1Y8RA

Sumo e1 activating enzyme sae1-sae2-sumo1-mg-atp complex
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
337
structure length
314
Chain Sequence
GGISEEEAAQYDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQVTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRDVIVKVDQICHKNSIKFFTGDVFGYHGYTFANLGEHEFVEEKTETTMVKKKVVFCPVKEALEVDWSSEKAKAALKRTTSDYFLLQVLLKFRTDKGRDPSSDTYEEDSELLLQIRNDVLDSLGISPDLLPEDFVRYCFSEMAPVCAVVGGILAQEIVKALSQRDPPHNNFFFFDGMKGNGIVECLGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the SUMO E1 provide mechanistic insights into SUMO activation and E2 recruitment to E1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords Ubiquitin-like 1 activating enzyme E1A
total genus 95
structure length 314
sequence length 337
chains with identical sequence D
ec nomenclature
pdb deposition date 2004-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00899 ThiF ThiF family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1y8rA00
3TZHA 1DDOA 2JD1A 5EQFA 1AHIA 2JFGA 4E5MA 3PYMA 2FR8A 1ZSVA 4ZRMA 3JQ7A 2GN6A 3K2EA 3VZPA 4OM8A 4BO0A 1DEHA 1PJBA 5CEEA 2PKQO 2FPIA 3LC1O 3H9UA 1ISJA 4BNFA 5IJZA 1IZ0A 2PGJA 1X7GA 5A02A 4IIVA 3TZ6A 4J7CA 3WMWA 3NTOA 3GDGA 3GGPA 3H6KA 1BXZA 3BTOA 4XYEA 5KVCA 1JVBA 3P7MA 3MTJA 3I9LA 4NBVA 3IUPA 1P0CA 3W6ZA 2NADA 3CH6A 4PIVA 3HB5X 3V5NA 1UUFA 4ALNA 1MC5A 4ZD6A 5DP1A 1RPNA 1ZUD1 4IBOA 4S3MA 5IZCC 5FEUA 2AHRA 1T2DA 4BNLA 2GASA 3GAFA 2NLOA 3UN1A 4GBJA 3E18A 3K31A 1D1TA 4B7XA 3TOXA 2ZB4A 5JDIC 2W2LD 3PQEA 1QLHA 1K6JA 2Q49A 3AU8A 2VUSA 3WYBA 2C20A 2HAEA 3DOCA 1MXFA 3T4XA 4YWJA 3JQDA 3DBHA 1F14A 4CMAA 4KWIA 1H6BA 1TVEA 4CLXA 4A5OA 3RUDA 3AW9A 1YQXA 3PGXA 1GPJA 4J7XA 3GNTA 2HJRA 3IKVA 1KEUA 5DCWA 1E6UA 2BHLA 1WZIA 4L0QA 4WOJA 4FGSA 1UAYA 1PZEA 1P9LA 1XDWA 4N54A 4E13A 2EGGA 4IQ0A 4DWVA 5EN4A 1B14A 3WQQA 2JHGA 2BLLA 3ROQA 3V1TC 2X4GA 3PHGA 3SC6A 4C7KA 5FF9A 2PR2A 4RVHA 4CUZA 4XQCA 1PR9A 3O4RA 1C1XB 4R3WA 1E7QA 4PG6A 2X9VA 2ET6A 3TFOA 4WPGA 1SMKA 3GEDA 2Q4BA 2Q1TA 1HDZA 3LT1A 1LRKA 1E3SA 1LLQA 3UFXA 1PWZA 3QHAA 5KKCA 2UUOA 3Q11A 5L4LA 3I3OA 1BDBA 1BVUA 1DJQA 4HNHA 1ZMTA 3PHHA 1PJLA 3P19A 3KLPX 3E82A 1XEAA 3FRJA 1MG5A 4NI5A 2OZPA 4TKLA 4TRRA 4DMMA 3ANLA 1HE2A 1B7GO 3DAGA 1RM0A 3KTDA 1JQBA 1E3IA 4JXKA 3TZCA 1WVGA 3JQAA 2JL1A 2RHRA 2IRWA 4AICA 3K6JA 1ZEJA 2O4UX 3NJ8A 4Y98A 1SPXA 5L53A 4R1SA 1BXGB 3U4CA 2CMDA 1FDWA 2QX7A 3RKUA 3B1JA 3X2EA 4QFDA 2Y93A 3ZNPA 4NBWA 4E2WA 2CD9A 1YWGO 4RPJA 3JD1A 5HBRA 4J3FA 3FWZA 3GDOA 5BSEA 2O3JA 3PI7A 2DM6A 2EJWA 5L7TA 3DBLA 4I5DA 2ZB7A 1VRWA 2FSSA 1H9BA 3JQGA 1ZFNA 3PDJA 5EIOA 4OKIA 5G0TA 1QORA 4DGSA 1HE4A 1I2ZA 2Y66A 4H16A 4CMEA 4CLRA 3ZWOA 1H93A 1JAYA 3RCBA 4XGNA 1Y8RB 1HRDA 1JWBB 4KOAA 4FPXA 3RUCA 3ZWPA 1KOLA 2BMAA 4MVJP 3OQ1A 2BF7A 1Y8QB 2F00A 1KS9A 3KETA 5ITWA 2GZ3A 1YB4A 4CR7A 1KEPA 2EW2A 2FN7A 1NPTO 3HFSA 1WW8A 2B35A 3RVDA 4MIEA 1K3TA 2EXXA 3C3XA 1QXSA 3RQSA 4Z0HO 1YS4A 2CSUA 4IDDA 2W2KB 3NAQA 1ENPA 1QSGA 4EYEA 1VL8A 3FNHA 1HSZA 1UDCA 4FFLA 2IYOA 4PLGA 4RGBA 1T2AA 3UAGA 5A06A 1UZMA 2Z5LA 3O38A 3G0OA 4AVYA 1JAXA 3NGLA 5H82A 1K2WA 1YONA 1ZVMA 5ES3A 3OIGA 4EJMA 4IZHA 4P4GA 1TXGA 3OM9A 1DIHA 1VSUA 1WXDA 5AXDA 3LDHA 4QO8A 1ISFA 4NU6A 4JNKA 3T4EA 3NKLA 4I5EA 3KYBA 3WXBA 1I33A 4FSHA 4B4UA 3JYQA 4HKTA 2X58A 1N1GA 3S2IA 4P8RA 4ND5A 4OHUA 3Q2KA 1EFKA 3H3JA 5JPIA 4RDHA 4YAEA 2GGSA 1QYCA 1VL0A 4MVJM 1K89A 4E21A 1MFPA 2IDZA 4ZRNA 4C7JA 4E12A 4CM1A 4BNNA 4MKZA 1HYHA 3E8XA 2YFQA 1GQYA 1ZNQO 2EGHA 3DHEA 3N7UA 3ZHZA 2NVWA 2I5PO 4QT0A 4AL4A 4ND2A 3W8DA 4CQMA 1LU9A 2WWRA 2OFPA 2YV2A 3DOJA 4HFRA 4P22A 1U7TA 4B4VA 5K6AC 3ONFA 1L7DA 2VHYA 4TQGA 3KEOA 4ZQBA 4A73A 4L4RA 1XQ1A 1D7OA 3P2YA 4L4XA 4R1NA 1ZK2A 1YL5A 1B2LA 2YUTA 1BHSA 4ZA2A 2Q50A 5F5LA 1B8PA 3RFTA 3WLFA 4LK3A 4AG3A 1JLLA 5KWEA 4EGFA 4RQTA 3N74A 5A3VA 3N58A 4PLTA 3ROPA 4CM8A 2GO1A 3PJGA 1C0PA 1E3JA 4NG5A 1E7MA 2OXIA 3KV3O 5L40A 3KXDA 3GRKA 4G5HA 1Y7TA 3VKVA 3V2GA 4JGBA 3W8FA 1IPEA 1GZ6A 4JJFA 3E9MA 2I66A 5JMWA 1MFZA 4BNIA 2FWMX 1ORRA 3BHIA 2QZ9A 5TGDA 4ONEA 5AYVA 3HHPA 3PJDA 2CVZA 4XB1A 1CERA 2FMUA 5TLSA 3DHNA 2OP1A 2I67A 3R6DA 4ZHSA 1SB8A 2P68A 4GH5A 2R00C 2E37A 4GWKA 4DRYA 4FQ8A 2ZTMA 1V8BA 5TS3A 4BO2A 1ISIA 2JFHA 2IZ0A 4FFNA 4BNJA 2NSDA 3ZV5A 5IDYA 3PLRA 1WP4A 1LNQA 3AFNA 5DT9A 1YVEI 4RZIA 1NQOA 3LT2A 2VRBA 4KUGA 2YFHA 4HV4A 2QG4A 1GYPA 2OORA 2DAPA 3ANMA 4UVHA 4Z6KA 3WSVA 3PWSA 3NT2A 2HCTA 3R3JA 3NEPX 3ZWXA 4NFHA 4BNUA 2DTDA 3D5TA 4J16A 5T5QA 3ASUA 1J49A 3ORFA 1F0YA 2H5LA 5COAA 2PD6A 5TQVA 4NBRA 3EHEA 4OSOA 1CWUA 2EKLA 1DLJA 2AQIA 2PK3A 1VM6A 1R15A 3A1NA 4F3YA 4BGEA 4UUPA 3L07A 4FN4A 4CMJA 4HP8A 1PZHA 4I08A 3WBBA 1NNUA 1FDSA 1X1EA 3GQVA 3AU9A 1Y5MA 1C1XA 5A5FA 4Z9YA 3FBGA 1PGOA 1XCBA 3KYCA 4JN6B 2VNSA 4CMGA 3RFXA 3LVFO 1BRMA 1KC3A 2AE2A 3WWZA 4E30A 1HLDA 1LXCA 4Q3NA 1LQUA 2O2SA 2VYVD 1NR1A 4CV2A 3AY6A 4K9DA 4BB5A 1ML3A 2C7GA 5KJCA 4WLOA 2XXJA 3D64A 3E1KA 4YAGA 4XRGA 5TJ9A 1O94A 1B26A 4D42A 5HWSA 5C5IA 1IUKA 1C0IA 3EVTA 3TOZA 3HNPA 4J0FA 1DRVA 3GVHA 4N5MA 4XIYA 3D7LA 3GZ4A 3VZQA 3EW7A 3U5TA 4LSMA 5C7LO 1PJ3A 5ICSA 2GN8A 3DR3A 4WK6A 1E92A 5DF1A 3ZW8A 2C5EA 3V1YA 3FF4A 1UJMA 