1Y93A

Crystal structure of the catalytic domain of human mmp12 complexed with acetohydroxamic acid at atomic resolution
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
158
structure length
158
Chain Sequence
GPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDDHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Macrophage metalloelastase
publication title Conformational variability of matrix metalloproteinases: Beyond a single 3D structure
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 39
structure length 158
sequence length 158
ec nomenclature ec 3.4.24.65: Macrophage elastase.
pdb deposition date 2004-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1y93A00
3Q2GA 2OW2A 2XS4A 2DDFA 2QPJA 3G5CA 1GKDA 1CGEA 2OZRA 4XM6A 5I0LA 1MMRA 1OS2A 1R55A 4WZVA 1BIWA 2L0RA 1BKCA 1C8TA 3B92A 3HY7A 3LQBA 3VI1A 1SLNA 1XUDA 1CIZA 1UTTA 1BQOA 3SHIA 2JT6A 1R1JA 2XS3A 1B8YA 5L79A 1PWUA 3V96B 4AUOA 3P24A 1CQRA 2MLSA 4GR0A 4PKTA 3TT4A 3EWJA 1BUVM 3ZVSA 1OO9A 5B5OA 1XFVA 1Y8JA 4FXQA 2W0DA 3EHYA 3TVCA 4CTHA 1ZP5A 5CXAA 3EDGA 3LJZA 4DPEA 1ZVXA 2JNPA 2W13A 1G4KA 4FXYP 2OW1A 2W14A 1UEAA 4FU4A 5I4OA 3GBOA 1EB6A 1UTZA 1ATLA 3KMCA 1R1HA 3HDBA 1D7XA 4DD8A 3O2XA 2USNA 5I3MA 2DW0A 2ERQA 2A8HA 3LJGA 3EHXA 1SMPA 3B2ZA 1JANA 2Z2DA 1JAOA 1BZSA 4ON1A 5D2BA 5D1TA 1L6JA 2J0TA 1YP1A 1OS9A 2X3BA 1CAQA 3EDHA 2J83A 1MNCA 1XFYA 2OW9A 2YB9A 2Y6DA 1FM1A 3AYUA 3KHIA 5JMYA 4GR8A 3DWBA 5D7WA 4DV8A 1BM6A 3DPFA 3LK8A 3VTGA 2O3EA 3F19A 1FBLA 4AYKA 1JIZA 1SATA 3LEAA 1UMSA 2JIHA 1I1IP 1JIWP 1CGFA 3WV2A 2EROA 1HY7A 3F16A 1A85A 4G9LA 1WNIA 1J7NA 3TSKA 2W12A 1OMJA 3N2UA 2RJPA 4Q1LA 2V4BA 1BSWA 1XURA 1IACA 1SRPA 2OY4A 1FLSA 4IJOA 1IABA 1PWWA 1ROSA 1I76A 4XM8A 4WK7A 1JKYA 3RTTA 2YIGA 3LGPA 4PKRA 1KUKA 3DPEA 1KBCA 5BPAA 2RJQA 3B8ZA 3E8RA 1XFZA 4DF9A 4L63A 1K7QA 2K2GA 5I12A 4AIGA 2POJA 3K7LA 3DNGA 2MZEA 5I43A 4JQGA 2OVXA 1OM6A 3L0TA 4XCTA 3L0VA 1S4BP 3HBVP 3KMEA 5LABA 1R54A 4WKIA 