 5AXAA 1XU7A 4X54A 1KETA 5DNAA 1S6YA 4CM3A 4MVJF 1HLDA 5ES3A 1ZW1A 1ADBA 3AOEC 3QVOA 2CFCA 2BD0A 3MWEB 3PJDA 4IJWA 3PYLA 1Y81A 4MINA 3NDRA 3WBBA 1TVEA 1HT0A 3U0BA 3V1YA 3BMQB 1U5CA 6LDHA 5L4NA 2X86A 2Q1TA 1DSSG 1HKUA 3V2GA 5F1OA 4WASA 3DZHA 3RBVA 3GEDA 3QVWA 3BAZA 5DBGA 1GFSA 1WAMA 3U49A 1PGOA 5L9AA 4J0EA 2WDZA 2IEDA 3G1UA 4RLHA 1P1JA 3UF0A 2P68A 2FPGA 3QVTA 4D41A 3PEFA 3KBOA 3RAJA 2EGHA 1Z6ZA 3G79A 4R68A 1XKQA 2XF8A 3PTZA 4CR6A 3VZPA 2OBNA 4FPXA 3VZSA 1CQIA 1I36A 4ZA2A 3CSDA 3DMYA 1DJQA 5JDIC 1LDMA 2VYNA 3DHNA 3GPDG 4L4SA 2Y0CA 2H9IA 3BMNA 4RQUA 1DO8A 2VOJA 4J7UA 4JIGA 5L4LA 5IZCA 4YAGA 2OMEA 4JNKA 2W4QA 1ZXLA 4JP3A 2B37A 1ONNA 4E5PA 4E0BA 2JFGA 3A14A 2PD3A 3QRWA 3WYCA 2BKAA 3GN2A 3E5MA 3ZWOA 4ZQEA 3KLMX 4EBFA 3FCOA 4BNXA 1EE2A 2NU9A 5DF1A 5G0UA 1DDOA 2JD0A 4U7WA 3BHMA 2O23A 5DOVA 1ZNQO 4ZQHA 4BO2A 2H6EA 4MPDA 3IUPA 4PZCA 3ENNA 3I9MA 2GN6A 1XDWA 2ZB4A 5JE8A 4IY1A 4D44A 5K6AC 4MDHA 2R6JA 4G5HA 4P4GA 4R1UA 4LN1A 1BVRA 4RDHA 4XD2A 4RO0A 2I76A 1U2GA 3LLSA 3O26A 4EUHA 3DZJA 3ETDA 2DKNA 3GZ4A 1B8VA 3TQHA 4O5OA 4PLHA 3L07A 1Y6JA 3K96A 4WPGA 1YJQA 3GVCA 1OMOA 3P7MA 2NVWA 2ZTLA 3UN1A 2FSVA 2IYOA 4Y67A 1AGNA 2RIRA 4I5DA 3RUDA 3WS7A 3MCVA 3IUSA 4CLDA 2FR8A 3H7AA 4E2YA 1ORRA 5FI3A 3S8MA 3GMDA 3ONDA 1PQPA 2HRBA 2I99A 4U0JA 1L7EA 4YT4A 1Y8QA 5B1YA 4P22A 4UEOA 3ZNNA 1CIVA 2D2IA 3MJEA 2NM0A 5IZCC 5AXCA 3U4DA 3RBZA 1VKNA 3NAQA 4PG6A 3ZU3A 4E4YA 4QQRA 5ER9A 3VH2A 5MDHA 3JTMA 3PGXA 2B5VA 2HMUA 3AFNA 2POQX 1I32A 1EBUA 5COBA 5DULA 4A73A 5L40A 5K9ZA 2AHRA 2DBVO 3AM3A 1QKIA 2NVUA 4AJEA 1NQ5A 2WWRA 1GEGA 4UUOA 2YFQA 2YQ5A 2FHSA 4CQLB 3ZHYA 3I4CA 5G0SA 1E6EA 3JQFA 3B1FA 4YRDA 4FC6A 4IXTA 4UVGA 1NX6A 1I0ZA 3M2TA 4J90A 3W4JA 1WP4A 2O2YA 4FOSA 2QIOA 3R1IA 5ER6A 4NU5A 5C3MA 1C1DB 4XR4A 4XRRA 4DVJA 1NYTA 4ILKA 4B4VA 1XQ1A 4CLXA 2X0RA 3AI1A 1ZBQA 2X9VA 4B3HA 2DPHA 4MVJE 3WGOA 2B36A 3I6QA 3LC1O 1LU9A 1JA9A 3DZBA 2O3SA 1JKFA 1WVGA 4WEQA 1PWZA 1HRDA 3DO5A 4L4RA 1BW9B 1U4OA 1ZK4A 1IHYA 5JYEA 4JBHA 3DBVO 5KJ1A 4NBVA 2J8ZA 3RUFA 1MXHA 1E77A 3BTUA 4UVIA 1J5PA 2A92A 4GH5A 5JYDA 3IAHA 3ZWMA 4J3FA 5I7FA 2O3UA 4TROA 2PNFA 1D1TA 3W1VA 3AI3A 1C1XA 4XGNA 1WMBA 1H94A 3QIVA 3PJGA 1FDTA 1ZEMA 2GZ3A 3UGKA 4NPCA 3ZI0A 3MJVA 1MG0A 1EEHA 3WIDA 4KWIA 1ZK3A 1CF2O 2WD8A 5TX7A 2NWQA 1L7DA 1T2CA 4B3IA 1YVEI 1TLTA 2BH9A 3GEMA 5ILOA 1HE5A 2YV3A 5LC1A 4FB5A 3E03A 1PTJA 4CQMD 3KB6A 5EQDA 3X2FA 2B69A 1CETA 4R5HA 1Z74A 2QG4A 1HYEA 2NVBA 3NGXA 2YJZA 4NH4A 1PGNA 2WD7A 1W73A 4BO7A 4XA8A 4UVDA 1BVUA 3TF5A 3PIIA 4DQVA 3EUWA 3OECA 4BNLA 1A27A 1N5DA 3ROPA 4RLSA 1T2FA 1KVUA 3WGIA 3A06A 1B15A 2R2GA 3Q9NA 4I8XA 3UOGA 3SEFA 5JNLA 1DOHA 4QT0A 3WWZA 4EUEA 4YJFA 4CUJA 3CKYA 5JMWA 1XQ6A 1HWYA 2GN9A 4RF2A 4BKRA 2VHZA 3H3JA 3GUCA 3U09A 4BGEA 1V3UA 1UH5A 3RU9A 3PDUA 3F1KA 3IKTA 2B4QA 5BSFA 2JAPA 5GZ3A 4R1SA 3TPCA 1VI2A 4YT8A 2ILTA 4OJNA 3C24A 1Z82A 3NJ8A 3ZWYA 2Y1GA 4YQYA 1IY8A 3EY4A 2VT2A 2PV7A 1GPDG 5GZ6A 4AJNA 2EKPA 3D7LA 1ONOA 1AXEA 3VPGA 2PGLA 3H5NA 3QWHA 2C0CA 2B4RO 4N5LA 2A35A 1G1AA 2PZMA 3PZRA 2X8LA 3GZNB 5IN5A 3V5NA 4DC1A 4GLOA 5L7WA 3JQAA 4ZD6A 3C8MA 2WEKA 5JY6A 1GD1O 3LT1A 4I1IA 4NMHA 2ZTVA 1GEEA 4OO3A 3VZRA 1PR3A 1NP3A 1BG6A 3GNSA 2HJRA 3OA0A 4RPKA 5BNIA 1GAEO 2O48X 1RM3A 3VPXA 2DTXA 3QJ5A 5CPFA 1GTMA 4B79A 4QTZA 5HRUA 4N5MA 1A4UA 1ISFA 1K3TA 3TZCA 4II2A 3O9ZA 2Y68A 1T2AA 