1EVJA 2EIHA 3UXYA 1CIVA 4AJPA 1B3BA 5I9NA 2DQ4A 2R6JA 5LCXA 5EMHA 1GAEO 1PJSA 3DFZA 1O8CA 1XQ6A 3QE3A 3K8ZA 1NFQA 4W99A 4YT4A 3DZKA 3ZWVA 1PS9A 1JKIA 2VHVA 1NFRA 2WM3A 3C7CB 4Y6RA 5C37A 1ENOA 5JNLA 4CUJA 2VTEA 4XDYA 1I10A 4YJHB 4CMHA 3MOIA 4TZKA 3CEAA 2AEJA 1LSOA 1V35A 3GMDA 2DTEA 5ILOA 1ADGA 4PLVA 2PGDA 1ZH8A 3OSUA 1ISHA 3DAFA 1Z7BA 1O5IA 4PFJA 2UAGA 3AJRA 3ZI0A 4WCFA 3I9OA 3K9QO 5B1YA 4XEHA 4MO2A 4BMNA 3KRTA 4DIOA 3VTZA 3JQ9A 4Z0PA 2ZQYA 1JA9A 1PJQA 3CUKA 3WJAA 2NVBA 4OAQA 3LYLA 4BGUA 2OO5A 3JYLA 3W4IA 4D3FA 2DT5A 2J5QA 4KMSA 4YJFA 3CIFA 1X13A 2YHIB 4RF5A 5IG2A 3SBOA 4GPD1 5JC8A 4A2CA 3IS3A 3DL2A 3RAJA 5JFOA 5JYDA 4OXYA 4CM7A 4INAA 3AFMA 4NJOA 5COQA 3U4IA 3WGTA 3FBTA 3Q9NA 3WIEA 1NBOA 1PQUA 4C4OA 3TF5A 1C1DA 1LSJA 3OJFA 2NU6A 1UP4A 4EBFA 4FFOA 3QSGA 2WSBA 4N5NA 3L6DA 4LMPA 1EZ4A 4NJMA 1TT5B 5JYEA 2NTNA 2E49A 4E0BA 1V9LA 4B4OA 3EVNA 4FJ1A 2ZKLA 3VOSA 3RBXA 1U3UA 2CZCA 5CG2A 5EJ2A 2Q3EA 3DZGA 3DQPA 4RQUA 1U4OA 1YO6A 3C24A 1PGPA 2BI8A 1LC3A 1ULSA 3V2HA 4U6QA 3PWZA 1WDKA 2Y05A 4BNMA 4PLHA 4CLOB 4R51A 4KWHA 5AOVA 1U3VA 2G1UA 1O0SA 3GK3A 1UXGA 3TFQA 3CE6A 3PK0A 2ZQZA 2C29D 4YEDA 3WGOA 5A5EA 3JD2A 3QVOA 3SLKA 3KYCB 1SO8A 1KEWA 1IL0A 1I3MA 3ICCA 3UICA 2DC1A 2B4RO 2OL4A 3MWEB 4JK3A 5EINA 3VH2A 2TMDA 2QZZA 3F3SA 3SEFA 4ALIA 1EQ2A 4NZ9A 4YVFA 4XYLA 1H6AA 3WDSA 1V0JA 1LQTA 1BTOA 3ST7A 2O3TA 4ALKA 2B4TO 2VZ9A 5A9SB 1Z75A 3CMMA 1UP7A 3WFJA 2I3GA 4D3SA 2X7HA 2GUGA 1ADCA 1W6UA 4KDEA 2D0IA 4BVAA 3F5QA 4RLSA 1DRWA 6LDHA 3GH3A 4TVOA 1H2HA 1I5RA 4TROA 1BDMA 1DHTA 3QLJA 3GG9A 2C59A 4LN1A 5KJ6A 5F1PA 4CL8A 4R01A 1PJTA 3L4BC 3P2OA 4NDNE 3HZZA 3GT0A 1OFGA 4RF4A 1DLIA 3ZZNA 2VNAA 1P77A 3CMCO 1GZ4A 2EF1A 3OJEA 4XCVA 1GCUA 4DIBA 4B3IA 3WS7A 5EQDA 3JYNA 4WLUA 5T67A 2FR0A 3CSDA 3EZYA 1AE1A 2AA3A 2B0JA 3RUFA 2QW8A 4WCFC 5LDGA 5DOZA 1RYEA 4N18A 2X9GA 3CINA 3H9EO 1RKXA 4RL6A 2E48A 2NUAA 4IGFA 4AJJA 3AK4A 4II2A 2C82A 4R16A 4RDIA 2DFVA 3ZHXA 1ADFA 1FJHA 2HRBA 3S2FA 3MZ0A 4CQMD 2X0NA 2YYYA 3WFIA 2NACA 2ZJ0A 4H7PA 4R1UA 1GTMA 4AJ4A 1DIAA 5JDCC 4GGOA 3DOOA 2R00A 5T8KC 1NVGA 2DBQA 2Q2VA 2EEZA 3ZNNA 4UVDA 1OOEA 3VHRA 1E0DA 1A7AA 3T7CA 4F46A 2G5CA 3QWFA 2BRUA 4WASA 3HJAA 1YL6A 4UEKA 3D5QA 1YBAA 3DB2A 1CRWG 1P74A 4R9SA 2O3UA 4BV9A 1NX6A 5JAIA 4ZVVA 4R68A 1QKIA 4IUYA 4OOEA 1BW9B 3K96A 3OEYA 3X2FA 4PG7A 2W2LA 2B37A 1DAOA 1EBUA 1N7HA 5U1PA 1R37A 3RC1A 1PIWA 3FN4A 2E6UX 4FJ0A 1EDZA 4KTTE 1LLDA 1J6UA 4NR0A 1LDNA 3OH8A 5IAAA 5C7IO 4MVJE 2E82A 1U5AA 1HETA 4D45A 2O4CA 4IQGA 3AUUA 4AJHA 4EJ6A 4R69A 1ZK4A 4EITA 4NBUA 1KVQA 1PQWA 4GAEA 5GY7A 4GVXA 4YJGA 1KY5A 4P4NA 1JKJA 1ZJZA 5GZ6A 1I3LA 4YB8A 4URFA 1P31A 2C2YA 2P5UA 4PZEA 4E6PA 3I6IA 1UDBA 4BKPA 3I9KA 2VRCD 5DBGA 2UV8A 4ZQFA 2OUIA 5KVVA 3WSWA 5CAEA 1IPFA 1X0VA 1B15A 2YY7A 1DRUA 4D46A 4K6CA 1HWYA 1UXJA 1QV7A 3TPCA 1M76A 3JQ8A 3QWAA 5TSDA 4YRBA 4U5QA 1PTJA 1R6DA 1DFHA 4LCEA 4M86A 4U0JA 5TNXA 3ROMA 3B1KA 1ZJYA 1EUCA 3FHLA 4MVJA 4ZJUA 3V8BA 1HYGA 3S2GA 1EVZA 2O48X 3HN7A 2O3SA 1AN9A 2VUUA 1HT0A 1Q7CA 3ZWMA 2HLPA 3UOGA 2VWHA 1AXEA 1ADBA 4MINA 1JW9B 2P9EA 5JCJA 4PLFA 1KBZA 3PDUA 4AJ2A 1AHHA 1M67A 4CMEC 3QVTA 2GF2A 2H1SA 3TZQA 3BMQA 4KP7A 2H63A 1ZW1A 3PIDA 4J0EA 3RU9A 4D0RA 4HWKA 1TI7A 3ZU3A 1L7EA 2EV9A 3QV1A 2PD4A 3BMNB 4ZQHA 3LF2A 5THQA 1NTOA 3M1AA 2OP0A 3IP3A 4J49A 4BO5A 1GZ3A 4J2OA 4LISA 4QTZA 5COBA 3TDKA 3WTCA 5H81A 4JBHA 3EMKA 2YDYA 1A7KA 2PD3A 1IB6A 4FD3A 5IDWA 4UEJA 2Y1GA 4PCVA 4W6ZA 3UF0A 1LDGA 2YHUA 4GQAA 4YA6A 3G49A 1Q7BA 1VJ0A 3PYXA 4EUFA 1G6KA 3KB6A 4JLWA 1FMCA 1ZSYA 3GGOA 1P1HA 4IJKA 4J9VA 3JQAB 1H2BA 5DNAA 1JKFA 1WDLA 4WCFB 4I9HA 3MJ4A 4EUEA 3F5SA 2G82A 1C3VA 3ZV4A 1YB5A 3U62A 2DPHA 2NVUA 3U3XA 1YL7A 1FK8A 5HTOA 4EW6A 4B3HA 1ZIDA 1KVSA 1W0CA 3OBBA 1TB4A 4DVJA 2Q2WA 3DBLB 1G0NA 4J91A 4E5NA 3GNQA 2Y1EA 4R5MA 5IFLA 4FFRA 4O6VA 4IQ8A 1YGYA 4B4WA 3OA2A 5AXCA 4D41A 3WNQA 4XKJA 4CM5A 4HFNA 3ABIA 4XA8A 2XAAA 3Q1LA 3GNSA 2PWZA 4B79A 1Y8QA 4FBGA 1T26A 3LU1A 2DBZA 2Q1UA 4PGFA 4FB5A 2X9NA 1Y8RA 3C1AA 4FFMA 2FOIA 1KIFA 5BSGA 4OO3A 1X7HA 3PZBA 4WKGA 2XXBA 2V6FA 3DZFA 4A27A 3UW3A 2A9FA 2VWQA 4CPDA 1YQGA 2DBVO 5T6BA 3VZRA 3LF1A 2JAPA 1MX3A 3GVIA 4RVDA 4E31A 1X15A 1Y1PA 3RASA 1DC5A 4JROA 3SLGA 4P38A 1CF2O 4R54A 2AG8A 5I7FA 5I8ZA 5BR7A 1KY4A 1HXHA 1MA0A 2OOSA 1PZFA 1PL7A 1QYVA 3ZV6A 4DXHA 4F6LA 2JJYA 4J1SA 7MDHA 2A94A 5JAMA 1VJTA 1YDWA 4NIMA 5DULA 2DBRA 5F21A 3GUCA 4AJNA 4AJLA 4Z9FA 2EKPA 4UEOA 3TL3A 3VPFA 5A1TA 4L74A 5G4LA 1GUZA 1VE9A 1NASA 4TRMA 1IOLA 2PZKA 3JQBC 4BNTA 3QJ5A 4RVFA 3ZV3A 3K30A 3QRWA 1YDEA 4RVUA 4H15A 3PJFA 2J3HA 3HQ4O 2VT2A 4RPKA 1M66A 2F1KA 2RIRA 4R3NA 3D1LA 3VPSA 1XELA 2FPGA 5KJ1A 1U2DA 4J7UA 2CY0A 1T4DA 4D7AA 2D59A 5A9SA 4HNGA 4L73A 4F45A 5JDIA 4E5KA 1E1MA 4NQZA 3ITKA 2HSDA 1VKNA 4E2XA 1ENZA 1K6IA 2VZ8A 1L1FA 3CKYA 4HUJA 4B7UA 1QLJA 1Q2XA 1I2BA 2YZ7A 1QV6A 1UXHA 3NJ4A 4E3ZA 1UH5A 2QYTA 2O23A 3FR8A 3JTMA 4LRSB 3DZBA 5DDIP 3WR5A 3ZU2A 5JC1A 2FSVA 1U9JA 5AVOA 4BNHA 3IDSA 3D4PA 2Y0CA 4WNCA 3B1FA 2A92A 3S1LA 3D3WA 4J4TA 1NWHA 3F1LA 3C1OA 4I1IA 1BGVA 2Q46A 4CMBA 3DFUA 2AEFA 3HDJA 5DCYA 4IGEA 2W2KA 3BA1A 3HWRA 2NQ8A 4M1QA 1AUPA 2HDHA 4MVJH 5HRUA 1V6AA 4PLCA 1U4SA 1NHGA 