2TCLA 1IAGA 2X3CA 1Y93A 4GWMA 4GF1A 3LQ0A 2OXZA 3OHOA 3CKIA 1D5JA 2FV5A 3DSLA 1CXVA 4XBHA 1AF0A 1MMBA 1PWQA 1ZTQA 3K7NA 3ZXHA 2DDYA 1QJIA 3LUMA 1GE5A 1GKCA 4GWNA 456CA 5CZMA 4GQLA 4JP4A 1GE6A 3P1VA 4R3VA 1JAQA 3KRYA 2OVZA 1KUIA 1RMZA 2OY2A 3DL1A 4PKWA 2KRJA 1PWVA 4ZR5A 2DW1A 4H3XA 1Q3AA 4L19A 4FVLA 3UVCA 3LIRA 966CA 1BKCI 1KUGA 3AYKA 4H82A 2K9CA 4A3WA 2OXWA 1C7KA 3ZUKA 4EFSA 5BOYA 3LIKA 3EDZA 3HDAP 1G05A 4L6TA 1AYKA 1Y0VA 1HV5A 1O0TA 3F17A 4WF6A 1MMPA 2Y6CA 3HBUP 2WO8A 4H76A 2MLRA 4PKVA 4HX3A 4G0DA 3LE9A 3TS4A 3WV3A 4PKSA 2X7MA 1USNA 1EUBA 2OI0A 1GXDA 1JJ9A 1QIBA 1O0QA 1KAPP 3Q2HA 3RTSA 4H2EA 5BOTA 1JH1A 3HB2P 4JPAA 2WOAA 2OW0A 3KEKA 3EDIA 1K7IA 1ZS0A 1ZXCA 1OM8A 2I47A 1ASTA 1IAEA 1GE7A 3KEJA 1MMQA 1G9KA 4H49A 2N8RA 3BA0A 1KUHA 1DMTA 3G42A 1BQQM 2OXUA 1G49A 1AKLA 1IAAA 1B3DA 1PWPA 2JSDA 4PKUA 1A86A 1OM7A 5L7FA 2AIGP 1GO7P 1KUFA 1ND1A 1HOVA 1GO8P 2JT5A 3HY9A 1SLMA 4JA1A 1EAKA 2CKIA 5H8XA 2MZHA 2MZIA 4AXQA 1K7GA 2D1NA 3O64A 4QKZA 3USNA 4IN9A 3LMCA 4H30A 2WO9A 1R1IA 3AIGA 5B5PA 2E2DA 4PKQA 2HU6A 3F15A 4GR3A 2PJTA 1YOUA 3NX7A 1QIAA 1H71P 2DW2A 1RM8A 3ELMA 3KECA 1XFUA 1BKCE 4I03A 3WV1A 1ZXVA 4H1QA 4I35A 1JAPA 1C3IA 2D1OA 3F1AA 4JIJA 2SRTA 2CLTA 3LILA 3LJTA 1XFXA 3HYGA 4A7BA 1UMTA 1JK3A 1D8MA 3KWVC 4XM7A 5CUHA 1G12A 2AYKA 5D1UA 3N2VA 1CK7A 1YCMA 3OHLA 2X3AA 3LUNA 4H84A 1HFCA 1D8FA 1XFWA 4GUYA 1BUDA 830CA 1Z3JA 4J4MA 1HFSA 1CGLA 1DTHA 3I7GA 5D1SA 2W15A 4WKEA 3MA2A 3F18A 2O36A 1QJJA 1HTDA 5I2ZA 1QICA 3LKAA 1SU3A 3U1RA 4ILWD 3I7IA 2ERPA 4HMAA 1QUAA 1XUCA 2FV9A 1I73A 1IADA 1YQYA 4IUWA 5D3CA 2E3XA
chains in the Genus database with same CATH superfamily
3Q2GA 2OW2A 2XS4A 2DDFA 2QPJA 3G5CA 1GKDA 1CGEA 2OZRA 4XM6A 5I0LA 1MMRA 1OS2A 1R55A 4WZVA 1BIWA 2L0RA 1BKCA 1C8TA 3B92A 3HY7A 3LQBA 3VI1A 1SLNA 1XUDA 1CIZA 1UTTA 1BQOA 3SHIA 3DTIA 2JT6A 1R1JA 2XS3A 1B8YA 5L79A 1PWUA 3V96B 4AUOA 3P24A 1CQRA 2MLSA 4GR0A 4PKTA 3TT4A 3EWJA 1BUVM 3ZVSA 1OO9A 5B5OA 1XFVA 