3E9QA 1MG5A 2J3HA 1KYQA 5AXDA 3HNPA 4M49A 1QLHA 4RGBA 5KJEA 3KEOA 5I8ZA 4H16A 3BYZA 3SJUA 4CM9D 4W6ZA 2HU2A 1A7AA 3WWYA 1UDAA 1UXKA 1U28A 4E2ZA 1X1TA 1T24A 5F3RA 3H3FA 1BTOA 2PK3A 3F4BA 1EUZA 3BMOB 5FF9A 1LLQA 3G49A 1LNQA 2NV6A 4YPOA 1R0LA 4R3NA 1Y8QB 2VN8A 2C29D 4I9HA 4YJHB 4P4NA 1F06A 2F00A 2YZ7A 2TMDA 4HUJA 2Z1MA 1NR7A 3ROMA 5B12A 2A4KA 3INGA 1JTVA 4EJ6A 2D1YA 1YO6A 2DAPA 4WNIA 4Y6RA 2CF5A 3D4PA 1KEUA 5JS6A 3DB2A 4MKRA 5BR7A 2W2LD 4R5MA 4FOOA 4YBZA 3CUKA 4D42A 4IQ0A 2GASA 1M6HA 5G0WA 1Z7BA 3SC6A 5ITVA 4Z9XA 5JBIA 2Q1SA 4R16A 3W4KA 3K8ZA 5JAQA 4R4JA 1DIRA 1EMDA 1MC5A 1SNYA 4OKIA 4TSKA 4A7PA 1HDGO 2JHGA 1NAHA 1Z45A 2G17A 1XLTA 4B3JA 5HWSA 3SVTA 4MIOA 1AN9A 1YB4A 3W4IA 3RASA 3WGHA 4YR9A 4ZICA 5FYDA 2WTBA 4IINA 2I67A 1E5QA 2HQ1A 5T64A 3WG9A 4HBGA 5JW6A 1KBZA 2XOXA 5A9SA 4BNGA 1HL3A 2H1SA 4WCFC 3UKOA 1KIFA 2RHCA 2I3AA 3DAFA 3IL2A 2HK9A 4FSHA 3E9NA 1GL3A 2AEMA 2CDCA 1BXGA 1NTOA 3DFZA 2CY0A 3PHHA 1T4DA 1I30A 1UXIA 1DHRA 5C7LO 4RDIA 4W99A 4M54A 4CMEA 2NTVA 3ZN2A 2ZTUA 1PS8A 2OFPA 1BXZA 1YE3A 2VHXA 4XQ9A 3BMCA 3ZNOA 3D3EA 3HE3A 5G0VA 3GQVA 4NK5A 2W90A 2O4CA 1Q0LA 3MZ0A 2EP5A 3QA9A 2VUSA 3JSAA 1M75A 3INTA 1A7KA 4KUHA 1AUPA 2VUUA 3ZV3A 2W2KA 1LLDA 2ZK7A 4BO8A 1NAIA 3PQDA 3U4CA 1CEQA 4FQ8A 2J5KA 5L7YA 1GPJA 1ZVMA 5MGBA 1EDZA 3H9UA 2WD7B 3ADPA 1O89A 2YFHA 4RVDA 2I3GA 1SMKA 1HDZA 4BNVA 3HADA 1X1EA 1BXKA 4JP2A 4Q3EA 1NFRA 1UJMA 2RAFA 3PHIA 2Y1CA 1Q7BA 3RSHA 4H3VA 4OXKA 3PZBA 1B3RA 3CH6A 1U7HA 3JYPA 1C0LA 1P9LA 3PRJA 1QV6A 5U1PA 3HDQA 2PR2A 2HAEA 2BI7A 1JN0A 2JHFA 4MIYA 5A3VA 1W4ZA 3ZWWA 1HE4A 2P9CA 1ADFA 1CYDA 1RM5A 4Q39A 1YL7A 4J1SA 3FSRA 2O3RA 4MP6A 2VWPA 4CMHA 1A72A 1PL8A 2W98A 3LSYA 1B8UA 3RFTA 1E7MA 3G17A 5FEUA 1YKFA 4YAJA 4CM7A 4FGWA 1HETA 5ICMA 3NDJA 1LSJA 1PR9A 4CLEA 2NQ8A 2X5JO 3MJ4A 3F9IA 2FMUA 5IG2A 1FXSA 1ISGA 1IYZA 3MOIA 3PP8A 4A03A 1ZEJA 3WJAA 3DTYA 1LXCA 4QEDA 2IXAA 4R1TA 2AQ8A 4NFYA 3WYBA 1HF3A 2IZZA 3NTQA 4PG8A 3LT4A 5JC8A 2X0NA 3PI7A 2X5KO 1E3WA 1XWFA 5KCZA 3OEWA 1KC3A 1JAYA 2IEBA 4IZIA 4PFJA 4EJMA 1DAOA 3DZFA 1PZHA 1ZXBA 2X6TA 2EG9A 2PA3A 2ZTMA 5I7VA 3KEQA 1IZ9A 3ZU2A 4DBVO 4DLAA 2CVQA 3TDKA 5J23A 4FFNA 3A4VA 4P4LA 1I01A 1ZJZA 2NQTA 3ZW8A 1E92A 1ZK2A 4NZ9A 3IP3A 1JLLA 2FY8A 3GN1A 4NJOA 4J2HA 2H5LA 3NRCA 1H5QA 2DPGA 1R4MB 4PVCA 1OBFO 4J4TA 4IDFA 4HFJA 5A5EA 1KEPA 4LW8A 1ZK0A 3DAPA 1GQ2A 1HDOA 2GO1A 4BVAA 2EKLA 3C85A 1X15A 1ONPA 1MXFA 3K6JA 1WNTA 5TNXA 4IDGA 3WNVA 3GGOA 2OOSA 4R69A 4O0LA 4RVHA 5B4VA 1HDCA 1U3VA 2WYUA 1RPNA 4NI5A 1PL6A 4PRKA 1QYDA 3TL2A 3KOUA 2VRCA 2ZYDA 4RF5A 3TOZA 4ZQBA 4PLWA 4G65A 3GH3A 2FPPA 2Q50A 5EINA 3AY3A 4WE3A 1N1EA 5HA5A 1RWBA 4Z0PA 4IDAA 1KVSA 3ABIA 4AVYA 3U4HA 3RUAA 4FD3A 5DOZA 4GPD1 4OQZA 4NBUA 1KVQA 3DDNA 3I5MA 1DAPA 4RCVA 1A71A 1HLPA 5B4UA 5EMHA 4E12A 2EJWA 1UUFA 3CTMA 2HUNA 1AHIA 2GN4A 1Y9EA 4A0SA 1R4NA 4GMFA 4HADA 2OXIA 1ISMA 1QMGA 1YS4A 1LJ8A 3MJSA 3KLPX 1AXGA 5JAIA 4NNJA 4LMRA 3WB9A 2BFOA 4LISA 2YHIA 2C54A 5A9SB 2QZZA 4DMLA 4O59O 4A10A 3QLJA 5TT0A 1QR6A 4XR9A 5I8WA 2Q2VA 3JYLA 4CMGA 2X9NA 5JDIA 4XGKA 5F5LA 3GK3A 1DLIA 4HKTA 4CR7A 3PGJA 5CEJA 3NT2A 4W7HA 2ZB3A 4Q3CA 4OL9A 1DJNA 3O8QB 1VL6A 3PWSA 1QYVA 2EIHA 4MP3A 1PGJA 4OYRA 4QXMA 3K2BA 2P2SA 3GVHA 3KYCA 1YQXA 3SX2A 3BMCB 3RCBA 3I83A 8ADHA 1FDVA 1QP8A 2F1KA 4UVEA 1GYPA 3VTZA 4CV1A 3LDHA 1YBAA 2R00A 3L77A 2XPCA 1YBVA 