5A05A 4AFNA 1D1SA 2HMWA 4RLHA 1ZMOA 4AJOA 3INGA 3SX2A 4D0SA 2UYYA 2QRKA 1G0OA 4OSPA 4O0LA 3BMCB 5CEFA 3JD0A 5EESA 5HS6A 4BB6A 3HB4X 3DEYX 4A7PA 4HFMA 2GR9A 5TT0A 3QY9A 4KQXA 4W82A 2CNBA 2FRDA 4IIUA 4M54A 4KTVE 3WNVA 3OIFA 5A4DA 1FDTA 1YXMA 1SOVA 4CQLB 5ENDA 4IDGA 2WYWA 4I8XA 3MJTA 2DPGA 2Q1SA 1KERA 2J3IA 3TSCA 3GHYA 1I24A 1R0LA 3AM4A 1LTHR 5A9TA 1LSSA 1LRLA 3PTZA 4R1TA 1PQPA 2PZLA 1GADO 5T57A 2O2YA 3OP4A 2CDCA 1HDOA 1MV8A 3AI1A 3TJRA 3I9NA 1D4FA 1TT7A 4UULA 4FCCA 4YRDA 1IY8A 2WE8A 3LLVA 5I7EA 3L4SO 4LGVA 4JCOA 4JBIA 3C1TA 2NU9A 1F8FA 3ZW9A 5HS4A 4Q3CA 3TQHA 1XHLA 4UAGA 4UVIA 2IEBA 2VUTA 4NU5A 1P1IA 3PWKA 4GMGA 1P45A 1VL6A 5JCJD 2EHDA 3PPIA 1EE9A 1PEDA 1SZJG 1Y81A 2HK9A 3D3WB 1ZBQA 2RCYA 5DBFA 4TZTA 1XR3A 4IZIA 4CJXA 2IXAA 3HADA 4S1VA 4BO8A 3GR6A 3GZNA 3DZIA 3CZRA 2WD7A 3GUYA 3WGHA 4Q3BA 3VDRA 4YXFA 1Q1NA 3ZWCA 1XIVA 3BTUA 3PYLA 5KCZA 3K92A 2ZJ1A 4WLVA 5CEJA 3GAZA 5H83A 4BMSA 4AJEA 1WZEA 4AJIA 1E3EA 1A27A 1LBEA 1M75A 5GZ1A 1N5DA 2YV1A 2BGLA 2H6EA 3UH1A 3RUIA 5JO0A 1C14A 4J90A 1UZNA 2EWMA 1ZSNA 1GUFA 3FNGA 1QYWA 4BKQA 1DOHA 4B7CA 3GA0A 3H5NA 3M1LA 7ADHA 4U7WA 1NQAO 4CLEA 3FPCA 4GMFA 5IXSA 5BT9A 2BGKA 1GEGA 4A10A 1NVMB 1W73A 3O8QA 3ZWWA 4H3VA 3H9GA 1CJCA 1LSUA 1GYRA 2YJZA 1KVTA 1UAGA 1Q0HA 1WPQA 3I5MA 3I6QA 5CPFA 2DKNA 4YJFB 1KEVA 1YJQA 3MOGA 4DQUA 4OOFA 1EDOA 3GPDG 4A0SA 3D4NA 1LDBA 1PU2A 4Z3KA 1JTVA 1P1JA 4XX0A 2OBYA 2Q1WA 4QXMA 5CP8A 5KIAA 3F9IA 5C3MA 3GFBA 1ID1A 1HZJA 2CF5A 3KSZO 2J3JA 3UHAA 4YQZA 1Z82A 4L75A 3WB9A 2B83A 1OC4A 3VH1A 4MKRA 2AQKA 2ZYGA 3Q3CA 1M6WA 1NYTA 2GN9A 2CDBA 2GLXA 1LEHA 2B4QA 3L0DA 3NX4A 3VC7A 5CG1A 8LDHA 3SVTA 3GEMA 5EL0A 2PLAA 4NK5A 3F6YA 4IXTA 2Z95A 2D4AA 1HYEA 3QWIA 4L9RA 2RH8A 3ZU4A 2GSDA 2Y1CA 4IY1A 3ADOA 4Y6SA 4XYBA 3WMXA 4CLHA 4UVGA 1GUYA 5G0SA 4J6FA 2IODA 1ZZEA 1Q0LA 4ALMA 1DFIA 2BKAA 1B8VA 3RBZA 1Q0QA 2JFFA 1P0FA 4BGIA 4PVCA 4YYZA 1XLTA 2O3RA 3LQFA 4YTEA 2WD8A 1LX6A 2HU2A 2PFGA 4XYGA 4BO1A 3VPGA 1PJ4A 4BL5A 4PRLA 3RWBA 1N8KA 3NDJA 5I9LA 3K73O 4J4HA 3JYOA 3M2PA 3BHJA 3DAPA 3KHUA 4DA9A 2EKQA 4G81A 3A28A 3ZGYA 2ZIZA 4I5FA 1GQQA 1NM5A 3DDNA 2HKIA 1R12A 2RHCA 3CPSA 3Q0EA 2IEDA 4E33A 4WUVA 4BNGA 5K0ZA 1DIBA 4R4JA 4IMPA 2AG5A 5J23A 1U7HA 1AXGA 5FWNA 3R0IA 1BG6A 2GD1O 2WYUA 3HG7A 4YRAA 5L7YA 5JSFA 4DLLA 1Q7GA 4WLFA 1C0KA 2Y1OA 3WX0A 5L3ZA 3JQFA 4XDZA 4WEQA 3NRCA 1NPDA 4DQXA 3BMQB 2AQHA 2HK7A 1OI7A 2DU8A 1E3WB 1EE2A 4MOWA 4OJNA 2P2SA 2IZ1A 1C0LA 1LI4A 4NFYA 1WMBA 3A9WA 1GQ2A 4IDAA 1E6EA 1I30A 3F46A 1GCOA 1B3RA 1U8FO 2QRJA 4CM4A 3A06A 1HL3A 3H65A 1WDMA 4J43A 5KNLA 1Y5RA 2C2XA 3QW2A 1SC6A 1IULA 2OGUA 3MJCA 4K6FA 4QSMA 4R41A 4IJWA 3AM5A 2E4AA 3ETGA 5I9MA 2QHXA 3U49A 3ZNQA 1XGKA 2NVUB 1H94A 3JQGB 3I4CA 1GU7A 3IAHA 4K1LA 4II3A 3ZWYA 3OA0A 2I76A 3QP9A 2I65A 4E5YA 3IOYA 4Z9XA 4CODB 3OIDA 3GMSA 3T7EA 4OQZA 4WLEA 3ASVA 2VWPA 1F12A 2UDPA 1MLDA 2X5JO 4NPCA 3W8EA 5I7SA 1PL6A 1ZXLA 1ISMA 5EERA 3RC2A 1D8AA 2DUUA 4IDBA 3UGKA 4BNVA 1Y9AA 3VKUA 3GEGA 4P4LA 5JO9A 2JCYA 1YJ8A 4PG8A 4XZ3A 4J1TA 3UUWA 2WYVA 3AY3A 4PVDA 4DC1A 4BNZA 2LDXA 1ISGA 1F17A 3CXRA 3WTBA 4D3DA 2OMEA 4RO0A 3ZU5A 5BSFA 3MJEA 4UUMA 3O03A 1CETA 3E9QA 2V7PA 5FI3A 5ITVA 1EVYA 4DMLA 1CQJA 1JVSA 1MC4A 4BQRA 2QIOA 3STHA 4FDAA 2EJVA 4DPMA 1HKUA 4ND4A 2ZTUA 5A04A 1PJCA 4L76A 4HFJA 4MVJF 3FI9A 3R3SA 5KJFA 5L9AA 2I6TA 4E5PA 1E7WA 2HO5A 1W4ZA 1ZKMA 4IDEA 2ZK7A 4K26A 4ALLA 2ZATA 4B3JA 5DBIA 1YOVB 6ADHA 1OAAA 1G1AA 1Z74A 1IYZA 1HE3A 4OIMA 4J2HA 4GKVA 5JMPA 3VH3A 2VWGA 5B37A 3NV9A 4CR6A 3PHIA 3CZMA 2W90A 1X14A 2FY8A 3GF4A 3O9ZA 4KUEA 3IQDB 1LRJA 4E2YA 1A9YA 1HZZA 2HJSA 5JLAA 3RKRA 3GPIA 3EY4A 4OH1A 3ENNA 2O7QA 1A72A 5A03A 9LDBA 3C7DB 1DIRA 1YRLA 2VYND 2DFDA 4G65A 3ICPA 3IP1A 1E3LA 1N9GB 2X5KO 3JQ9C 1D3AA 3PFWO 3HSKA 1N1EA 3WGQA 4IJVA 1MGOA 3RBVA 1HEUA 3ZWAA 4ID9A 4IS3A 3DBRB 1PGQA 4XR4A 3QA9A 4N7RA 1MUUA 2A35A 4J4BA 2P91A 1PX0A 2JCXA 3OFSA 2UVDA 1LLCA 4FR5A 4RZHA 4GX0A 4FIZA 1H6DA 4YAIA 1P1FA 4BHTA 2EW8A 3G79A 5KJEA 1ZO8A 1LUAA 1Z6ZA 2Q2QA 3JSAA 2O50A 3JQCA 3DXFA 3IKTA 1BMDA 4BOYA 1FDUA 3E9NA 3G3EA 4W9NC 4A03A 2W8ZA 1QP8A 5AXAA 3BIOA 4W4TA 4TRNA 1NQ5A 3FPLA 3KSDO 3QQPA 4WE3A 4CR8A 1XKQA 5F1KA 4YAKA 4PLYA 4WNIA 3BMOB 4IS2A 5DOVA 1I3KA 2J6IA 3EDMA 1XSEA 5GZ3A 3JCZA 1P1RA 4U6SA 1RYDA 2EP7A 4MIOA 2P4HX 3HE3A 3RFVA 4EZBA 4LRTB 4TRJA 4DREA 4ROSA 1P3DA 5G0UA 1ZK1A 1H0KA 5TC4A 4ZN6A 4K28A 1A4UA 1T24A 1DHRA 1ONPA 1YBVA 2PGLA 3B70A 4MDHA 3BXXA 3LC7O 1PSDA 3ZWNA 4ZGWA 3WQRA 3KLMX 4ND3A 4WOKA 1YQDA 3KEQA 5DCUA 3U9LA 3RJ9A 1U2GA 4FGWA 2GZ2A 2O7SA 4IDFA 5KVSA 5JY6A 3D0OA 5TX7A 3VZSA 4YR9A 4XR9A 4CQLA 3ADPA 3QVWA 4BS9A 3PHLA 5U9CA 4DPLA 5BNFA 3AI2A 2Z1MA 2NTJA 3DZJA 2W4QA 4E2ZA 3S2EA 4CLDA 4EJ0A 2DVMA 3Q9UA 1E5QA 4GI2A 5C7OO 3DMYA 1F06A 3OICA 3AOEC 5LC1A 1R0SA 1P33A 2VT3A 5CFZA 1I36A 1XU7A 1P44A 3RUAA 4WECA 1N92A 1ARZA 3TRIA 5JW6A 4Q3AA 3VPXA 2Y67A 5JCXA 1R4NB 2EP5A 1ZCJA 2PZJA 2WD7B 2G17A 5I7VA 3RC7A 4FFPA 4OXNA 1EMDA 2I9PA 3HDYA 4OQYA 1VKOA 3OHSX 1DPGA 4LVCA 4JX8A 4PLZA 1MXHA 4CMKA 3UCFA 1CDOA 2P9GA 1QYXA 2JD2A 1TEHA 4FW8A 4CV3A 1UP6A 1EQUA 4JQCA 5IF3A 1JDJA 1I32A 2A4KA 4NBTA 1QG6A 5K6AA 2D1YA 4GSLA 2CUKA 3W4KA 4BNXA 5ER9A 3D4OA 1IE3A 