1Y8JA 4FXQA 2W0DA 3EHYA 3TVCA 4CTHA 1ZP5A 5CXAA 3EDGA 3LJZA 4DPEA 1ZVXA 2JNPA 2W13A 1G4KA 4FXYP 2OW1A 2W14A 1UEAA 4FU4A 5I4OA 3GBOA 1EB6A 1UTZA 4L7AA 1ATLA 3KMCA 1R1HA 3HDBA 1D7XA 4DD8A 3O2XA 2USNA 5I3MA 2DW0A 2ERQA 2A8HA 3EHXA 3LJGA 1SMPA 3B2ZA 1JANA 2Z2DA 1JAOA 1BZSA 4ON1A 5D2BA 5D1TA 1L6JA 2J0TA 1YP1A 1OS9A 2X3BA 1CAQA 3EDHA 2J83A 1MNCA 3DTEA 1XFYA 2OW9A 2YB9A 2Y6DA 1FM1A 3AYUA 3KHIA 5JMYA 4GR8A 3DWBA 5D7WA 4DV8A 1BM6A 3DPFA 3LK8A 3VTGA 2O3EA 3F19A 1FBLA 4AYKA 1JIZA 3DTKA 1SATA 3LEAA 1UMSA 2JIHA 1I1IP 1JIWP 1XM5A 1CGFA 3WV2A 2EROA 1HY7A 3F16A 1A85A 4G9LA 1WNIA 1J7NA 3TSKA 2W12A 1TVIA 1OMJA 3N2UA 2RJPA 4Q1LA 2V4BA 1BSWA 1XURA 1IACA 1SRPA 2OY4A 1FLSA 4IJOA 1IABA 1PWWA 1ROSA 1I76A 4XM8A 4WK7A 1JKYA 3RTTA 2YIGA 3LGPA 4PKRA 1KUKA 3DPEA 1KBCA 5BPAA 2RJQA 3B8ZA 3E8RA 1XFZA 4DF9A 4L63A 1K7QA 2K2GA 5I12A 4AIGA 2POJA 3K7LA 3DNGA 2MZEA 5I43A 4JQGA 2OVXA 1OM6A 3L0TA 4XCTA 3L0VA 1S4BP 3HBVP 3KMEA 5LABA 1R54A 4WKIA 2TCLA 1IAGA 2X3CA 1Y93A 4GWMA 4GF1A 3LQ0A 2OXZA 3OHOA 3CKIA 1D5JA 2FV5A 3DSLA 1CXVA 4XBHA 1AF0A 1MMBA 1PWQA 1ZTQA 3K7NA 3ZXHA 2DDYA 1QJIA 3LUMA 1GE5A 1GKCA 4GWNA 456CA 5CZMA 4GQLA 4JP4A 1GE6A 3P1VA 4R3VA 1JAQA 3KRYA 2OVZA 1KUIA 1RMZA 2OY2A 3DL1A 4PKWA 2KRJA 1PWVA 4ZR5A 2DW1A 4H3XA 1Q3AA 4L19A 4FVLA 3UVCA 3LIRA 966CA 1BKCI 1KUGA 3AYKA 4H82A 2K9CA 4A3WA 2OXWA 1C7KA 3ZUKA 4EFSA 5BOYA 3LIKA 2YUFA 3EDZA 3HDAP 1G05A 4L6TA 1AYKA 1Y0VA 1HV5A 1O0TA 3F17A 4WF6A 1MMPA 2Y6CA 3HBUP 2WO8A 4H76A 2MLRA 4PKVA 4HX3A 4G0DA 3LE9A 3TS4A 3WV3A 4PKSA 2X7MA 1USNA 1EUBA 2OI0A 1GXDA 1JJ9A 1QIBA 1O0QA 1KAPP 3Q2HA 3RTSA 4H2EA 5BOTA 1JH1A 3HB2P 4JPAA 2WOAA 2OW0A 3KEKA 3EDIA 1K7IA 1ZS0A 1ZXCA 1OM8A 2I47A 1ASTA 1IAEA 1GE7A 3KEJA 1MMQA 1G9KA 4H49A 2N8RA 3BA0A 1KUHA 1DMTA 3G42A 1BQQM 2OXUA 1G49A 1AKLA 1IAAA 1B3DA 1PWPA 2JSDA 4PKUA 1A86A 1OM7A 5L7FA 2AIGP 1GO7P 1KUFA 1ND1A 1HOVA 1GO8P 2JT5A 3HY9A 1SLMA 4JA1A 1EAKA 2CKIA 5H8XA 2MZHA 2MZIA 4AXQA 1K7GA 2D1NA 3O64A 4QKZA 3USNA 