3ZHZA 4XDYA 2W2KB 4B7XA 4E30A 1DXYA 3FNEA 4QFDA 4J49A 2O7SA 2Q3EA 2YDXA 1X13A 1Q2XA 4KUGA 3EK2A 3A1NA 3A28A 4J1NA 5A04A 2PH5A 5K6AA 1PJCA 1X14A 3EMKA 3FR8A 4FJ1A 5DBIA 4CJXA 3QQPA 4OOFA 3OMLA 5KNLA 2UYYA 4MP8A 3KSZO 5BNFA 2O2SA 4YB8A 3NKLA 3VKUA 1SPXA 1ADGA 1YQGA 2Q1UA 3JQGA 2UUPA 4EW6A 1QRRA 1WWKA 3RWBA 5L45A 2GLXA 2AG5A 1HXHA 1J49A 3ETGA 1RYDA 3OQBA 3LVFO 3NV9A 4BO0A 1O5IA 1ZSNA 1NM5A 2I5PO 4CLOB 4BO3A 5A9RA 1Y1PA 4DREA 4BNMA 3WICA 4IBOA 1Q1NA 1XEAA 2X0JA 1DC6A 1M6WA 2BFPA 3BXXA 5BNTA 4FJ0A 3ASVA 4OOEA 1N92A 1XR3A 3ITKA 3G0OA 1DHTA 4TRJA 3BA1A 3GG9A 1VRWA 4AJHA 1GQYA 1K0UA 4LK3A 3IOYA 5EPOA 2Y0EA 3BZUA 4ZRMA 3N74A 3ORFA 4EDFA 4KP7A 4ALMA 2BGKA 4CUZA 1LI4A 1EVIA 4LRTB 5IJZA 4TZTA
chains in the Genus database with same CATH superfamily
5JQGB 2HL6A 1T9KA 3EXG2 3KPWA 3P2JA 1C8LA 3WRWA 1QP7A 1G6Q1 1IIBA 3IAEA 3AIIA 5JAPA 2DBRA 2EW8A 3FN4A 5DKFA 1LGYA 1Z25A 5FAXA 1NV8A 3P96A 1TCCA 3O0DA 4GXTA 2FP4A 4AJOA 4BWGA 3M5DA 1M54A 4ICIA 1OX4B 4CMKA 3IIIA 3UAWA 2ICAA 5J43A 2OUIA 2XA2A 5F23A 1IPEA 2C7BA 3VPSA 3VR1A 2NU8A 4YCMA 3O1IC 4PG4A 4D4KA 1SXHA 1YQTA 2POCA 4KG7A 3ZX5A 4UD6A 4GBED 4I9NA 1JSCA 2CEAA 4EG4A 4K9KA 2FB9A 4B8ZA 4CDMA 1CS0A 2Q27A 2RGEA 2Z5LA 4RKEA 4CFZA 5JISA 3GR6A 3F73A 4A91A 5DHQA 2SHKA 2IODA 2QAIA 2KW5A 4JJFA 1Z26A 1VMEA 4KGDA 1HY3A 1XMJA 2PX5A 3T5CA 1XCPA 4B4OA 3R40A 2QK4A 3MAAC 1XFAA 3THOA 4RTRA 3GV0A 3KJXA 2C2MA 1G5QA 1M2OA 1R2QA 2HJ9A 2RAUA 4PSDA 1GUBA 4RE5A 3H9EO 4FKBA 3VPFA 5DP2A 4BVLA 3MT9A 2R7KA 3R0JA 4RA6B 5K51A 2X8WA 4QAQA 3H11B 4DLRA 1ZQ9A 1C9MA 2JRCA 2IKQA 2FETA 1IZ0A 1QC5A 3OOJA 1NW4A 4MVYA 4P33A 4RKRA 4S2EA 4F97A 5I48A 2GBLC 3C74A 3IV9A 2QTNA 4OI4A 4I50A 5T5QA 2EX4A 4TLCA 5HQJA 1OB5A 1Z3CA 3WWEA 1VKHA 5IS2A 3OHMA 1U65A 4XUDA 1HQYE 2P8JA 5AHWA 1M67A 2IP4A 2EL7A 4E11A 2YV2A 4JL8A 3AUSA 3G9QA 3U44B 3DMTC 3ELWA 3KEFA 1JFFB 2Q2NA 3RKRA 1O54A 4PE5B 1Q7CA 3AXTA 2JCSA 3WMWA 3L9XA 1P4JA 1RI4A 2JFQA 3L1VA 1Q7RA 3U4QB 4F1WA 3T3DA 5LYJF 5BSWA 1QANA 1NVMB 2FPPB 2PCJA 4YROA 4FFVA 2IZ0A 4R2KA 1YRWA 4RQAA 2QROA 3U80A 1P0QA 4E5YA 2RARA 4ENUA 2VP4A 2CV1A 4C30A 5C5IA 3EPKA 3RK1A 4Q3AA 3DTTA 3O75A 4DUYB 2RGCA 4J0QA 1RPAA 1SOUA 1Q2UA 2OYCA 1NJFA 1P80A 2A0FA 2HO4A 3IBCA 4PLTA 1Z5VA 3U60B 3SF0A 1Z4JA 1JFLA 3AR7A 3NNDA 2Q28A 3WDLA 1V5EA 3FUUA 4WDRA 3WWPA 2LIVA 3N39C 4WINA 4PX5A 1QV7A 4KO2S 2ZYRA 3ZZ0A 1LBEA 2YQ4A 1KXJA 4MCJA 4O4HF 3GPLA 4RENA 2JNWA 1E1KA 1XCMA 2JVIA 5BW8A 3KDSE 3QPWA 1M2EA 1AK9A 4KXVA 1UEJA 2AIRA 4PCAA 4HWRA 5GJCA 2I1QA 1KY4A 1UK8A 3NGLA 1KHHA 3LJKA 5JCPA 5FHRA 3JQEA 4F60A 1FTNA 2BHTA 3GGDA 1QU2A 5AD1A 4ENSA 1XNHA 2PZJA 1BWPA 1HTWA 3ZZTA 3DFUA 4CT0A 1RYFA 2E37A 1B23P 1R5OA 3DLCA 2VBGA 1IVSA 5KYXB 3QFSA 2Z2YA 4Q4AA 5ITZA 3HB5X 4DLBA 5KWJA 4B17A 3A6HA 3EC1A 1IBSA 4DCTA 4YMHA 5I5EA 1TADA 1YJXA 4MUXA 4PWYA 1EJBA 1CC1S 3VC7A 4YV1A 2QZJA 4OKSA 4MQ6A 1XZFA 1E1QA 1MFPA 2BT4A 2WM9B 4XW2A 1YRHA 5AI8A 3RR2A 4DM7A 4HEA6 3QMPA 4IHJB 1TU4A 1UJ4A 2R2AA 1VTKA 2OFOA 3T7JA 1NL3A 1ZOSA 4AG5A 3M7IA 4R8MA 3CVOA 2GRUA 4YMIA 1KP3A 4YUVA 1XZKA 3DJYA 3VO8A 5JNSA 3VKWA 2X76A 4DZZA 3ZEIA 2AFHE 2X2PA 3AVQA 4A0GA 2GXAA 5AI5A 3GLFE 4BIMA 1U0LA 2EVWX 1IDN1 2R1VB 3COPA 4Y6SA 4GX2A 1XAHA 1CZLA 1WXFA 2ZJ4A 4FI3F 4ZRNA 5IDWA 1YSCA 3A3NA 5ICSA 5T67A 1TYZA 4HNVA 2HRQA 2YWCA 1ZU4A 5ALTA 1VCMA 4P82A 1VJ1A 3FWNA 2QW8A 3Q3CA 1MT0A 5TMBA 