1UXIA 2X5OA 5FFFA 3KVOA 2BFPA 4RF2A 4DBZA 4YPOA 2IYPA 1Z73A 5F5NA 4DIFA 4DL9A 4WLNA 1M6HA 3UCEA 2GRAA 2FR1A 3WIDA 4FOSA 2BD0A 2J5RA 1HDGO 2VHZA 3E03A 3L6OO 1R4MB 4U8GA 2NU7A 4MP3A 2I99A 2WJPA 1YB1A 3INRA 1VI2A 3IMFA 4CM6A 5GMOA 3TN7A 4JIGA 3G1UA 4RPLA 2NU8A 4PG4A 2B5VA 3RROA 1HF3A 4DPKA 3DBVO 5KOIA 5G4KB 1E1LA 1Y6JA 2X8LA 2PH5A 3JQEA 1DC3A 3JD3A 3PVZA 4MPDA 5TRTA 3DBRA 4CV0A 5IN5A 1E7YA 3FTPA 3LSYA 3V1UA 3ZHBA 3ZNOA 1HDRA 3SJ7A 4DQVA 4FC6A 2V6BA 4GWGA 2IE0A 3C8MA 3LT4A 3IC5A 3LK7A 2D2IA 5F1OA 1KETA 1SB9A 2EERA 3FR7A 1K5HA 4GGPA 3H8VA 4PLPA 2X0RA 4NH4A 1GEEA 4LMRA 1WMAA 2X0IA 2HMUA 2NTVA 2BFOA 3BMCA 1CYDA 5HA5A 3PQFA 3UKOA 2PA3A 3TWOA 1R4NA 3LLSA 3OEWA 3PRJA 3RJ5A 3VVCA 1NPYA 4QX6A 3ENKA 3GY0A 4OL9A 3IJPA 1GD1O 3D3EA 3RSHA 4BUCA 3DHYA 1TLTA 1DO8A 3FNFA 1BXGA 2GDZA 2Y0EA 4YACA 1NAHA 3H3FA 4BNWA 4X54A 2VHWA 4I5GA 4UREA 1PZGA 5A9RA 1X1TA 4FJ2A 4GSKA 1EBFA 3ZN2A 3ULKA 4BO6A 5B4UA 1UDAA 1BSVA 4RCVA 5TIIA 3JQAD 4M49A 5FYDA 5KKAA 4DLBA 1ZXBA 1PGNA 3ETEA 1GYQA 1KVUA 3JV7A 4BGVA 3H5AA 3I1JA 3ETDA 4TSKA 4EI2A 2D5CA 4MP6A 1BVRA 5CDUA 5IZ4A 3C7AA 3MTGA 3DMTC 4DTIA 1NFFA 1S7CA 4PLWA 4ZQEA 5L51A 3PJEA 1I8TA 3EC7A 1OZAA 3A4VA 5G4KA 3AUTA 1A71A 4BKOA 3LZ6A 4IDCA 1OBFO 3GG2A 4KDFA 3U4DA 3FNEA 2C5AA 2RH4A 4YAJA 1NR7A 2WTBA 5TT1A 2GYYA 4B8ZA 2FZWA 2HQ1A 1H6CA 4RV9A 1DAPA 3F4LA 3H2SA 1VPDA 4OXKA 1GFSA 2VOEA 4BNYA 3DTYA 3MCVA 2BELA 4MIYA 1DFGA 3VPHA 2ZCUA 5I8WA 1E7RA 2AMFA 1ZK3A 1E5LA 3DTTA 3OQ6A 2YV3A 4EEXA 4L8VA 4BO9A 3ZCXA 2RAFA 2W98A 3H9JA 3F4BA 1AGNA 4D43A 3KBOA 5JBIA 1HDYA 2QRLA 3O26A 1DC4A 4ZICA 2WEKA 1E77A 3PIIA 4IINA 1Z7EA 3IUSA 1DC6A 2VYNA 4W9NA 4B8WA 5KTKA 4BNKA 3S55A 5DP2A 1X0XA 3NYWA 5CDGA 3EUWA 2DTXA 2PV7A 3PEFA 5ADHA 1HLPA 1U5CA 3QWHA 3BMOA 3DC2A 4I9UA 4CM9A 4PZCA 5B12A 1UR5A 3PLNA 4CQMB 2SCUA 3JQ8B 1RM5A 1T2FA 3EYWA 1YOVA 3VH4A 1ZK0A 1JWAB 3DMTA 2Y68A 5IDXA 2D5AA 1PGJA 3MEQA 4UUOA 4MVJD 2CF6A 1T25A 2AW5A 3L6EA 3WLEA 4KZPA 4N5LA 4O1MA 4A26A 3LT0A 3ONDA 3TL2A 1E1NA 2VCYA 2FP4A 3WYCA 5CDTA 3JD4A 1NQTA 2D3TA 3C85A 1T1RA 2ZTLA 3PHJA 1W8DA 1GPDG 1SEPA 2VZ0A 4ZU3A 3GC6A 4IMRA 3NGXA 1MG0A 2DUWA 3EGOA 3KZVA 1YBMA 4HY3A 4GL4A 4ND1A 3S8MA 5BNIA 1R66A 3G17A 1BWSA 1EEHA 1N9GA 4U0KA 2VRCA 4CLRB 1NHWA 3I83A 4QFCA 3AY7A 1V3VA 3HDQA 5F3RA 4FOOA 2Y0DA 4M87A 1XA0A 5DN9A 4ILKA 4GLLA 3ONEA 1XYGA 3EK2A 3GFGA 1RM3A 4BO4A 1B8UA 4Q9NA 4WCDA 5AQ1A 4BMVA 3PXXA 3GGGA 1R0KA 2CFCA 3JQBA 2Q99A 4WGGA 2P5YA 2X1HA 3WYEA 3MJVA 2ILTA 3NT5A 3L9XA 1MP0A 3WJ7A 1K6XA 1E6WA 4J1QA 1LJ8A 2JHFA 4HADA 1LDYA 2VOJA 4BIIA 4CM9D 1QYDA 1IZ9A 2P9CA 4L4SA 4XYMA 2X0JA 4Z0TA 4IPTA 4BQPA 4MKXA 3INTA 1DJNA 4Q3DA 1YH3A 2ZCVA 4DYDA 4NNJA 3GVXA 5HM8A 1WWKA 1A9ZA 2PZMA 3NUGA 4DLAA 2X86A 2V6GA 3BAZA 3H7AA 1FF9A 1XG5A 4XJTA 3RIHA 1T4BA 2HRZA 2AEMA 2HMTA 3FTNA 3QVSA 4MP8A 3IL2A 3WGYA 4XQEA 4ALJA 4OMUA 5BQFA 4G2NA 2GNAA 4GKBA 2FZEA 2JCVA 2ZYDA 3Q6IA 4GX2A 2Z1NA 1J4AA 5MGBA 1B16A 4JP2A 4NFSA 1GV0A 4CM3A 1SCUA 2IXBA 2EG9A 4XGKA 2Y1FA 3KM0A 4Q3EA 2I3AA 3QWBA 1S6YA 3P5SA 4EUHA 4QUKA 3W4JA 2VHXA 1WNTA 5JS6A 1VSVA 4FS3A 2FHSA 4RVSA 1PJ2A 2PH3A 5L45A 5G0WA 4TMFA 1FDVA 9LDTA 2FPPA 1E1KA 3GN1A 3WQSB 3F47A 3OF2A 2Y99A 4IJUA 3K5PA 1IHXA 3PFFA 3I4FA 4NK4A 4BO7A 1PR3A 2B36A 3TNLA 2X23A 3LC2O 1H5QA 3VDQA 1O89A 1NAIA 1HDCA 1N2SA 4PRKA 3VTFA 4KQWA 1NP3A 4ZQGA 3L4BA 5JY1A 3VAZA 3GRPA 4DYVA 5CPBA 3UVEA 3IIEA 2Q45A 3DO5A 2DLDA 3V2UA 4O63O 3A14A 5L4SA 3BHMA 1CQIA 1U3WA 4EDFA 5ER6A 1SEVA 1KC1A 1U1IA 3GOHA 3U09A 1SAYA 1EVIA 4CM4B 2CVOA 3SXPA 5B4TA 1NWCA 3DWFA 1UZLA 3GHHA 2HUNA 2BFAA 1BW9A 4Q39A 1LDEA 3I23A 2VQ3A 5JDCA 1HDXA 5CHEA 3RC9A 4BV8A 3U0BA 1H9AA 3AUAA 5IN4A 2VTDA 3AOEA 3NDRA 3PP8A 4HX5A 4PG5A 4GLOA 1SNYA 2O3QA 3DONA 3HN2A 4RPHA 1LDMA 2NQTA 1P1KA 5DZSA 3DZHA 3WOHA 1PL8A 1RWBA 3RD5A 5T64A 2BGMA 3KUXA 3ZHYA 2BFMA 4QECA 4Z3DA 4OGWA 2J3KA 1GV1A 1NXQA 1O9BA 1V3TA 2GPTA 3BZUA 2J8ZA 4YT2A 2V6MA 2C7VA 3I9MA 1CEQA 3NT4A 5JE8A 1U3TA 3WGZA 1DXYA 2XPCA 2PTGA 2ZYAA 3FWNA 5K9ZA 5A3JA 4DBVO 2NM0A 4W7HA 1GDHA 3MJSA 3H5RA 3SJUA 1DSSG 2G76A 5IDQA 1SOWA 3WICA 2RBEA 3FCOA 1HTBA 1A4IA 4GX1A 5TJHA 3OETA 1PS8A 5IZCA 4GVLA 3JYPA 3ZWBA 4YT5A 4YJGB 1EFLA 1EK5A 2WE7A 4I9NA 4TWRA 1HE5A 1GY8A 4XB2A 3H4VA 1C1DB 3EAGA 3BMNA 4AJKA 3EZLA 3HUDA 4J9UE 2WMDA 4NMHA 1DIGA 3E5MA 3I9JA 4MJLA 4NHEA 1J0XO 5THKA 3L77A 4FC7A 2R2GA 3AWDA 2P4QA 4QQRA 5KVQA 4WEOA 4QEDA 2D8AA 5JXWA 4QO7A 5IXYA 1LA2A 2YHIA 3HFGA 3Q2IA 4UVEA 4BKRA 1E3WA 3NDIA 4XQGA 4MVJG 3WGGA 1NVTA 1KVRA 4CUKA 1WLYA 4F6CA 3VVBA 1F8GA 4XD2A 4CMCA 3NTRA 2B69A 1BXKA 4E4YA 3TZKA 3L9WA 2CVQA 4WJZA 4HXYA 3FSRA 3GN2A 4LCJA 3B6ZA 2LDBA 4RPGA 3GDFA 2VYVA 1EUZA 1XWFA 2AXQA 3O8QB 4LVUA 4YBZA 3ZH2A 5T8KA 1LLUA 1Z45A 2OBNA 4CMIB 2NWQA 1JU9A 5L4NA 5ENVA 1QMGA 1GL3A 1FXSA 4XWYA 4D44A 5JAQA 5MDHA 2QQ5A 3WGIA 3AI3A 5TF4A 3ZDFA 2AQ8A 2GZ1A 3ON5A 3W6UA 2ZTVA 1KYQA 3I52A 2C0CA 2JKVA 4YJDA 2BI7A 4ESOA 4JBGA 3OQBA 3KOUA 3H9QA 4BO3A 3B20A 3GLQA 3PQDA 1TT5A 4YCAA 1GR0A 4AJ1A 4ITUA 4CV1A 5CDSA 1RJWA 1DBVO 4IXWA 3M2TA 2GERA 5EPOA 3FD8A 2Y1DA 5L7WA 1EUDA 3NTQA 2C54A 3GZNB 2B5WA 4M89A 1ZEMA 1T1SA 1PS0A 4Y67A 1JN0A 3RU7A 1ULUA 3AUSA 4PZDA 2WDZA 1I2CA 1IHYA 2TMGA 1ONNA 3W1VA 