4IN9A 3LMCA 4H30A 2WO9A 1R1IA 3AIGA 5B5PA 2E2DA 4PKQA 2HU6A 3F15A 4GR3A 2PJTA 1YOUA 3NX7A 1QIAA 1H71P 2DW2A 1RM8A 3ELMA 3KECA 1XFUA 1BKCE 4I03A 3WV1A 1ZXVA 4H1QA 1XAXA 4I35A 1JAPA 1C3IA 2D1OA 3F1AA 4JIJA 2SRTA 2CLTA 3LILA 3LJTA 1XFXA 3HYGA 4A7BA 1UMTA 1JK3A 1D8MA 3KWVC 4XM7A 5CUHA 1G12A 2AYKA 5D1UA 3N2VA 1CK7A 1YCMA 3OHLA 2X3AA 3LUNA 4H84A 1HFCA 1D8FA 1XFWA 4GUYA 1BUDA 830CA 1Z3JA 4J4MA 1HFSA 1CGLA 1DTHA 1OZ9A 3I7GA 5D1SA 2W15A 4WKEA 3MA2A 3F18A 2O36A 1QJJA 1HTDA 5I2ZA 1QICA 3LKAA 1SU3A 3U1RA 4ILWD 3I7IA 2ERPA 4HMAA 1QUAA 1XUCA 2FV9A 1I73A 1IADA 1YQYA 4IUWA 5D3CA 2E3XA
chains in the Genus database with same CATH topology
3Q2GA 2OW2A 2XS4A 2DDFA 2QPJA 3G5CA 1GKDA 1CGEA 2OZRA 4XM6A 5I0LA 1MMRA 1OS2A 1R55A 4WZVA 1BIWA 2L0RA 1BKCA 1C8TA 3B92A 3HY7A 3LQBA 3VI1A 1SLNA 1XUDA 1CIZA 1UTTA 1BQOA 3SHIA 3DTIA 2JT6A 1R1JA 2XS3A 1B8YA 5L79A 1PWUA 3V96B 4AUOA 3P24A 1CQRA 2MLSA 4GR0A 4PKTA 3TT4A 3EWJA 1BUVM 3ZVSA 1OO9A 5B5OA 1XFVA 1Y8JA 4FXQA 2W0DA 3EHYA 3TVCA 4CTHA 1ZP5A 5CXAA 3EDGA 3LJZA 4DPEA 1ZVXA 2JNPA 2W13A 1G4KA 4FXYP 2OW1A 2W14A 1UEAA 4FU4A 5I4OA 3GBOA 1EB6A 1UTZA 4L7AA 1ATLA 3KMCA 1R1HA 3HDBA 1D7XA 4DD8A 3O2XA 2USNA 5I3MA 2DW0A 2ERQA 2A8HA 3LJGA 3EHXA 1SMPA 3B2ZA 1JANA 2Z2DA 1JAOA 1BZSA 4ON1A 5D2BA 5D1TA 1L6JA 2J0TA 1YP1A 1OS9A 2X3BA 1CAQA 3EDHA 2J83A 1MNCA 3DTEA 1XFYA 2OW9A 2YB9A 2Y6DA 1FM1A 3AYUA 3KHIA 5JMYA 4GR8A 3DWBA 5D7WA 4DV8A 1BM6A 3DPFA 3LK8A 3VTGA 2O3EA 3F19A 1FBLA 4AYKA 1JIZA 3DTKA 1SATA 3LEAA 1UMSA 2JIHA 1I1IP 1JIWP 1CGFA 3WV2A 2EROA 1HY7A 3F16A 1A85A 4G9LA 1WNIA 1J7NA 3TSKA 2W12A 1OMJA 3N2UA 2RJPA 4Q1LA 2V4BA 1BSWA 1XURA 1IACA 1SRPA 2OY4A 1FLSA 4IJOA 1IABA 1PWWA 1ROSA 1I76A 4XM8A 4WK7A 1JKYA 3RTTA 2YIGA 3LGPA 4PKRA 1KUKA 3DPEA 1KBCA 5BPAA 2RJQA 3B8ZA 3E8RA 1XFZA 4DF9A 4L63A 1K7QA 2K2GA 5I12A 4AIGA 2POJA 3K7LA 3DNGA 2MZEA 5I43A 4JQGA 2OVXA 1OM6A 3L0TA 4XCTA 3L0VA 1S4BP 3HBVP 3KMEA 5LABA 1R54A 4WKIA 2TCLA 1IAGA 2X3CA 1Y93A 4GWMA 4GF1A 3LQ0A 