3RC2A 1JB9A 4I4TB 5KVVA 3QY0A 3NORA 3C3EA 5AW9A 3WBFA 5JVDF 4ODIA 2X8AA 3V8VA 1KWKA 2I80A 3C7KA 4WFKA 4TZ0A 1PNOA 1B26A 1VHJA 2ZXFA 3II6X 1G2OA 2R60A 4HEA1 4N3BA 4IYRA 3DYIA 4CFSA 4IDDA 3DE5X 2CSUA 1FDWA 4GM0A 4W4TA 3ZQ6A 2A1UA 1SBHA 3H9GA 2PKYX 1XCJA 1XNQB 3U17A 4NG4A 4D8UA 4ZK6A 2CLIB 1UKBA 5LZ9A 2VHVA 1H66A 1TQ4A 2ZI4A 5FCDA 3WIEA 3C1OA 3P2IA 4AS3A 2W7TA 1QNFA 3KB8A 5LA6F 2VP6A 4CG1A 1UK6A 1NXWA 3PGVA 4R9VA 4UQOA 1SQGA 3ZGVA 2GBGA 4PYJA 4RHYA 2ZROA 1PK9A 1ODCA 2BFBB 2WABA 2ECKA 2OXFA 4Q02A 3RIYA 3AXSA 3OQ6A 2P40A 1XNJA 3OM0A 1V4VA 2I03A 1G3IA 3F4LA 1ZJWA 2ZE7A 4YREA 3TL6A 3AJ8A 1LDEA 2QPOA 2JLZA 1OIWA 2Q5QA 1M7GA 2Q46A 4O2BF 4XTCS 3D4OA 3GJXC 5WRFA 1V25A 4R6WA 3ZVRA 4XVCA 1KOLA 2NACA 3ANSA 3BMNB 2P9QA 2BKLA 4LWOA 3JRWA 3ROGA 5JU6A 1HSOA 2A9FA 1L3BA 1YZVA 5JBNA 2PMEA 4Q4DA 1NLZA 4DNQA 4EA8A 3LCRA 2DUWA 1KEEA 1OXUA 2I6FA 4GQAA 3ZEAA 5AVWA 4X61A 4WNCA 1MGOA 5JLAA 3LYHA 3SLGA 5GZ1A 1OLOA 2XH8A 4ZPJA 3DWGA 4RV4A 5ALEA 3SLRA 1TVKB 4LJRA 3NTOA 1ST3A 3IP6A 1HRKA 5JQGF 1DJPA 3LHFA 1MC4A 1A82A 4EWLA 4U8HA 1YU6A 4U6SA 3VR0A 2ANBA 4CYMA 1T8PA 1CZUA 4ARVA 4AECA 3F8TA 1E1MA 4K1LA 4V2IA 2ENUA 3HC7A 4JGBA 2ZYGA 1ZIOA 3FNIA 1E6UA 2HNBA 2QXUA 4KO3S 3EPJA 4RJJA 4UTZA 3OKAA 2G83A 1TMGE 3TNLA 2QVYX 5EMLA 2GPNA 2C5AA 9GPBA 2EFHB 3BL6A 2J3IA 3ZKWA 1YC5A 3C70A 3R74A 2DOKA 2CFOA 2VF4X 4WXHA 3TB6A 3CVWA 4MQMA 2QX8A 1C3EA 1T9ZA 4DEVA 1PYGA 3N86A 1O94A 2AHOA 2EBFX 1XD2A 4K8OA 1NBHA 1U98A 2Z4TA 3GLGA 4RVSA 1GRQA 3ICEA 5EZYA 1Q17A 3V9AA 3FF4A 1E6WA 4JGGA 4TMFA 3DAYA 1YKGA 1CUYA 3ADOA 3HWX1 4OAQA 4OGFA 5E7MA 3MB5A 2FZEA 1GFWA 1XDGA 5JC1A 1M0SA 2J9FB 1Q0PA 2D7JA 3E1SA 2PLFA 2G6BA 3I3OA 5C5DA 4CTMA 3I9JA 3EXFB 1UXJA 3L0YA 4J7XA 1ZC4A 5AVUA 3IQEA 1VSTA 2FZ5A 3HVRA 5HUHA 3R7AA 1EE9A 1M1ZA 2AJTA 3LKVA 1I3KA 1HDEA 4D0GA 4D74A 2HA6A 1XCBA 1GN9A 2JBWA 3GXBA 4MYCA 5LL6P 2ZRKA 1QGZA 2WZBA 2XNDD 4HAVA 2QTFA 3C5HA 3IE0A 4NBKA 2A4MA 2UYCA 5A7FA 3NMUF 4HN4B 1JVSA 4FEYA 2ZB2A 4JJIA 1O03A 2RBGA 3ER6A 1T1EA 2ZCUA 4JJZA 4ZHSA 3VV3A 1XCGB 1JAHA 3DL0A 3Q8XB 4MR9A 4R1NA 3FD8A 3Q7SA 5JT1A 4Y1RB 1MB4A 3DC7A 3PQ3A 2HZ7A 4DYVA 1I3LA 2QP3A 2BGJA 2E7ZA 3EZFA 5BRJA 2VJNA 5D1NA 3EH1A 4PPNA 1EU1A 3G2KA 4QE3A 2VT3A 5IEJA 4DRYA 3AZQA 1Q5PA 4IAOA 4DHWA 1P2TA 1JALA 2P1RA 5JCJA 3RI3A 1OB2A 2CVFA 1D8TA 2BP7B 5TQ2A 3VDNB 1KEZA 1N1MA 4F5WA 4KI0A 2HA5A 1DAKA 3SEZA 1NNSA 2KHZA 3RLFA 3T4PA 2JLCA 5JSZB 4Y9DA 3THSA 1P3JA 4PG7A 4FMPA 1XZLA 4PFSA 2FG6C 3DUFA 4EY5A 1KE2A 3OAAD 5FUMA 4JVMA 1O0BA 4P0QB 2WIKA 1QHEA 1BMDA 3AIOA 3CX6A 5JARA 1QPBA 4W5RA 4OH1A 4IGKA 4UU8A 4PW0A 3GLUA 2G72A 4AULA 2HSGA 1TOAA 5BWCA 1E2GA 3IILA 2AOTB 2JLAA 3F3MA 4JFAA 3VA7A 1E2KA 2PUCA 3ETHA 4X00A 3GWZA 4AKEA 5AI4A 4WEOA 4DLVA 5AVXA 1V1JA 5K09A 13PKA 2HDNB 3PPIA 1W0CA 3F67A 1RM4A 4DIEA 2Z56A 3L06A 2WKPA 5L53A 4RVCA 3PC8C 4RL4A 4RNCA 1KI7A 5DFAA 4L02A 3G0DA 3VYWA 4AUNA 2IHVA 2H2DA 4M0DA 1ZX1A 4MV0A 4LYJA 4WTOA 2ODAA 3HDJA 4KYTA 1DBRA 2IZ1A 4EGAA 3TUZC 2J4CA 3SMQA 2VP2A 4OM8A 5H9VA 3GUUA 3DYBA 2Y66A 1JHVA 3QVXA 1J2YA 2QUBA 3B1XA 6AT1A 1N2CA 3P9IA 5C1IA 4OMUA 1A9QA 4J3NA 3L0OA 5AW1A 5EKTA 1KSGA 3EVZA 1H9CA 1OWNA 2FEXA 4IHJF 3QE9Y 1G8AA 2BRUA 2NXJA 2ZBDA 3OQJA 3VHRA 1OZFA 2PV0A 2VHQA 1FK8A 5EIBD 4OQPA 3FZYA 1R37A 2WHPA 4TXLA 3SC4A 4Q6BA 4KPFC 3HRHA 3GVPA 3GT4A 4XWGA 1ICEA 1C1XB 1A50B 3MD9A 2DKFA 3H84A 2H29A 4PRZA 