5BNTA 2BH9A 3HDHA 3JQ7B 3AOGA 1RM4A 4R9RA 4JJGA 4GX5A 3OJOA 5L95A 2OHXA 1VJ1A 3QVXA 3KO8A 1O6ZA 3PZRA 2J5KA 4YQYA 4DC0A 1TA4A 4CMIA 2POQX 1U28A 1OMOA 2XF8A 2X22A 3JQ6A 4MVJI 4TVBA 2UUPA 3E5RA 4PN3A 1ONOA 4Y8VA 2GCGA 1R4MA 4CL3A 4RJTA 3ROKA 3SC4A 3WWYA 3UCXA 3AM3A 2IZZA 3GVCA 4W7IA 3COSA 3DBHB 1V3UA 4XRRA 3PGJA 3OMLA 1N7GA 2HMSA 4IM7A 4RVGA 1Y9EA 1QR6A 1T2EA 1MB4A 1YE3A 3KYDA 2JAHA 5LDHA 3E6AA 1I0ZA 2YQ4A 4M55A 3BTSA 3KSUA 2HK8A 4YT8A 3ITDA 3K2BA 2G0TA 4YJHA 1I01A 1XU9A 3QIVA 4M8SA 2PKQP 3CTMA 2AE1A 4BKUA 5AXBA 4EEZA 1VC2A 3ANNA 3MWDB 1M2WA 2QYSA 4R5HA 1B0AA 4JP3A 1LC0A 4YDRA 5CDYA 2ZB8A 2YQ5A 4O5OA 4E32A 3WBFA 3H2ZA 5BSHA 1PWXA 4TKMA 1EK6A 5G0VA 5JAZA 3KYDB 4O59O 3IJRA 4XGIA 2NNLD 3OJLA 1VLLA 1I3NA 1SBYA 1WAMA 4UUNA 1T2CA 4XQ9A 1HSOA 4CM8B 2H9IA 2ZB3A 1OC2A 4XIJA 1J5PA 5B4VA 4NJMB 4RF3A 2XOXA 2YDXA 3U4HA 4LW8A 3OJ0A 8ADHA 4J1NA 1U8XX 2HMVA 3RI3A 2Q4EA 4RORA 1X7DA 2PY6A 5U4QA 1R16A 4XJSA 4KUHA 1K0UA 2YW9A 4DUPA 3GVPA 4LSWA 1O95A 1DB3A 1QRRA 2JD0A 2V65A 4JJIA 3RUEA 2NV6A 3F1KA 3JQFC 1E7SA 3BYZA 2GN4A 3E48A 3G1TA 1ENYA 3R1IA 4OYRA 3WG9A 3M6IA 1A5ZA 4OKNA 2VN8A 3RUHA 1UXKA 2PNFA 4HBGA 3OECA 5ICMA 2PKRA 4Y9DA 4Y6PA 5G2OA 2C07A 2X6TA 5ILGA 4CLOA 2CDAA 1YKFA 5FI5A 4D79A 3BTVA
chains in the Genus database with same CATH superfamily
1MOPA 2JD1A 1PQ4A 3R6TA 2IBTA 3VU9B 3AUKA 3PSAA 4B83A 2HA7A 2ZJ4A 1R0RE 5IT9A 1KZ4A 3JQ7A 3R8FA 3VZPA 2NG1A 4L0CA 2XQIA 3KQTA 4BO0A 4YASA 4W9MC 1CUZA 4YJKA 4X8LA 5IJZA 1RABA 3FYUA 2APJA 2IHJA 3QNMA 3VR2A 2V0CA 3GW8A 4Q9KA 1G7TA 2YJGA 3QEKA 4D3YA 1Y6FA 1DADA 5EP3A 3CVWA 4J7CA 4OQQA 3NTOA 3NWEA 3NPAA 4H0CA 4BVLA 3HMKA 1BXZA 1VJGA 4XYEA 2ATIA 1AA9A 2QDKA 3OCCA 3CT6A 3PC2A 3I9LA 4NBVA 1GLGA 4DJTA 4B9AA 1PE0A 2FUEA 4B8YA 1VHLA 1XZIA 1KH3A 3DFKA 2E85A 2EJTA 2OO3A 1RPNA 4U2CA 1KIAA 2G6BA 4R9VA 1P4JA 2ZRHA 1UM9B 4LBWA 3ONWA 2AHRA 4FNGA 4A0RA 4CT5A 3HDTA 3Q6MA 3JVDA 5LQSA 4RA6A 3E18A 1DOZA 4WXEA 1T13A 2ZB4A 3PEUA 3STYA 1TYZA 4OTZA 3ZD8A 1AKTA 1SVIA 4JGGA 1LPNA 4KQCA 4XGQA 3DAHA 4JT9A 3EOZA 2FWAA 1DQZA 1JIJA 1QK3A 4INOA 5LXTF 3WYBA 3CQ9A 2QNIA 4RACA 3T4XA 5BWNA 3JQDA 3DBHA 5DVZA 5KBYA 4KH1A 5E2BA 3HCWA 4F0JA 4KWIA 4ZXFA 4R0MA 1H6BA 1TVEA 3SYKA 4A5OA 3GLIE 3GMIA 3QMMA 2ALJA 3FTCA 3O7WA 1OJLA 4J7XA 2PG3A 3CRNA 1OXKB 3GNTA 3G6WA 4JVMA 4LG1A 4WSOA 4H0NA 2HWWA 3FB1A 4RKRA 2X3UA 2H65A 2O7VA 4KQ1A 4P36A 1KEUA 4NY1A 2PUFA 4XTCS 3U3DA 3UQYS 2G3YA 2ZYWX 4L0QA 4X8OA 2IUUA 1KP2A 3NM6B 3CWQA 3OWHA 4KG7A 4XIGS 2JZNA 3MUNA 2OA0A 4EA8A 3K6RA 4DANA 2ODBA 1KJWA 2VLIA 3N0XA 1THTA 2HIMA 4X45A 4XSGA 1AQJA 4DWVA 3W9YA 3WQQA 5A7HA 1TKAA 2JHGA 3HO1A 2X6QA 2Z8YM 4DZTA 2ZRBA 3DR5A 5DW3A 3CRZA 3PDWA 4Q05A 4OL0A 4TMYA 2X4GA 2XNJA 3QEMA 1CX9B 4O2AB 2I6XA 3U81A 3V1TC 5C8XA 2PT5A 3CPHA 3HLTA 2MWMA 3Q9SA 4PAQA 4C7KA 5EJAA 3RHTA 2GBCA 1AX9A 1RHJA 3SMQA 2VBIA 4ZP1A 4LRXA 3SJCA 3ACBA 4H27A 4LJAA 3W34A 3WP1B 5HCIA 1P5FA 1SVWA 1FNCA 4F97A 4V39A 5TPWB 2COKA 3EBOA 3L05A 2W71A 3ESZA 2KQUA 5DYWA 3TPFA 1E7QA 4B85A 4U7DA 4EHHA 1Q0RA 1BXRB 2X9VA 1EI9A 1OI4A 3TFOA 2Q3BA 4WPGA 1HGXA 4X8HA 1GA4A 2Q1TA 1QGZA 3RS7A 1U8EA 1PWZA 1PCXA 3I0MA 1AZWA 1CUFA 4FD2A 1N9KA 3R5SA 7AT1A 1BDBA 1BVUA 3UFXB 1RZRD 4TXHA 3GLGA 1Q0ZA 4MKHA 4GW3A 1DG1G 1XEAA 4KI7A 4LVNA 4NXNB 1JSCA 1KF0A 2I6SA 3O3OB 2Z6AA 3M81A 3BGDA 4NI5A 2IIPA 5KNCH 3BRWA 2OZPA 3ANLA 2XW6A 1AF7A 3ROGA 1J8QA 4GEKA 1RM0A 3WRWA 3U4QB 1WQ4A 1JQBA 1E3IA 2V8BA 4JXKA 4H6PA 3KQYA 4QHSA 2WLTA 3ERCA 1S02A 4XVCA 2QX9A 2NSJA 2O4UX 3NJ8A 1P2FA 2HL6A 1W0KA 4G07A 2QTBA 1JAZA 3U4CA 1FDWA 1PTKA 2CXPA 2NP6A 3B1JA 3PB3A 5DE3A 4DYHA 1XCPA 4TTIA 2NYAA 2FUG6 3DMGA 3RVQA 1BFUA 4RPJA 3HB0A 1W88A 4MYSA 3KZCA 3OQPA 5IJ0B 1EWKA 3GH1A 4WKPA 3T1OA 4E46A 4DMRA 3W5IA 3MGKA 3GDOA 3EIQA 3DUWA 1U2RA 3G2KA 3PI7A 4EG3A 2FEAA 4FM9A 4JI5B 5GJCA 2JPDA 2YWGA 4RL4A 4U02A 1F4LA 2ZIAA 5AESA 3DBLA 4N4AA 1LPBB 3TUJC 4UOEA 5BWLA 1UMDA 1TUBA 3JQGA 5J2TA 3KVNA 1JLHA 1WULS 1FMJA 2AMJA 1Y5NA 2XQGA 5M04A 3ZU6A 4DGSA 2M2IA 2E9SA 2NYUA 4EA6A 3R2JA 4O08A 4CLRA 1NXOA 1Q95A 5CD1A 4JELA 1JI0A 1H93A 3RCBA 4XGNA 3RUCA 2J3EA 1KOLA 3JWIA 3RS9A 3CLSD 2FSHA 3OQ1A 4W1PA 3CFYA 3KJXA 4HX2A 2H85A 5AW3A 2XE8A 1YB4A 3OX2A 2RE8A 3A26A 4FUQA 4KMOA 2JK0A 3HFSA 1NPTO 1WW8A 1AKWA 3F7NA 1EAYA 3RVDA 1K8YB 1DC7A 1K3TA 3O75A 1QX4A 3IURA 3ZUPA 3VR4D 3A8TA 3B2EA 4D9KA 3FCCA 2RGUA 2HZBA 3GO4A 4HGYA 2XTNA 3WRYA 3TI7A 4EKYA 1YS4A 2IUSA 4S2UA 1GSOA 2HMAA 2VP6A 1E2BA 2X0KA 4B6FA 1E2PA 1P7VA 4G9BA 1HSZA 5KQGA 3FMIA 2AUTA 4IV8A 4QGSA 4Z9AA 2AMYA 1M1NA 2R8RA 1S3SA 3E3OA 3HLYA 3QX3A 3G0OA 3NGLA 4B6EA 2KM1A 4KIUA 3P2IA 1CEYA 2JA2A 1WPRA 4IZHA 3QMWA 1FQWA 4RBNA 721PA 3RGWS 3IR5A 2P65A 3N8GA 4P3YA 4JDPA 1ISFA 1XTJA 2FRXA 3SDBA 1CS4C 4PYMA 3ES9A 1JFVA 4JNKA 3CURA 2QUZA 1ORDA 1RBZA 1KS2A 3ESYA 4M6WB 1LFDB 1P60A 3NKLA 1NIJA 4I5EA 4WI1A 4YR7A 3WDKA 2P7HA 1W47A 5CU7A 4QWWA 4AO6A 3I30X 2F4VB 3ZEAA 1JQ5A 1XZQA 3U61B 1P7ZA 4HXFB 2Q8QA 4OHUA 1EFKA 2GF9A 3H3JA 2RHMA 3W04A 5AVXA 4JXJA 1QRTA 1OYWA 5EXPA 1TYDE 3BD6A 2G1PA 4KQFA 1M8GA 4P6VF 2OQVA 2JVKA 4A8PA 4C7JA 3ZX4A 3UO8B 3LI2A 1LGYA 2FSFA 3OU2A 4CM1A 4E08A 3KD2A 1C4WA 1DQSA 1J0DA 3MCWA 4QOIA 3FHCB 1PAUA 5NLLA 3UC5A 