2OXZA 3OHOA 3CKIA 1D5JA 2FV5A 3DSLA 1CXVA 4XBHA 1AF0A 1MMBA 1PWQA 1ZTQA 3K7NA 3ZXHA 2DDYA 1QJIA 3LUMA 1GE5A 1GKCA 4GWNA 456CA 5CZMA 4GQLA 4JP4A 1GE6A 3P1VA 4R3VA 1JAQA 3KRYA 2OVZA 1KUIA 1RMZA 2OY2A 3DL1A 4PKWA 2KRJA 1PWVA 4ZR5A 2DW1A 4H3XA 1Q3AA 4L19A 4FVLA 3UVCA 3LIRA 966CA 1BKCI 1KUGA 3AYKA 4H82A 2K9CA 4A3WA 2OXWA 1C7KA 3ZUKA 4EFSA 5BOYA 3LIKA 2YUFA 3EDZA 3HDAP 1G05A 4L6TA 1AYKA 1Y0VA 1HV5A 1O0TA 3F17A 4WF6A 1MMPA 2Y6CA 3HBUP 2WO8A 4H76A 2MLRA 4PKVA 4HX3A 4G0DA 3LE9A 3TS4A 3WV3A 4PKSA 2X7MA 1USNA 1EUBA 2OI0A 1GXDA 1JJ9A 1QIBA 1O0QA 1KAPP 3Q2HA 3RTSA 4H2EA 5BOTA 1JH1A 3HB2P 4JPAA 2WOAA 2OW0A 3KEKA 3EDIA 1K7IA 1ZS0A 1ZXCA 1OM8A 2I47A 1ASTA 1IAEA 1GE7A 3KEJA 1MMQA 1G9KA 4H49A 2N8RA 3BA0A 1KUHA 1DMTA 3G42A 1BQQM 2OXUA 1G49A 1AKLA 1IAAA 1B3DA 1PWPA 2JSDA 4PKUA 1A86A 1OM7A 5L7FA 2AIGP 1GO7P 1KUFA 1ND1A 1HOVA 1GO8P 2JT5A 3HY9A 1SLMA 4JA1A 1EAKA 2CKIA 5H8XA 2MZHA 2MZIA 4AXQA 1K7GA 2D1NA 3O64A 4QKZA 3USNA 4IN9A 3LMCA 4H30A 2WO9A 1R1IA 3AIGA 5B5PA 2E2DA 4PKQA 2HU6A 3F15A 4GR3A 2PJTA 1YOUA 3NX7A 1QIAA 1H71P 2DW2A 1RM8A 3ELMA 3KECA 1XFUA 1BKCE 4I03A 3WV1A 1ZXVA 4H1QA 4I35A 1JAPA 1C3IA 2D1OA 3F1AA 4JIJA 2SRTA 2CLTA 3LILA 3LJTA 1XFXA 3HYGA 4A7BA 1UMTA 1JK3A 1D8MA 3KWVC 4XM7A 5CUHA 1G12A 2AYKA 5D1UA 3N2VA 1CK7A 1YCMA 3OHLA 2X3AA 3LUNA 4H84A 1HFCA 1D8FA 1XFWA 4GUYA 1BUDA 830CA 1Z3JA 4J4MA 1HFSA 1CGLA 1DTHA 3I7GA 5D1SA 2W15A 4WKEA 3MA2A 3F18A 2O36A 1QJJA 1HTDA 5I2ZA 1QICA 3LKAA 1SU3A 3U1RA 4ILWD 3I7IA 2ERPA 4HMAA 1QUAA 1XUCA 2FV9A 1I73A 1IADA 1YQYA 4IUWA 5D3CA 2E3XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q2G A;  2OW2 A;  2XS4 A;  2DDF A;  2QPJ A;  3G5C A;  1GKD A;  1CGE A;  2OZR A;  4XM6 A;  5I0L A;  1MMR A;  1OS2 A;  1R55 A;  4WZV A;  1BIW A;  2L0R A;  1BKC A;  1C8T A;  3B92 A;  3HY7 A;  3LQB A;  3VI1 A;  1SLN A;  1XUD A;  1CIZ A;  1UTT A;  1BQO A;  3SHI A;  2JT6 A;  1R1J A;  2XS3 A;  1B8Y A;  5L79 A;  1PWU A;  3V96 B;  4AUO A;  3P24 A;  