3PT9A 1SBIA 3CJTA 3KSDO 4ZU6X 3P9NA 4X90A 4M1OA 5KQGA 1ZMTA 5DM70 3F78A 2EX1A 4TXMA 5A05A 1Z0JA 2J6CA 2WE8A 2XRFA 3IKJA 4I4TF 4DG9A 4UOEA 4G6ZA 3U7QA 4Y30A 2V6GA 3TS1A 3H5OA 1Z75A 4BQNA 3N8HA 1GRVA 2FCRA 2ACVA 1VE7A 4D97A 1KOGA 1PVOA 1CJKC 4OX9Y 4B7CA 1PD0A 3VPAA 1U3UA 4NJEB 2PH7A 2G04A 3JQ8A 5AKZA 5HBRA 2LP4Y 3UT5A 1AGYA 4BQPA 5DBOA 1AE1A 4CU2A 3BRSA 4RXTA 1GY8A 4GF5A 5BR1A 1ZESA 2ZSKA 3D8TA 1UJ5A 4OEHA 5DHSA 2AGVA 3BB1A 3QVKA 1HTBA 2UYQA 2EQAA 3SJZA 1KJ8A 3QPAA 1E66A 5B58C 2O2XA 2I6SA 3ENWA 3E3LA 3X2EA 4I55B 3RHFA 1RC1A 3WGJA 5BNZA 1RJ9A 3HACA 2NU7A 4CIWA 2FN3A 4ZXFA 4XTRA 4G36A 4UTRA 4K6CA 1D0VA 4WFQA 1T8RA 3R3VA 3O2SB 1J4AA 2GI4A 2OCIA 3DEZA 2DQZA 4A92A 1OSNA 5EHIA 3LF2A 2QX9A 2SICE 4NDNE 5IBQA 1DG9A 1DRKA 3RVOA 2X4LA 3EZXA 4QQKA 4OGWA 1MTOA 5JROA 2CNLA 4GZLA 4K3UA 3WAGA 2HDOA 2ZETA 2BSQA 5EZQA 1T1GA 5FOVA 2X9GA 4R01A 3TVDA 1NP7A 4R2WA 1AZLA 4A8JC 2I54A 1K8YB 1L4MA 1Z5PA 3KR9A 4RCZA 2RI0A 2VEOA 3LHIA 4KQGA 4A26A 2KLHA 4PZ9A 1CQWA 1EK1A 1L4FA 1YRBA 5DYWA 4F3NA 2SCUA 1E64A 2QL6A 2ZQZA 4HAUA 2QLMA 4PAGA 3RT7A 5ESWA 3S2SA 5L3SA 3AVUA 1CDOA 2JJ1D 3K05A 4OJKA 4WY8A 1GAXA 3K2EA 3HJHA 4KOAA 1R0KA 1RAAA 1USVA 2PMCA 3AM5A 2G76A 3B51X 3V33A 4Z9BA 2OBMA 1SB8A 1EA7A 2QX6A 3DCNA 1U7PA 4DM4A 5BSHA 2Z98A 3E9RA 5EI5A 4WLOA 2CVPA 1U0JA 3TX2A 4N7BA 1BFDA 4US1R 5IXYA 6REQA 4C78A 1Z4OA 3I30X 1PT5A 1XA4A 3GAAA 4TWRA 5B55A 2EV9A 4Q7KA 4Q7LA 1RI1A 5HS4A 5TQVA 3ODGA 1OI4A 2RHOA 2QA5A 3SGLA 4O5AA 2C4VA 3PWKA 3S2YA 5DEIA 4D26A 2WQZA 3ONFA 3SP1A 4TKLA 1T2NA 1XAGA 3SS8A 4YRCA 4BP1A 4ZEVA 3TTYA 3I64A 5ERXA 1LQ2A 1OXSC 3VTFA 4WCFB 3KLBA 5FQOA 3VDRA 4C22A 2X3YA 2ZYSA 3PVZA 2WE7A 5IKPA 1MHTA 4MEBA 1F8FA 4EK9A 4QG7A 2B0JA 1ZLYA 2DQSA 3USZA 4P8RA 1WY5A 2HA2A 2ZYAA 1MPTA 1TT5B 1I7LA 2ZJ3A 3Q8KA 3EULA 4UATA 3S99A 5C37A 2BEWA 5CFPA 3LYUA 5CM2Z 3N0TA 1RNLA 3IAS6 1FDSA 1X70A 2Q3JA 3KVRA 3LP8A 4RABA 1N4DA 2N1MA 2R85A 5AHKA 5F5NA 3ZHCA 4ER5A 1JIVA 2QUIA 2J5QA 3PQCA 5E8JA 4JNCA 3UEOA 2UUBB 4XPIB 4NAVA 1Z28A 4L5JA 1ZUHA 2WMYA 4UBLA 1FRQA 2W2OA 3NYWA 3DEYX 4C4SA 2E4AA 4ISBA 1KR5A 3TJRA 2CJFA 1YI8A 2ZRQA 3ZHVA 1A2BA 2QM8A 5HDQA 2ZJYA 1ISHA 5J40A 3ZJYA 1QF7A 1TA4A 4L76A 4QGGA 4YGYA 1G0NA 4A8PA 2HU5A 1O5OA 2A3NA 3QLVA 4GYWA 4IUBS 5FLYA 1E7WA 1KPIA 2FN8A 5KDLA 3U26A 4I1SA 3EFBA 3MJTA 2J41A 5LWHA 3BFKA 2C2WA 4P92A 2ECPA 4P4SB 2FFJA 2QT0A 3CR7A 4RGQA 3SE7A 3H0EA 3TDNA 2B8NA 4G5GA 1JIXA 3OM9A 4NR0A 3TNDA 2VDMB 3AESB 3HR7A 3PDIA 4L51A 4N1AA 1T8YA 3H0KA 1D1SA 1XHLA 1WEKA 4BHTA 2GBPA 1H42A 3HDYA 3IAS1 1R00A 5COAA 3UCXA 2RD2A 2IE8A 4R3WA 4J16C 1ZM7A 1CJMA 3ZBTA 2NP6A 4LJ5A 1N2EA 1KQOA 3F7OA 3PFFA 3CNQS 4RVNA 3TEFA 4GZ5A 1AKYA 3JALA 2P5TB 3UMRA 3L7YA 4RLQA 1E1LA 1EP1B 5FJJA 4BGIA 2PKQP 5JXGA 3KBBA 4RSMA 3WMEA 1FE8A 1KK2A 2OV8A 1AUQA 1QK5A 2AXPA 1I9GA 1QDLB 2CXHA 2NTYC 2OWEA 3P2YA 5DCUA 4ZU1X 1R8XA 1G291 1B7GO 1R18A 2C5SA 2CUTA 1V95A 2FWJA 2VH5R 3PC2A 3VAZA 3W6UA 1JDJA 2AJLI 4MUGA 2B1GA 1RXSA 3WQHA 5B2FA 2GAOA 2FZVA 2VXOA 2IIPA 3DWFA 1E99A 4LXIA 1NWHA 1QBGA 2XYGA 4IIVA 2A84A 2YQZA 2ZIZA 3UUFA 4BNKA 2ZBFA 3GGPA 1BXGB 1U2ZA 1G16A 3DBHA 3JQCA 1XEWX 3OQPA 5DN6A 3NYIA 5P21A 1J8DA 1GU7A 1N0IA 2GYYA 3EG5A 3D6TB 1U5BB 3H19A 3KDAA 3O1JC 4QOGA 1JMVA 4TKUA 1N5IA 3KKNA 5JDCC 1RPJA 5IC4A 4BJ6A 1PT8A 3QF4A 3OCZA 5BUQA 3F1LA 1SJ9A 1QMPA 4QUIA 2H9YA 4Q0MA 4HWKA 3I5UA 4F7DA 