1XBTA 2EGHA 3DHEA 5AP9A 4GZMA 2MMGA 2I5PO 5DWVA 5FOQA 4ND2A 2IIQA 1DJMA 1VKJA 4HFRA 1S2LA 2R7KA 1Z62A 3KEOA 1T5IA 4TQGA 3ER9A 3LQ2A 2OHGA 1YC2A 2P9JA 3MWFA 3FOZA 5K6TA 3CW9A 1UMKA 1XYVA 2WQZA 2P2NA 3OESA 4QNRA 1B2LA 2D1TA 1BHSA 4PO1A 5F5LA 2Q50A 1NSTA 1UOOA 4XFKA 1NUTA 3RF6A 1KI6A 1JLLA 3KOXA 2H92A 4AG3A 5KWEA 4PSCA 2ZRAA 3C16C 3TECE 2LWIA 4JB3A 2QL7A 5A3VA 4PC3A 4KLZA 4F7WA 4WJLA 2BGNA 1PT7A 2GRUA 5BN3B 2O1XA 2AR0A 3UHOA 4H1HA 2IU4A 2QU8A 2ZRGA 1KMHA 1JH9A 2O1EA 3D8TA 3W2FA 4HRXA 3PXEA 1UBFA 4NG5A 2OXIA 1E7MA 4ZT7A 2UVPB 5CFQA 2OT3B 5BMOA 3KXDA 3GRKA 3GPLA 1DV2A 3B36A 3VKVA 2H07A 4DNQA 4JGBA 2DPXA 3W8FA 2CXOA 2JDIA 1IPEA 5E6SB 1CY2A 3TQRA 3EXHA 2I66A 2CKDA 3E61A 3GGDA 2VPZA 1S2MA 2XTJA 3R7DA 4BNIA 5JMWA 2PX8A 4DKJA 3PV0A 3KYJB 3HXOA 5C8YF 2VT7A 4RMHA 1XCGB 4P4SB 4FCVA 4MVWA 4EY3A 1NMZA 2YRFA 3FVWA 4YWHA 3VUFA 4DR7B 3DHNA 4JLOA 5AH0A 2BH2A 3GX1A 1U2TA 4E1VA 2KBEA 1QH0A 4I1UA 5JWRA 4FQ8A 2YOHA 1V8BA 5TS3A 2H1FA 4BO2A 5JI3E 3DE3X 2JFHA 4JLSA 5FPSA 1X92A 6PFKA 4HMOA 4WY5A 2EZTA 2PO7A 2Y4NA 2R751 3FSEA 4J2TA 3PWTA 1C8VB 4NZMA 3PEWA 1KOGA 4WBXC 3G5AA 1IRIA 2DWPA 2FA9A 3SK0A 3I73A 5B30A 5B64A 1HPLA 1LNQA 3AFNA 3UIEA 2ZJ5A 3PFKA 1YVEI 4RZIA 3LT2A 3KZXA 4TT8A 5CR9A 5FLYA 1EU1A 4D56A 2HSJA 2XUQA 2VJKA 2B94A 2ZR8A 3IA7A 1SA0B 2DAPA 2OORA 3ANMA 4EX6A 5L8VA 2B34A 3P0HA 4LJ7A 5KQLA 4RH3A 3R3JA 3THXB 2ZRFA 1KARA 2NO7A 3NWOA 3ZC3A 3ZWXA 2IX3A 1G2QA 3IAEA 3ASUA 5T5QA 1J49A 4ECEA 2F59A 2WMYA 4AS1A 5AJWA 1XEWX 1F0YA 3K9GA 4JODA 4A8HA 4EZEA 4N5DA 2PD6A 5TQVA 1CWUA 3AH8A 1D6SA 2EKLA 2YMLA 1ABEA 3QV2A 1OZHA 2ZE7A 2I3ZA 1VBNA 1WEHA 1QHGA 3BB3A 2H11A 2R4QA 4LSZA 2W48A 1TK9A 1VLQA 2PS9A 4YRLA 4FN4A 5FULA 3ZDCA 4XD7A 1FRZA 1RS0A 3RG8A 2E21A 3GBSA 5IJ9A 3OAAD 4W82A 1BE6A 4IICA 4TV8B 1VRCA 3BWBA 1KXJA 3E9DA 2RGXA 5AM3A 1Z28A 5H3HA 2YZMA 3QKRA 2PGXA 1XCBA 2VDQB 4LDRA 5BRNA 1T4GA 5CA1A 4QZVA 1KC3A 1O1YA 2AE2A 3PKZA 3WWZA 3LECA 5E9AA 1MEEA 4ZTBA 4B6GA 4E30A 3D81A 2VYVD 4CV2A 4K9DA 3PT9A 2C7GA 4WLOA 3S6JA 2XXJA 4C4YA 1XXHA 2C2KA 5TJ9A 1V2HE 5HWSA 3U19A 4DIDA 1Z6PA 2ODWA 3EGDB 1IUKA 1C0IA 2H1LA 2HHAA 3EVTA 3IAM1 1GUDA 1FMLA 3DD1A 3MAJA 3V46A 3GVHA 4QJIA 3KSRA 1RLTA 2BFNA 2C9DA 3H4TA 3MMNA 4PAMA 1O97C 3VZQA 4KXFB 4LSMA 1RXYA 3CVYA 3LUGA 1IEQA 4MA5A 1DP4A 5BNWA 1B00A 2X19A 2GN8A 1SD1A 3DR3A 3IE2A 1E92A 4H7JA 4Q9AA 4QPZA 1DZ3A 3FDJA 5DF1A 2GAJA 3FF4A 1F1JA 1S2OA 1UJMA 2RSLA 3NTVA 1CIVA 4O5AA 1K88A 5JH7B 1QFJA 2FUKA 3DFZA 1XQ6A 3KJGA 4HUTA 2M98A 4YT4A 2VDOB 2W6OA 3BGIA 1PS9A 5TQJA 2VHVA 2WM3A 4AZ0B 4B3FX 1O57A 4TL9A 3UOAB 5C37A 1T29A 4CUJA 1KJZA 2VTEA 4NENB 4XDYA 1WPXA 3KR1A 2CJWA 3CY6A 4TZKA 2FPIB 2AEJA 1LSOA 2G28A 3TB4A 4BCCA 2WFAA 3GMDA 4HD8A 5IMSA 3HTXA 2BBWA 3AR6A 3U7QB 5IC4A 2Q2NA 1ISHA 3R7AA 5LQJA 4YCSA 1O5IA 4PFJA 2UAGA 3AJRA 3PGVA 5E3JA 3ZI0A 3ZKAA 4F1WA 5KYKA 1QHFA 3I9OA 3K9QO 3NOOA 1A3CA 4H77A 2C42A 4O1HA 2DQYA 4GMKA 5DB4A 5TQ2B 4BGUA 1YNSA 2G5PA 4C1BA 4R6WA 3ZQ6A 4AKEA 1W5TA 1EFRD 1SQ0A 1PK9A 4HGRA 1X13A 4Q7EA 4QUDA 1AUOA 5IG2A 3SBOA 2X9QA 2IHKA 4S0XA 3IS3A 4UHBA 2MYPA 1KI6B 2ZR0A 1QTRA 3PA6A 4LYEA 5LP6B 3IALA 2OAEA 2XYRA 2BEVB 3BBPA 1JAIA 1R6UA 1ULZA 3AFMA 3JW8A 4OXYA 2YN4A 3V2IA 1DAEA 5KYXA 2ZLBA 3TLGB 4OHBA 3HKDA 4RNCA 3E53A 4Z86A 3WIEA 2P77A 3LPMA 1L5HA 2CLLB 4C4OA 1NQXA 2LNDA 2OBLA 1LSJA 1ZOOA 2NU6A 2XIQA 3H19A 2VDNB 5CLHA 3UK7A 1XDUA 2CYBA 5H4HA 2PH1A 4LMPA 3A10A 4ZAWA 2HA0A 1EZ4A 3PC3A 1SKAA 3FWKA 1OX4B 4J3JA 2E49A 1WY7A 3OFNA 4JWKA 3CLRD 2NVOA 5CIYA 2R0QC 4DUZB 4P34A 2WAYA 1XTIA 3KQSA 4FNAA 3VR5H 4LKRA 3STWA 5BOSA 1QCYA 4K7JA 3DQPA 1TRHA 2HTEA 5LB2A 3SZGA 4RQUA 2D7DA 3DKPA 4X7BA 4B32A 3C24A 2BI8A 5CLGA 4FBLA 5BSWA 4L7VA 3MYRA 3LV8A 1WDKA 5I7WA 4M21A 5FWYA 3RHSA 3PNMA 1DS6A 2PWYA 1Z47A 3IFSA 3Q41A 4OJTA 4R51A 4NKRA 1U3VA 2G1UA 3LOUA 4JX9A 3B1VA 1P2BA 2HHJA 3G2HA 5AVSA 3DB1A 4LYFA 1CR4A 4X6UA 3SBXA 2AKEA 4KXQA 5ALSA 4C3ZA 1SXJB 4JSRA 2ZQZA 5A5EA 3JD2A 3SLKA 4HVLA 3G7NA 2OV6A 1R8SA 3MWDA 1QOPB 2Q5FA 1QG4A 3AJ8A 2OESA 3ICCA 1IQ0A 1B2RA 2QRZA 2QJFA 3L0IB 2YN2A 1NVKA 4BLVA 1EQ2A 5IJ9B 3LQKA 1VIDA 4OK3A 3QU9A 2FJUA 3CX7A 3B1YA 5TE9A 3TR0A 2XE7A 2G9RA 1R9NA 1BTOA 1BS1A 2POCA 1SXGA 3C6BA 3ST7A 2VZ9A 2HD4A 4N9WA 3B48A 1YTUA 2ORWA 2FW7A 4LKOA 2JFQA 1Z35A 3OI7A 4EL0A 4KQGA 1NVEA 5ALXA 4BVAA 4E70A 4RVOA 3L46A 1VMKA 4R8VA 3IDOA 4TROA 1B8OA 2JLBA 4TV8F 3BM5A 3L0CA 3USZA 2FX3A 2FWIA 1P3JA 4H1TA 4Z4GA 1ND5A 1M9NA 3A3OA 4LN1A 3OC0A 3DOFA 1E4VA 3EWSA 1E62A 5CXSA 4CL8A 3HWWA 4R01A 4DBLC 1PJTA 5CA1B 3LWBA 3P2OA 4GI1A 1VLVA 4MA0A 4JUIA 4NDNE 1OFGA 4IOLA 4QUAA 2ERXA 1T2UA 4OM7A 2PGIA 3DFIA 5KO2A 3G1WA 3LBIA 2VSFA 4KXNA 2EF1A 2XUJA 3G82C 4TUYB 4YHBA 3BC1A 3G8YA 1EP2B 1FRFS 1MR3F 1WZUA 4F86A 1O6FA 1V11A 2GS9A 4DFDA 5IM4A 2QJTA 3TXAA 4ZIRB 2R68A 3ESCA 3RUFA 4R8SA 4M9ZA 3PEEA 5E9WA 3UJ7A 3JATB 3H9EO 3QVUA 3OPMA 4X84A 1RKXA 2PKCA 4XUCA 2JHAA 1ZJ5A 1UPXA 2HU7A 3HKCA 3HM2A 4V0LA 1EXWA 1G64A 2FPMA 3BXFA 2DFVA 3QLUA 4IGKA 1EGHA 3QX9A 1DINA 2Q28A 2HRBA 2I7XA 3C8HA 3E7XA 3MZ0A 4MEJA 2NZ2A 2V55B 2YYYA 4G01B 4MKFA 5TMDA 1R5NA 1SZPA 3RKSA 3THXA 1P91A 4YREA 1RC0A 2JLSA 4A6DA 1I6KA 3HV2A 3DLPX 4AJ4A 1MX9A 5GGYA 1V8PA 5KDLA 3DOOA 3L8YA 