1CQR A;  2MLS A;  4GR0 A;  4PKT A;  3TT4 A;  3EWJ A;  1BUV M;  3ZVS A;  1OO9 A;  5B5O A;  1XFV A;  1Y8J A;  4FXQ A;  2W0D A;  3EHY A;  3TVC A;  4CTH A;  1ZP5 A;  5CXA A;  3EDG A;  3LJZ A;  4DPE A;  1ZVX A;  2JNP A;  2W13 A;  1G4K A;  4FXY P;  2OW1 A;  2W14 A;  1UEA A;  4FU4 A;  5I4O A;  3GBO A;  1EB6 A;  1UTZ A;  1ATL A;  3KMC A;  1R1H A;  3HDB A;  1D7X A;  4DD8 A;  3O2X A;  2USN A;  5I3M A;  2DW0 A;  2ERQ A;  2A8H A;  3LJG A;  3EHX A;  1SMP A;  3B2Z A;  1JAN A;  2Z2D A;  1JAO A;  1BZS A;  4ON1 A;  5D2B A;  5D1T A;  1L6J A;  2J0T A;  1YP1 A;  1OS9 A;  2X3B A;  1CAQ A;  3EDH A;  2J83 A;  1MNC A;  1XFY A;  2OW9 A;  2YB9 A;  2Y6D A;  1FM1 A;  3AYU A;  3KHI A;  5JMY A;  4GR8 A;  3DWB A;  5D7W A;  4DV8 A;  1BM6 A;  3DPF A;  3LK8 A;  3VTG A;  2O3E A;  3F19 A;  1FBL A;  4AYK A;  1JIZ A;  1SAT A;  3LEA A;  1UMS A;  2JIH A;  1I1I P;  1JIW P;  1CGF A;  3WV2 A;  2ERO A;  1HY7 A;  3F16 A;  1A85 A;  4G9L A;  1WNI A;  1J7N A;  3TSK A;  2W12 A;  1OMJ A;  3N2U A;  2RJP A;  4Q1L A;  2V4B A;  1BSW A;  1XUR A;  1IAC A;  1SRP A;  2OY4 A;  1FLS A;  4IJO A;  1IAB A;  1PWW A;  1ROS A;  1I76 A;  4XM8 A;  4WK7 A;  1JKY A;  3RTT A;  2YIG A;  3LGP A;  4PKR A;  1KUK A;  3DPE A;  1KBC A;  5BPA A;  2RJQ A;  3B8Z A;  3E8R A;  1XFZ A;  4DF9 A;  4L63 A;  1K7Q A;  2K2G A;  5I12 A;  4AIG A;  2POJ A;  3K7L A;  3DNG A;  2MZE A;  5I43 A;  4JQG A;  2OVX A;  1OM6 A;  3L0T A;  4XCT A;  3L0V A;  1S4B P;  3HBV P;  3KME A;  5LAB A;  1R54 A;  4WKI A;  2TCL A;  1IAG A;  2X3C A;  1Y93 A;  4GWM A;  4GF1 A;  3LQ0 A;  2OXZ A;  3OHO A;  3CKI A;  1D5J A;  2FV5 A;  3DSL A;  1CXV A;  4XBH A;  1AF0 A;  1MMB A;  1PWQ A;  1ZTQ A;  3K7N A;  3ZXH A;  2DDY A;  1QJI A;  3LUM A;  1GE5 A;  1GKC A;  4GWN A;  456C A;  5CZM A;  4GQL A;  4JP4 A;  1GE6 A;  3P1V A;  4R3V A;  1JAQ A;  3KRY A;  2OVZ A;  1KUI A;  1RMZ A;  2OY2 A;  3DL1 A;  4PKW A;  2KRJ A;  1PWV A;  4ZR5 A;  2DW1 A;  4H3X A;  1Q3A A;  4L19 A;  