2VJPA 3ZBPA 4UJ5A 4P31A 3V2IA 4IILA 2Z30A 3KSBC 4X41A 1LI5A 4JUBA 1W46A 4ZV9A 4ES6A 2G7ZA 5CXUA 2OCYC 3RV3A 2O8CA 4LHSA 2ZU0C 1C14A 4U2BA 3OJCA 4MVWA 1YB1A 5HJEA 1ZM9A 3QLVC 4CGYA 3DJFA 5K8JB 2FUEA 3OA2A 3TW8A 2NO4A 3MWLA 5CCXA 1U0BB 1USIA 3AB3A 3HR4A 5KVQA 3KQQA 4DGQA 4RF4A 3UFBA 3E0XA 3HSSA 1JH9A 4YXWD 1PJAA 4Q9JA 1NQWA 1XK7A 4M7PA 3T5MA 3WHPA 4R9UC 2BEUA 2WFAA 2JGMA 3GRZA 3SQOA 1H8EA 4BO1A 2D1SA 3MVEA 1OXXK 2PO7A 4F8YA 2G9RA 1XGKA 1IC6A 3BK2A 3H1TA 2GKGA 4CCSA 3ND9A 4FE3A 1Y5MA 1KF0A 2PX3A 3VU3A 1PX0A 1AKMA 4YP9A 1A97A 1AUOA 1NUUA 3DA8A 3UUGA 2JAQA 2GN0A 4I9FA 1SVUA 3R0ZA 4K05A 3T9AA 5B4TA 1ZJ6A 4RVOA 4BTEA 5A9TA 3A9VA 3LIIA 2O0KA 3IB3A 1FRVA 3N5KA 1M34A 2IHNA 3HMQA 3ETEA 3SG0A 2H4HA 2V4ZA 3D8HA 3A4YA 1ZSYA 4QBFA 4V0ME 1NVGA 4XZ3A 3RPEA 2P9GA 1E3DA 2BM0A 5IDXA 3BCHA 1NDUA 4WKBA 1T6ZA 1JZTA 4I55F 3IAXA 4JSTA 1UFVA 4Y0AA 5FI5A 1A9TA 4PZAA 4UXHA 2R8RA 1Z16A 4Q3NA 2BGNA 1RWWA 2ZBPA 3RGWS 1Z73A 2FFQA 3ISJA 1CUGA 2PFGA 4Q4JB 3EGVA 4EPTA 3CWQA 4IIGA 2HIHA 3NM4A 5ERGB 2ZSHA 1L5VA 4HGRA 4GMXA 4NENB 4J07A 3EEFA 1PEAA 4H6VA 3FTNA 3K1JA 1SZJG 3DR5A 4EFKA 3FNHA 1FDRA 1PAUA 1K2WA 2XMPA 1PSDA 3DF7A 5TVGA 4WUTA 3NWEA 4EQZA 4QG3A 2Q6OA 2JK1A 3REOA 3ELYA 4CM8A 3SSNA 4FFRA 1X77A 3RG8A 2REXB 5H8WA 3IKLA 1CULC 2E82A 2KQUA 3V1TC 1IIRA 2IT1A 1AZTA 5CEFA 2P9TA 1U0NA 2VHCA 3NWOA 1ZRNA 2OGSA 1UP6A 3TFQA 3UBMA 2AX3A 4PRYA 1NG9A 2G88A 2VQFB 2R5FA 4YRKA 2XT0A 4MQUA 3NVDA 4R51A 4BNJA 4N3CA 2GHTA 1NMSA 1PJLA 3H65A 2PZKA 2DCMA 2Y1DA 1NVXQ 3QLUA 5FD8A 1KO4A 4INAA 5F9MA 2CSXA 2J4DA 1NJSA 2QRPA 3HO6A 1Z68A 3LQ1A 3N2EA 4DLYA 2V6BA 4DMCA 4HBZA 3PEVA 1CDZA 2ZEJA 3P2EA 3SXPA 4ZI7A 1VG1A 4EENA 3CM0A 1VYUA 1BA2A 1YOBA 2QAGA 1VPEA 1LLCA 1CTQA 3ETJA 4M0KA 3RVNA 3ER9A 5D2CA 1W2HA 2ZI3A 4Q7EA 2JA2A 5C53B 1AF7A 2D7DA 2W2NA 1X1BA 2X2EA 4DL9A 4X45A 1YR6A 2H9AA 4C6HA 1TTHA 5HQ3B 1PZNA 5I47A 2EDAA 4D9CA 5TLSA 4RTPA 2P5YA 2GD1O 4B7AA 1G55A 4N47A 3TG2A 4CN9A 2HYIC 2EWVA 2GARA 3MMZA 3MSCA 2R8YA 3OFJA 4KN8A 4BNHA 5KSZA 3L4JA 2WYHA 3N75A 1U8XX 2ZRFA 3A1VA 4YRQA 1TAGA 4ZQGA 3S2ZA 5A4AA 3WK8A 5D7BA 4EIWA 2ATXA 2VSOA 1EKXA 3NWPA 2I4OA 3H2YA 2JHAA 2WKWA 2VWGA 3I01M 1PUXA 2B1JA 1E0SA 1OFVA 221PA 1PJ2A 4L9AA 5CHEA 3MMPA 1SR8A 3WSTA 3T1NA 4QOHA 4DYDA 5JXIA 2VRCD 3NM6B 1G0OA 1ZGGA 3P32A 2R8ZA 3QSGA 3TR6A 3BAFA 3IE1A 4R40A 5U4XA 3J7AC 3ZDYB 1L4UA 1UBUS 1RKUA 2O7QA 5H68A 1Q7GA 1ULUA 4BNNA 1V26A 1L7QA 4DAOA 2C2BA 4J8PA 1JQAA 1RVV1 2DFTA 3CS3A 3DZKA 3EDCA 1WS6A 2AN1A 3EMDA 4MXDA 1TA9A 4P98A 5H81A 3CF4A 4LY9A 4AURA 2HXYA 3P0EA 2FOLA 3U7IA 4KI7A 1C50A 2AEEA 1FMCA 2J4FA 3HY6A 3SYRA 3GA5A 4I08A 1C9DB 4NS4A 5EUQB 5IMBA 3TLXA 3JZFA 1AH2A 4ID9A 2FRVA 4ZT7A 3TIGA 4C0KA 2ADFA 1MO4A 1BMFA 1ZVKA 2CLMB 2ZIAA 3BMOA 3F6PA 3G9XA 5JCOA 2NT3A 1Z4QA 5BRNA 5E3HA 4B31A 2ZJ7A 4LZWA 1HH4A 1FXWF 4HDKB 1JV2B 3RVBA 3N3BC 1OWOA 3ZVNA 1RHJA 3MLAA 2O1SA 4YQZA 2OV1A 4QXOA 2Z2KA 1DT3A 2VF2A 3OT1A 1F7VA 1E2BA 5EE5B 4BBAA 1D4AA 1OROA 4ARIA 1U2EA 3IXQA 3L84A 1EUDA 2GYUA 3N2GB 1Q77A 1XA3A 2VPXA 3DOCA 3ST7A 5TGZA 2PWPA 1O6FA 3H87A 2IU4A 4J0DA 1PS0A 1RE0A 4TTVA 4ADSG 3GFBA 5BURA 2GBFA 4MV6A 4GVXA 1OAAA 1Y1LA 4W82A 2DVMA 1CLUA 1EP2B 1CR6A 1L5RA 1NVAA 2XDWA 3K0CA 3M2PA 2G1UA 3OZEA 3PFCA 4KO1S 2AN3A 4N4AA 3WMGA 2J1LA 3E27A 2VNSA 4OLAA 1ESCA 4JIMA 1CDDA 3I09A 3MT8A 3Q6IA 1Z7EA 2ZIXA 5JBQA 2I7DA 2I4NA 4AY5A 