2NUPA 2ESRA 3NIBA 3AJEA 2BZGA 3JALB 4UCXA 3W5VA 1NVGA 4H31A 1GPNA 1NF3A 2Q2VA 2XT6A 3ELWA 4I4TB 2WQ7A 2FTKE 3VHRA 3T7CA 2RK3A 1UPAA 2YH2A 1VI6A 4URVR 3FVQA 1GNPA 4OJQA 3DOIA 4NP6A 4C0BA 4UEKA 2JLXA 3OE7A 3RTBA 3ZCTA 4D3ZA 3A2MA 1TMOA 2O3UA 2O5RA 2X8BA 3Q1KA 3QHPA 1MB0A 2AZMA 4L5AA 5HF6A 2ZT6A 4R68A 4QXPA 1U0HC 1BW9B 1QNLA 3K96A 2J9RA 4JLMA 3BHNA 4N3NA 3X2FA 2H2WA 2RAPA 3C5WP 4EECA 1XKXA 1I7DA 1EBUA 4B31A 3QEMB 2XZOA 1QFXA 3VXKA 3T5BA 4DMFA 5FWAA 1T9GR 1ZN7A 1OAKA 1J6UA 2Y9MB 2XNKA 1LDNA 3GRZA 1N2CE 3M6WA 2M6LA 1TJ5A 4AS2A 2ARKA 3F98A 4DAEA 4BASA 3P2EA 1O54A 1W4LA 3E4CA 1GPUA 4JGIA 1PTJC 4RZXA 5WRFA 5C7IO 4D45A 5A71A 2QY9A 1Y1QA 2YWJA 3UAZA 1MEOA 2H1HA 2CUTA 2O4CA 4KO1S 5EPEA 4EJ6A 4AJHA 1J06A 1ZK4A 3HA5A 1W4RA 3ZIAD 1AA6A 1KVQA 1NSYA 1X80B 1QFMA 2H2HA 2I2AA 4IYRA 3CX3A 1JKJA 4ZCSA 5GZ6A 1I3LA 1FJ2A 1U90A 4PZEA 3RUPA 3UAOA 3HXQA 3ASZA 3AHIA 2QLMA 1NOJA 3UWMA 3NVMB 4IDQA 1MZPA 4WZAA 2WHXA 2PL9A 2H48A 4I55B 4M8KA 4EMUA 1B15A 1WS6A 2HY7A 2JS7A 2YY7A 3G0IA 4EMBA 5E7MA 1UFOA 5FBHA 3U4QA 3PC6A 3QWAA 1QP0A 1RR6A 3BS4A 1I6LA 4U5QA 1G8KA 2ORVA 2QD5A 4O2BF 1DFHA 1OWLA 2F3SA 1D1PA 1TC1A 2RHLA 2YZ2A 4M9CA 5TNXA 5YASA 3KQVA 1XLVA 3V8BA 1Y4UA 3CH5A 2WHQA 5LQUA 3S2GA 2ID4A 3IH5A 2O48X 5AR1A 5D3MA 2GN0A 3AHHA 3HN7A 4BP9A 2BFCA 1Q7CA 4Q12A 3SSOA 4AY4A 2FDCA 4TLCA 2ZRLA 4OA5A 5I9TA 2VA9A 2IYYA 5AW7A 1MDFA 1KBZA 3PDUA 3O82A 1AHHA 3UUEA 4NRDA 4NOMA 3H97A 1T8YA 1H2FA 2GF2A 3GLGB 3TZQA 1Z8DA 3BMQA 2JI8A 3PIDA 3MFYA 4P5EA 1O95D 1OX4A 3GRAA 3ZU3A 1ZD2P 1NVVR 3CV3A 4KIWA 4AM8A 4EGJA 1EWQA 1MH9A 2PD4A 4I50F 2D1RA 4FGKA 2H4YA 5A0FA 1NUSA 2GVDC 3ZI7A 5A3RA 1YTLA 4H2DA 2I6GA 4KX5A 1RFLA 1T8WA 4DN6A 2ZSFA 3PGLA 2V9ZA 4HDRB 3KXIA 4F4DA 5ERYA 5K3OA 2GNOA 1K5PA 4QYIB 3T6KA 5EZQA 4AUKA 4FXPA 5H70A 1P5RA 1P0MA 4TWAA 3SZRA 4LXIA 4JBHA 5H81A 4QTTB 1WXXA 2DXIA 3AHJA 2NP7A 1IB6A 5K0CA 1BMTA 1RQNA 1ST2A 2GVNA 4RWZA 1R8XA 5BO5A 3WSTA 1NBEA 1WXGA 3KKQA 4KGDA 3B5IA 4D8TA 5DHTA 3PVSA 1LDGA 5IVHA 2GTPA 2YHUA 4GQAA 4YA6A 2DH5A 2CL6X 2HADA 4TYYA 4OP1A 1V11B 3KELA 5C5EA 1FQKA 1NA5A 2WUEA 1ETUA 3CS3A 3MCZA 4NBNA 4WFJA 4E88A 3WWEA 3F6BX 4PQRA 5C1BA 3H13A 3DFFA 1XD2B 2JGNA 1CZKA 3UBTA 1JKFA 4I9HA 3MJ4A 4EUEA 3F5SA 1KJYA 3TRHA 2WTXA 2OZEA 4XVHA 5GJWC 2DPHA 4UZFA 2JGDB 3EG9B 5AW2A 1ZG3A 2EBWA 3GJXC 2ZSBA 1G3UA 3OBBA 3D6AA 1TB4A 4JVNA 4UTOA 1QRUA 1IK4A 1UPFA 4B33A 4LF8B 3RS5A 4C29A 2OCPA 4B6OA 4Q9DA 4H7HA 4Y18A 4JJEA 2IKQA 3S7TA 3GLKA 5ALLA 5E6RA 2BPOA 2VBFA 1OX6A 1BVHA 3ZHSA 4YCJA 3GNQA 4ZT3A 2OCKA 4E5NA 4DR3B 2HH9A 2P9QA 4R5MA 3EXAA 1UM8A 1YGYA 2V7XA 4YFYA 1CHNA 5AXCA 1GZSA 4CM5A 3ZGNA 3LY7A 4XA8A 5I9IA 1EWYA 2FGJA 1PP4A 2H2DA 4OCZA 1FNNA 1V1RB 1Y8QA 2ID9A 2QM3A 3K20A 1II9A 4IIYA 1TM2A 1UMBB 4OMCA 1Z4IA 1X1CA 2V58A 4XJXA 1XZMA 4R2JA 4PGFA 4RHXA 2X9NA 3C1AA 4PPFA 3FETA 3RHZA 2GAIA 5BSGA 1X7HA 1GPYA 1UK8A 3PZBA 4RH0A 4RDXA 2E4UA 3OT1A 2XXBA 4NAHA 1FVHA 4UPDA 2AR7A 5DX1A 2A9FA 3WIVA 4CPDA 1G98A 4KPEC 1QDEA 1V4BA 4P3KA 3BJIC 3NI2A 1BE0A 2O8EA 3UT5A 1DQNA 1MX3A 4RVDA 3PE4A 5HX7A 2RDMA 1YVUA 3SLGA 5JJKA 1CF2O 4U2GA 2XJ9A 2V4MA 3F74A 4WVLA 3WGVA 3AV0B 2X0FA 4UTRA 1N0WA 3T38A 1V5EA 3TMYA 4UNRA 4KXMA 3R0XA 2Y6VA 4B74A 1C9KA 1SG0A 4PZYA 5EZSA 1Q1GA 1Q0SA 2PE5A 1LK0A 1PR4A 2A94A 1VJTA 1YDWA 4I4NA 2P9TA 4NIMA 3A05A 1JTEA 5DULA 5F21A 3GUCA 1L5LA 4AJNA 5CNKA 4TUYA 4YFVA 3F3MA 2HCRA 3VC2A 4DUGD 5E4FA 2OGZA 4UEOA 5AW8A 4ZVLA 2FPWA 2E5FA 4YP7A 2VJNA 3PHBE 4RSHA 4B44A 3AO0B 2W4MA 3FOCA 5SICE 1M8FA 4XDGA 1X42A 4NU0A 3ZV3A 1YDEA 1Z25A 2RHTA 3QKWA 5IT4A 4MDYA 2YOFA 3H1PA 3HQ4O 3PC8C 4D9BA 3HI4A 4R2MA 1M2KA 4X41A 2NXNA 4LPKA 4R3NA 5AHXA 2NU8B 4D9IA 3VPSA 3H8WA 1UK7A 3NORA 4UMEA 1M34B 1JIKA 3ZLUA 1U2DA 3HUTA 4TT3A 5KYVA 4J7UA 2QTGA 1XAHA 4PIMA 4WXPA 1UKVY 1WETA 2WFZA 3BAFA 2ODTX 3GRRA 4M1EA 2DLNA 4HNGA 2VK4A 4WESB 4MUAA 1BD3A 4MYHA 3U9SA 3OZXA 1DVRA 4PSUA 1ENZA 1SCKA 3C3MA 4I6EA 5DN6A 1L1FA 1PUXA 3ZXSA 1QV6A 1UXHA 1TA0A 3P1JA 2QYTA 4E3ZA 3FR8A 1L7MA 1F3OA 2A0KA 5JQGB 1VTKA 3BH7A 3DZBA 4BE4A 4YHHB 2Q4TA 1SBZA 5JC1A 2FWPA 2V7EA 1U9JA 3HL4A 1VBKA 4X1KB 2Y0CA 4CIVA 3B1FA 2A92A 2FYTA 3S1LA 4CG1A 4J4TA 1NWHA 4BDSA 3GLIA 4A2QA 1S7GA 2CK3D 4UKDA 2I2CA 4DNPA 3BE8A 2F43A 4HEA1 1TJNA 4CMBA 3WISA 2JLQA 5DCYA 4L72A 4EYGA 4B87A 3HWRA 2NU9B 4YRQA 2NQ8A 4M1QA 2WWGA 5I7AA 1Y9JA 3CPEA 1T3LA 2HDHA 4MVJH 1Z34A 4C4AA 3IOCA 5A05A 1NHGA 2CW5A 3TD9A 2KX7A 4AFNA 2W5UA 4MR8B 2WKPA 3KUUA 2HMWA 4UAJA 2VF2A 4Y3UA 1LW7A 3HMQA 3WLRA 4B46A 2ZCJA 4D0SA 3M7IA 3ZZUA 3ZCXA 1MAWA 4GT1A 3WGUA 5BMVA 3ZK8A 1CIPA 1WUTA 3FZNA 3JD0A 5EESA 5HS6A 3I6YA 1E69A 4C7MA 2QAIA 5JT1A 3DEYX 4A7PA 4ND8B 2UUBB 1R0XA 2HI0A 3LP5A 4KLNA 1QCDA 4TYQA 4YONB 3T35A 2L18A 2R8EA 4DOMA 1KQFA 3U7FB 2ZI4A 3T0FA 2CNBA 4IUBS 4MAFA 4ZU6X 4L57A 1A2QA 2YMQA 3ILHA 3UW1A 1T36B 4AXBA 2F1RA 1T6ZA 1YXMA 3IVGA 4CQLB 5CNMA 3N2NA 5DM4A 5ENDA 3KKNA 4WAUA 1LNZA 2J3IA 4Y6OA 3TSCA 1AQIA 1W87A 1TQ4A 2XE4A 3DFMA 1FDOA 4O4JF 2I1QA 1IN8A 3QUSA 2QGFA 1LTHR 4Q9HA 4AUMA 4I1PA 3O73A 5DHAA 4AP9A 1C9NA 2PZLA 2CNNA 2O2YA 4FX2A 2ANCA 3OP4A 7YASA 4KZKA 4ABTA 3AI1A 3TJRA 2P2GA 1D4FA 5AKXA 1TKBA 1XZLA 4FCCA 5FQOA 2XE6A 4MUNA 3KLNA 1JEAA 2BFEA 3QQ5A 2DOKA 