4FVL A;  3UVC A;  3LIR A;  966C A;  1BKC I;  1KUG A;  3AYK A;  4H82 A;  2K9C A;  4A3W A;  2OXW A;  1C7K A;  3ZUK A;  4EFS A;  5BOY A;  3LIK A;  3EDZ A;  3HDA P;  1G05 A;  4L6T A;  1AYK A;  1Y0V A;  1HV5 A;  1O0T A;  3F17 A;  4WF6 A;  1MMP A;  2Y6C A;  3HBU P;  2WO8 A;  4H76 A;  2MLR A;  4PKV A;  4HX3 A;  4G0D A;  3LE9 A;  3TS4 A;  3WV3 A;  4PKS A;  2X7M A;  1USN A;  1EUB A;  2OI0 A;  1GXD A;  1JJ9 A;  1QIB A;  1O0Q A;  1KAP P;  3Q2H A;  3RTS A;  4H2E A;  5BOT A;  1JH1 A;  3HB2 P;  4JPA A;  2WOA A;  2OW0 A;  3KEK A;  3EDI A;  1K7I A;  1ZS0 A;  1ZXC A;  1OM8 A;  2I47 A;  1AST A;  1IAE A;  1GE7 A;  3KEJ A;  1MMQ A;  1G9K A;  4H49 A;  2N8R A;  3BA0 A;  1KUH A;  1DMT A;  3G42 A;  1BQQ M;  2OXU A;  1G49 A;  1AKL A;  1IAA A;  1B3D A;  1PWP A;  2JSD A;  4PKU A;  1A86 A;  1OM7 A;  5L7F A;  2AIG P;  1GO7 P;  1KUF A;  1ND1 A;  1HOV A;  1GO8 P;  2JT5 A;  3HY9 A;  1SLM A;  4JA1 A;  1EAK A;  2CKI A;  5H8X A;  2MZH A;  2MZI A;  4AXQ A;  1K7G A;  2D1N A;  3O64 A;  4QKZ A;  3USN A;  4IN9 A;  3LMC A;  4H30 A;  2WO9 A;  1R1I A;  3AIG A;  5B5P A;  2E2D A;  4PKQ A;  2HU6 A;  3F15 A;  4GR3 A;  2PJT A;  1YOU A;  3NX7 A;  1QIA A;  1H71 P;  2DW2 A;  1RM8 A;  3ELM A;  3KEC A;  1XFU A;  1BKC E;  4I03 A;  3WV1 A;  1ZXV A;  4H1Q A;  4I35 A;  1JAP A;  1C3I A;  2D1O A;  3F1A A;  4JIJ A;  2SRT A;  2CLT A;  3LIL A;  3LJT A;  1XFX A;  3HYG A;  4A7B A;  1UMT A;  1JK3 A;  1D8M A;  3KWV C;  4XM7 A;  5CUH A;  1G12 A;  2AYK A;  5D1U A;  3N2V A;  1CK7 A;  1YCM A;  3OHL A;  2X3A A;  3LUN A;  4H84 A;  1HFC A;  1D8F A;  1XFW A;  4GUY A;  1BUD A;  830C A;  1Z3J A;  4J4M A;  1HFS A;  1CGL A;  1DTH A;  3I7G A;  5D1S A;  2W15 A;  4WKE A;  3MA2 A;  3F18 A;  2O36 A;  1QJJ A;  1HTD A;  5I2Z A;  1QIC A;  3LKA A;  1SU3 A;  3U1R A;  4ILW D;  3I7I A;  2ERP A;  4HMA A;  1QUA A;  1XUC A;  2FV9 A;  1I73 A;  1IAD A;  1YQY A;  4IUW A;  5D3C A;  2E3X A; 
#chains in the Genus database with same CATH topology