5HEKA 4AS1A 1XCOA 4Y2XA 1EFKA 5I51A 3O91A 5K3CA 1WKBA 3EUEA 4JYMA 3SF8B 2Y0DA 1P2DA 5HNKA 1X3SA 3BUSA 3EXG1 4QPDA 2PSFA 1FQWA 1K6MA 1G8FA 2WR8A 5D7NA 1S3IA 3VI4B 4C2BA 4Z8YA 1X7YB 1U3WA 1U2GC 3O4RA 4ITRC 3ASUA 1JHZA 1H69A 3FPAA 2AVDA 3K4QA 3KKPA 3ONEA 4KW7A 5C7IO 2V0GA 2O19A 1VKZA 4YRNA 3M70A 1ILWA 2YTZA 1EGMB 4HDNA 4ZI2A 1U7OA 2J87A 3EBOA 3ZD9A 4AZ3B 5KNCA 1FS4A 3WIVA 1WXHA 2I8CA 3AVPA 2Q2QA 3FNRA 1K5HA 2EHDA 2FVXA 2OHVA 8MHTA 4DA6A 4ZJUA 2WUVA 3V9PA 4J43A 3MELA 2NTJA 1A88A 1JJ7A 1KIAA 5FBKA 2FR8C 5B3JC 2DWQA 3MINB 3JD4A 1Q14A 2VQ3A 4GOMD 3L41A 4J2OA 1HTTA 2BTEA 1P0IA 4LI3X 3FTPA 2Z6AA 1SXJB 3LKZA 1H2ZA 4MVJG 1AMOA 2EDCA 5MGNA 5T41A 1JJVA 5AI6A 2QUKA 1EWKA 3CA8A 3N0RA 4IXNA 1NN5A 1PIWA 4FB4A 1JHPA 2NO9A 4TT3D 1E2PA 1WXWA 1I2ZA 2ZQ5A 5LBUA 4XVUA 4KQ9A 3BICA 4Y9TA 1UWKA 4XH9B 4V02A 4HNHA 5IBRA 1DIAA 4N03A 4NYIQ 1P18A 2C5BA 2F90A 5LU9A 3DEJA 2ZR7A 1NUPA 1MH1A 3UO8B 1G3QA 5MHTA 4GUDA 4HF7A 3HB7A 4HQOA 1MCZA 4PZPA 3LFTA 3RODA 5EJAA 4W5HA 4S2UA 2I66A 1PLJA 5F78A 5KNDH 1P4AA 4K6KA 3RS4A 1N2IA 2JFPA 2XCQA 1N2OA 4PLPA 4BMNA 4DBZA 1N2XA 2GB4A 3K0CC 2CZGA 3L7NA 3QE4A 5A6SB 1TK3A 1VKOA 3HA2A 9MHTA 4RF3A 3K9GA 5KX5B 2BM8A 2OB1A 1PR5A 4IXWA 4Y2PA 2X7JA 3T0GA 2O3QA 3OX1A 1XMOB 4B3GA 1I3CA 1EPUA 1E2LA 4R54A 2Z5FA 3UAOA 3NVAA 2AFHA 2Q4DA 1IK6A 3M4JA 1F3OA 1Q0TA 1RWKA 4DV7B 2OZLA 3S70A 2XXBA 4BQIA 4IZHA 2TECE 4PWZA 3KTAA 4GSKA 2W2QA 1RQGA 1DUSA 2A1TS 3OLCX 4UBJA 5KKAA 3SQNA 2G09A 1PZGA 1TZBA 2FDCA 4KTVE 2X8JA 3O0TA 4KQ1A 5U4QA 4UE2A 4UHEA 1R6BX 4CODB 3UAXA 1Z0AA 2O2JA 4EO7A 4B7UA 3QX3A 9ATCA 4QJ4A 3ZU6A 3F71A 3D7MA 3MTQA 2NO0A 2WTMA 4Z3DA 1LA2A 2HOQA 2P3SA 1S01A 1Z6TA 4E88A 2C07A 3LLMA 5JCXA 4PYLA 1ZHHA 2BUBA 3UATA 3LCVB 1E7RA 5TY0A 3RKSA 3K0AB 4BNDA 1M7HA 5FR1A 4EYQA 3MQ4A 3W8NA 4ZYVA 5CDFE 1PCXA 4IHKA 2DHDA 4C3OB 1GT6A 2YWJA 2IBMA 4Y2QA 2HN9A 3C5VA 3CX4A 1QZTA 1SVOA 5B37A 4IMRA 4AI6A 3D7KA 4W5JA 2ZYVX 3OPXA 4GECA 1MA0A 5E6UB 1SBQA 4FN5A 4QTTB 3RRMA 1WUTA 2AF3C 2JBAA 2PGXA 3UK2A 2A5JA 3GU3A 2CCGA 2P9FA 1GFZA 4QC2A 4K9DA 1EAYA 3W6OA 5IYZA 3VYUB 3FDFA 3UMVA 3VHXA 2ZT8A 2H2WA 4DPMA 2FW9A 1JG2A 1H8HA 1SUIA 2OGUA 4M7RA 5LOVA 2H0RA 4FFOA 3GAFA 2DWCA 3F3KA 1Z47A 4XB6B 5A2GA 1J22A 2B94A 1GO2A 1ZYUA 1Q7TA 3L4BA 4MK4A 1IEWA 1XEXA 3R9XB 2QTRA 4I19A 4KZKA 4OP3A 2FU5C 2GCGA 1A5ZA 3ITNA 2OBXA 3K92A 3LX6A 4JC5A 4KFCA 3DMGA 1QQTA 3KR1A 3ZBUA 1FLNA 3VMMA 1W4BA 3A70A 3EE6A 1QZZA 3IQDB 1BS9A 1FSSA 2AOUB 1TLFA 4PSCA 4YQFA 4M3NA 3JVUA 2DT5A 1QE5A 2HHLA 1EFVA 4LECA 1R6AA 2ATVA 3KOMA 1O8CA 1B0AA 2H31A 3PHGA 5EHXA 2OK7A 5KNDA 1NJ5A 1AMNA 3L1HA 4KO4S 4UOZA 1DBQA 2GVNA 4P0PB 2HJSA 3KQVA 3LCJA 5CNIA 2XMRA 7YASA 1B16A 4FMDB 2HCFA 5LKAA 4M9ZA 4AG3A 4KYUA 3U6KA 4JJ7A 5BMVB 1JMKC 2DLCX 1T8SA 2XGSA 2OHFA 4CM5A 2V8BA 1FFDA 1LF5A 3HXPA 3EDYA 5AKEA 5B3AA 4AY2A 1CXZA 3R3UA 2A57A 3LMKA 2PJRA 2DR3A 4JJAA 4UD2A 5DV9A 5LYJA 3CLVA 3WKBA 1U2RA 3LI2A 1ZG3A 2GA8A 1OA0A 2Y1KA 2OFFA 3D9QX 3HABA 2VTEA 3GBVA 5KAMA 2AJCA 4ACBA 2HXSA 4UMDA 4BKPA 5JPDA 5I9TA 2IU0A 4AL4A 2M98A 3CZ5A 3PF8A 5TPWB 1CQZA 2FUKA 2C7VA 3CR3C 4WOCA 1TI7A 1BCRA 4HUQB 1NURA 2ZIVB 2R1TA 3B8EA 1OFIA 3I2GA 4EFNA 2AUMA 2D0DA 1E1QD 1Y63A 5A03A 1NBME 1NRJB 2FH5B 2C2YA 4U4AA 4AYXA 5KMGB 1GGKA 4O4HA 1L7NA 3BGOS 1RQ2A 3NFYA 2D62A 1DC4A 2B1RA 4COKA 5K2OA 3A4MA 3LY7A 5C8YA 1PNQA 2CMHA 2N0SA 1F5NA 4Z53A 4RTNA 4LHZA 