2GRJA 4LGVA 4S1OA 4XLTA 1CSEE 5KHAA 1NJSA 4ZHQF 1I7PA 4QGAA 3VU9A 3RC8A 2NSLA 3K0FA 3L0YA 3D2CA 1F0KA 1VG0B 1Y37A 4XVRA 4NU5A 1P1IA 1UPUA 2DPYA 1P72A 2D1SA 2WAMA 5DHFA 1U3DA 4NVRA 3FMGA 2FWBA 1QE5A 1P45A 3ICWA 2JASA 3M6VA 3N87A 4RXMA 1AIPA 5JCJD 4PHGA 3LC0A 1EE9A 3D3WB 1Y81A 2HK9A 4B4KA 2C4UA 5JZVA 1ZBQA 3MQFA 1N57A 2JANA 2RCYA 4GP9A 4TZTA 4RELA 4PQEA 3WLSA 1NI4A 2I3DA 4YS6A 5K0LA 3T7IA 4BO8A 2H57A 3CZRA 3R7LA 4B2YA 3VDRA 2D5BA 3MT0A 1F7UA 2VPTA 1RWOA 1TE2A 4RGYA 2YUIA 4ICIA 5KCZA 2ZJ1A 1RZVA 3T1TA 2J33A 3ZLTA 2IHBA 3MINB 1EFAA 1I51A 2JFPA 3DZCA 4BMSA 1WZEA 1R64A 2I7DA 1E3EA 1A27A 1DAMA 4OAPA 1N5DA 2XB2A 1RRVA 1W2HA 4ECAA 2BGLA 2WC1A 4L78A 2XKKA 4C4TA 3R7FA 3VOTA 1OTYA 1G3MA 3G0BA 4J90A 3IMKA 1Z38A 1AT1A 1NRXA 1TZ2A 3HXKA 3MMSA 4QUBA 1ZSNA 3F9RA 4EHDA 2MYNA 3FNGA 4ZI2A 1QYWA 2I2FA 4U2KA 5HFAA 1XEXA 1DOHA 3CX8A 2Z09A 4RYDA 3LDFA 3UAYA 7ADHA 5EEHA 1C0EA 4IIFA 5C1OA 3G9ZA 1SQ5A 3ABQB 3SIXA 1C8KA 1G8FA 2F3PA 2HREA 5BT9A 5LBUA 4ND6A 3A36A 1JALA 4FFWA 3WYAA 2C0PA 3WL4A 1C3OA 2C99A 1EUDB 5SYMA 1GEGA 3EXFA 3GMTA 1W73A 5JUWA 1UADA 2QTAA 4KGXA 2NYRA 5LWQA 4R2HA 1CJCA 3NIGB 3URMA 4LJYA 5E1OA 4BLQA 1DUSA 1J9EA 1Y63A 3WZLA 3I5MA 2QRGA 3OQHA 4W5JA 4HT3B 4ZDJA 4HUQB 2QTWB 4MV7A 5KSPA 5C8ZA 1DX6A 1YJQA 3I64A 5ALYA 4EL5A 1NBAA 4DQUA 4OOFA 5KNCA 2QTHA 4A0SA 2V8OA 2RHOA 4GZ3A 3D4NA 1LDBA 3DXZA 3F7MA 2B8EA 5CP8A 1CC1S 4PPQA 3M34A 2OD9A 3F9IA 2B82A 2F3TA 4KE8A 4BMCA 3GFBA 3L82B 3OU6A 1AJEA 2CF5A 4WT7A 5AKGA 4EG5A 2VJOA 2WTAA 1GUAA 2GFIA 3KB1A 5CUQA 3E3AA 4MPRA 3UHAA 1Y7IA 4F93B 4D25A 3LT5A 3FFTA 1CUWA 4KE9A 1OC4A 1CS0A 4LZAA 5KOYA 2AQKA 1W34A 2ZREA 4L6IA 4MB6A 1M6WA 2JRLA 3GLIB 3ZOKA 3SE0A 4UJ5A 3IPXA 1L5KA 1XP5A 1SKBA 3K09C 2JFZA 4RPCA 3HEAA 4AW9A 2R96A 3H2HA 4FYMA 2QT1A 2BE7A 3GEMA 1ZCZA 4RULA 3LTEA 4D9GA 2VSYA 2VHJA 3IP7A 2XYGA 2OLJA 1AK1A 2HR1A 1N6HA 3VJMA 4UCQA 4BVGA 2IYNA 2SKDA 4GP7A 3K9CA 4YLYA 1ODSA 2ZUSA 4PO3X 3EQZA 5TDHA 2GSDA 4HH4A 1WV0A 3UJBA 1YUMA 3ND8A 5HUJA 3PD1A 2LE0A 1EGVB 2W58A 2HU8A 3PX3A 4CLHA 1XZFA 4Y6LA 2GD0A 1LBSA 5FXMA 3H2GA 1ZZEA 3TRFA 4IDHA 5EHIA 1DWQA 1P7YA 2O05A 4KREA 1DFIA 1K7CA 3B7WA 3FRHA 1K5GA 4UNNA 3VYSB 4EEKA 4E1AA 5JATA 1RXCA 1FP4B 1NV8A 3IIIA 4QTUB 2BGGA 4M0UA 1XQXA 1Q84A 4C4XA 4L4YA 4KYVA 1F0PA 1VECA 4YYZA 1Q12A 1XLTA 3BDIA 1KQOA 2P8JA 2HQSA 5FTNA 2WIAA 2HU2A 2VNKA 2PFGA 3SYTA 2YWDA 4GZ6A 4XYGA 1WF6A 3QELA 1X7YB 2OAGA 3UV3A 3V42A 4BL5A 2FHPA 1HQKA 1E1CA 1YVPA 1JZTA 3NHKA 4QPDA 4MJ7A 3K73O 3BIWA 4P35A 3CIOA 4J4HA 4RCYA 1E0AA 1R6XA 1ZESA 2H3HA 2EKQA 1H2YA 4C08A 3A28A 2VPPA 1NMQA 3DE5X 2W11A 3OAAA 3QW4B 4HB4A 4E1BA 2JFXA 1WVMA 2QTMA 3DDNA 4R83A 5DGCA 2J5BA 4GRDA 3OJWA 5FNVF 5J2UF 4PYRA 3QFSA 3NTUA 4KNWA 2HKIA 1C9JA 4TTQA 1LZKA 2PWPA 3FZYA 4QRDA 4HNAB 1AXRA 3K5WA 2XB6A 4LC1A 1F2VA 2J9FB 3S99A 2XCSB 3H5TA 4Z8YA 3GJ8A 3GI1A 1WB5A 2Z0MA 4PM4A 3BIJA 5KHLB 4M9RA 1B6TA 4Y2UA 3H1TA 5FBWB 4D4MA 4AMYA 1BG6A 2R62A 3HLKA 5EJ6A 3EXEB 1G66A 2JFNA 3IMEA 3QXSA 3TK1A 4BX8A 4EHFA 5EHZA 4YRAA 2J30A 3B5EA 2GPYA 1BHQ1 1TCUA 2P90A 2YXBA 4KQIA 5JSFA 2XT0A 5SZHB 4WLFA 2Y1OA 2Y71A 4BFLA 3ZGZA 1Q0TA 3RREA 3HS3A 1OYVA 2QUJA 1FPMA 4WWHA 4QSHA 1LNSA 1NPDA 3W6NA 5GONB 3MT8A 5A0TA 3PNKA 3BMQB 3FGOA 1Z2DA 4QDUA 1E3WB 1I4LD 2QKYA 1TZKA 3I8XA 3KU4A 3LPAA 4TVSA 3EJ6A 2OM6A 5G02A 4O25A 3NPMA 4N82A 1PDVA 4IDAA 2GPBA 3T7JA 3ICEA 4MAAA 1GCOA 2DHRA 3R7BA 4DJJA 1CJBA 1EB9A 1LKZA 4CM4A 3EGWA 5GP1A 1HQCA 5F4ZA 5GJVC 1WDMA 3I01A 5EWJB 2ZETA 2C2XA 4ZKDA 1PVVA 4MA4A 4BMPB 1EFHA 5CB4A 3Q7QA 4LBZA 1TZJA 3MJCA 5EXDA 3R7WB 1Z56C 5I9MA 4HAWA 3LY5A 2H7YA 4AQDA 4BNLA 1U0OC 3MA0A 2CLFB 5AVTA 4KR3A 2NVUB 3BJRA 3W0LB 5LYJF 1H94A 1UBNA 3IAHA 4K1LA 3RSFA 3UWKA 2JJ1D 2OMKA 1YK0A 1E6CA 2QN8A 3OA0A 4EY8A 5JJIA 1BWPA 1IVYA 4UUAA 2PZFA 4RZ2A 2CT8A 1RJDA 2I4IA 1G16A 2J4CA 1RPTA 3GMSA 3HP4A 4DBLE 3WK7A 1J1IA 1RP7A 3HA3A 2VWPA 1F12A 1U9IA 3PTAA 2Y1LA 5PNTA 1IIBA 2X5JO 3FLAA 4OXRA 5DI9A 5JEEA 2XYPA 1QPGA 5FQNA 5I7SA 3S1SA 2BCEA 1GVNB 4YAWA 5I45A 4KDCA 4QDOA 1XCJA 3S44A 3OPYA 3IQZA 4IDBA 1RLUA 4HVTA 1Y9AA 1AC5A 4L1KA 4OIFA 2JGAA 4Q16A 4BNVA 3T5AA 4TTTS 1UBCA 4M8LA 2QMYA 4LJ6A 3FCSB 1VE5A 1YJ8A 3H84A 4XZ3A 2P6NA 3RVSA 1ZW6A 4J1TA 3UUWA 3WL7A 2XNDA 1PF7E 3AY3A 3CZ5A 2XOKA 1VA5A 1YK1A 1Z12A 4BNZA 4YX9A 1WUIS 2QZPA 3AT1A 2LDXA 1GPWB 1U2SA 4GP6A 5AI5A 4BLOA 1BC5A 3N8IA 1ZN8A 4HTFA 1F17A 3CXRA 3KFVA 2FW6A 1Z18A 3RFUA 3SIWA 3T41A 3AFHA 3OWOA 2WJVA 3WTBA 4DZRA 1TAUA 2GAFA 4RO0A 2Q6LA 4RTJA 3WLPA 3ZU5A 3FZQA 4Q3LA 2A3RA 2F9MA 1CETA 4G3XA 5IJ0A 1EVYA 4N1AA 3QKIA 3K9FC 2GCEA 4BQRA 3CUYA 3RFFA 4WV3A 4P7GA 5BYBA 4FDAA 1S3IA 3STHA 1HKUA 2VDPB 3NDPA 2ZTUA 5EFOA 4MVJF 4HFJA 1SCBA 1QE0A 4O2LA 1TAQA 3F4KA 3EZ7A 3LHDA 3HGMA 1TQ8A 4KPUB 1UBRS 1ZLXA 2I6TA 5BXYA 5M7EA 1W4ZA 5MGNA 5DNUA 3P20A 2DGDA 3M70A 4BZZA 4QTYA 4MV5A 4J94A 2ADOA 2OECA 5DBIA 1OAAA 2HLHA 5ALGA 1ZJJA 1SUFA 1NONA 1Z74A 1IYZA 2ST1A 1PEYA 3LA8A 1IEWA 2FE1A 3NBAA 3O2JA 4J2HA 3B52X 2IPOA 3CJTA 3HKBB 4DM3A 1TK3A 1ULHA 1X80A 3VR3A 4UBMA 1KDTA 2R8BA 2VWGA 5E1MA 4JVSB 5B37A 5HF8A 5IAJA 3RLIA 2VO1A 3CZMA 2W90A 4H60A 3M1IA 3A1EA 3LPCA 5JSUA 5K0TA 3O9ZA 1IAVA 3A1CA 4PZ9A 1UC8A 2H2GA 1GHTA 2NSHA 3GWZA