5BQPA 4QECA 3L4BC 1RLMA 2PGDA 1TJPB 1CY0A 2X0FA 3P9YA 5L3VA 1UAYA 4KN5A 1KPGA 3HLKA 1DWQA 1SC9A 1ZN2A 1X8KA 4AP5A 1MB9A 5BSMA 4B71A 5LQDA 1ISSA 5AW7A 5FO0A 3VH1A 3FHLA 5C1OA 2WTEA 5ALXA 3F3SA 3NYRA 1AVTA 4MA4A 1ZGAA 4M8IA 4TM8A 4N3AA 2NUAB 3IQFA 4D8YA 2HV9A 1FBNA 2B3DA 3MIZA 4FBLA 3R6TA 1YL6A 3V32A 3NT4A 1R0SA 5F98A 4OHFA 3KQOA 3V1MA 1IUKA 1X7GA 2ADMA 2WYWA 3BXFA 3LW7A 3O8QA 2NXCA 2VDRB 2COKA 2HKIA 4MS3A 3PSAA 1ZCBA 2H57A 5DIZA 4CMJA 1N9GB 3DOUA 4OYLA 5D5QA 4FGUA 4RACA 2IFTA 3OZTA 3A37A 5B3LA 3D1LA 1BOOA 5BV2P 1GYRA 4K8RB 2QUZA 1ZGBA 4P3XA 3TRIA 4LZZA 1GZ4A 4FYVA 3ZE8A 2I2DA 2Y77A 5CB0A 2VKQA 2LW7A 5JVDA 4ZOLB 2CHEA 4Y1GA 1F12A 3QV1A 1Z7GA 4IJUA 3JQPA 2VZEA 3PCXA 2FQWA 4DDTA 4BWVA 3IUYA 4RM3A 2DYKA 1RWMA 1FLAA 2WB2A 2ZR8A 4PBTA 2R5NA 4TXNA 1L8OA 1GIAA 1AKEA 1Z2PX 3NHUA 5BN4B 1JAZA 4ZGBA 2ORVA 2UU9B 5F77A 4LTMA 5KOJB 5KX5F 3GLVA 1GR0A 1KFKB 4JLAA 4II3A 2J09A 4RM2A 2AD1A 4MVJM 4BJHB 2ZRIA 3SZUA 4EKNB 4BO6A 4ND1A 1AZWA 1PL7A 3F46A 2IHUA 2W6PA 5DH9A 1VL2A 1BQ4A 1E8DA 4M55A 5DSZA 3BFJA 4M1SA 2YCLA 4OKNA 5LA6A 1C4OA 1N36B 2FSUA 1GQSA 1W88A 3LQFA 4URHA 3RROA 5C80A 1XN4A 4FW9A 3UH0A 4CIXA 4LDJA 4X66B 1TD9A 3BSYA 5DYTA 4UM7A 2O6LA 1TZMA 2XITA 4XIJA 2V5AA 4HRYA 4TWJA 4JI5B 2ZI7A 3CLUD 1A1VA 4RVUA 5D3ZA 3HO8A 1MUUA 4O2BA 2RH4A 4YT2A 5F2KA 4H18A 3CXRA 1NHGA 4WXRA 5THXA 3LBAA 5K3BA 3AY7A 5C81A 1O94D 2IEZA 3U7HB 1UBCA 1CT9A 2XOKA 3X1XA 2UZ4A 4N48A 3ZY4A 2XQKA 4LHEA 3EQ8A 3H97A 4PZDA 1EFUA 4UEKA 2QN1A 3T3GA 5JSFA 2XQJA 3L4SO 2NU6A 3NIDB 4ZKDA 4F5ZA 3TFOA 2R8XA 4CMIB 1ZOIA 1PZEA 4FI3C 2V8OA 2J46A 5EEHA 1B8NA 2ZVQX 4UNSA 3WGMA 5I9NA 2XKAA 3OI7A 2RGUA 5IJAA 1K1EA 4FR2A 4BGUA 2JVKA 1XZ8A 4P58A 1G3UA 2AFIA 3JQ9A 5ESDA 5C32A 5ADHA 3IVXA 3ROEA 1IL0A 1Y9ZA 4FHGA 1KYXA 1OX4A 4I5FA 5EAIA 3WY9A 2FK7A 1UR5A 2Z5VA 3CWZA 1K5PA 3EXAA 2BR4A 3SHFA 2PRKA 2L17A 4KXXA 3WOVA 4MDFA 3B3FA 4C0AC 3U19A 3UK1A 3QMVA 4ZOAA 5CB8A 3FOEC 4JZYA 5HR5A 5SZHB 1P1IA 4EY4A 1AO3A 2JI8A 2JI6A 2XT6A 3P0RA 4Q24A 3WADA 5MF6A 2BYTA 3QU5A 1RBZA 4HGOA 3LE8A 1GILA 3FRIA 4OSOA 5DHPA 2C96A 2Z08A 2AOVA 4B32A 1FF9A 5JCJD 3WGQA 4IUYA 3ZU4A 3GNQA 4RA6A 3ILSA 5LP1A 3ZE2B 1N7GA 3GI1A 1DXHA 3H11A 2ZB7A 2Q5HA 3MGGA 4OQNA 5I7AA 4AU1A 3QFRA 5K6TA 1F14A 3UHAA 4AO7A 1FTYA 3LWDA 4RV9A 4CT5A 4R8KA 2YASA 1BCSB 1I33A 2MINA 3Q15C 4B83A 1YDFA 1IJKA 1DS6A 1VG8A 2X7HA 2FF5A 4ZI3A 1J2JA 1HR0B 3QXGA 4ESVA 2CW5A 3EWSA 1A5SB 1CF9A 2EBHX 3ZH9B 4FFBB 3OCUA 4FMDF 2X0EA 2J32A 4BZQA 4UE3S 1U0OC 3DT8A 4AJ4A 2YWRA 5BMVF 1EZZA 4H4DA 3U44A 4X8OA 2IV2X 1JFFA 4EPVA 1Y5RA 2HSWA 4MHOA 4Q9NA 2RONA 4QHYA 1C8BA 5KHAA 3ZCXA 3G8YA 4CDRA 3VU0A 3U4QA 5A2QA 1P5FA 3WMRA 3QBVA 1VQ1A 3D64A 4D5GA 4F71A 1VHTA 2P6PA 1ZR4A 4N3GA 1TIKA 3D8BA 4K86A 3SYTA 4F04A 3IDQA 4L8VA 1RZRA 4EAAA 3IIMA 2OCBA 1GA6A 1TZ2A 5E9JA 1KFCB 1MF7A 4TWAA 1I24A 1OVMA 2JCVA 4BCCA 4BQSA 3TSAA 1WG8A 1U2DA 3AEYA 4C1BA 2ETXA 5A5GA 2BMAA 1SY7A 1YK1A 2JCXA 1IZYA 2JHCA 1OGYA 2DTDA 3OF3A 4IH4A 3PXXA 2C99A 2ACWA 3DW3X 3IBSA 2GRJA 2JLRA 2YYSA 1JDBB 4WOPA 4AQ7A 4OQ4A 3RKUA 4ZMBA 1OGIA 4ROSA 3GT0A 2CJYA 4IOKA 5G2OA 3ZGLA 2QW0X 4HCJA 1HDXA 1YZLA 1CS4C 1G41A 1QO0A 4BB5A 5JTTA 1N1GA 3AO0B 4RESA 1NSYA 2HZBA 1SXJE 4Z4GA 5HTOA 621PA 4UAGA 4RZIA 1XRJA 2A5YB 1YZHA 1JKXA 1K2VN 1E1YA 1YHYA 2HD4A 2QRKA 5FI0B 5ILQA 3UAZA 3RRNA 1ENYA 1GQRA 3S8EA 4A15A 1KPHA 1VSQA 5B1SA<