 3Q2G A;  2OW2 A;  2XS4 A;  2DDF A;  2QPJ A;  3G5C A;  1GKD A;  1CGE A;  2OZR A;  4XM6 A;  5I0L A;  1MMR A;  1OS2 A;  1R55 A;  4WZV A;  1BIW A;  2L0R A;  1BKC A;  1C8T A;  3B92 A;  3HY7 A;  3LQB A;  3VI1 A;  1SLN A;  1XUD A;  1CIZ A;  1UTT A;  1BQO A;  3SHI A;  3DTI A;  2JT6 A;  1R1J A;  2XS3 A;  1B8Y A;  5L79 A;  1PWU A;  3V96 B;  4AUO A;  3P24 A;  1CQR A;  2MLS A;  4GR0 A;  4PKT A;  3TT4 A;  3EWJ A;  1BUV M;  3ZVS A;  1OO9 A;  5B5O A;  1XFV A;  1Y8J A;  4FXQ A;  2W0D A;  3EHY A;  3TVC A;  4CTH A;  1ZP5 A;  5CXA A;  3EDG A;  3LJZ A;  4DPE A;  1ZVX A;  2JNP A;  2W13 A;  1G4K A;  4FXY P;  2OW1 A;  2W14 A;  1UEA A;  4FU4 A;  5I4O A;  3GBO A;  1EB6 A;  1UTZ A;  4L7A A;  1ATL A;  3KMC A;  1R1H A;  3HDB A;  1D7X A;  4DD8 A;  3O2X A;  2USN A;  5I3M A;  2DW0 A;  2ERQ A;  2A8H A;  3EHX A;  3LJG A;  1SMP A;  3B2Z A;  1JAN A;  2Z2D A;  1JAO A;  1BZS A;  4ON1 A;  5D2B A;  5D1T A;  1L6J A;  2J0T A;  1YP1 A;  1OS9 A;  2X3B A;  1CAQ A;  3EDH A;  2J83 A;  1MNC A;  3DTE A;  1XFY A;  2OW9 A;  2YB9 A;  2Y6D A;  1FM1 A;  3AYU A;  3KHI A;  5JMY A;  4GR8 A;  3DWB A;  5D7W A;  4DV8 A;  1BM6 A;  3DPF A;  3LK8 A;  3VTG A;  2O3E A;  3F19 A;  1FBL A;  4AYK A;  1JIZ A;  3DTK A;  1SAT A;  3LEA A;  1UMS A;  2JIH A;  1I1I P;  1JIW P;  1XM5 A;  1CGF A;  3WV2 A;  2ERO A;  1HY7 A;  3F16 A;  1A85 A;  4G9L A;  1WNI A;  1J7N A;  3TSK A;  2W12 A;  1TVI A;  1OMJ A;  3N2U A;  2RJP A;  4Q1L A;  2V4B A;  1BSW A;  1XUR A;  1IAC A;  1SRP A;  2OY4 A;  1FLS A;  4IJO A;  1IAB A;  1PWW A;  1ROS A;  1I76 A;  4XM8 A;  4WK7 A;  1JKY A;  3RTT A;  2YIG A;  3LGP A;  4PKR A;  1KUK A;  3DPE A;  1KBC A;  5BPA A;  2RJQ A;  3B8Z A;  3E8R A;  1XFZ A;  4DF9 A;  4L63 A;  1K7Q A;  2K2G A;  5I12 A;  4AIG A;  2POJ A;  3K7L A;  3DNG A;  2MZE A;  5I43 A;  4JQG A;  2OVX A;  1OM6 A;  3L0T A;  4XCT A;  3L0V A;  1S4B P;  3HBV P;  3KME A;  5LAB A;  1R54 A;  4WKI A;  2TCL A;  1IAG A;  2X3C A;  1Y93 A;  4GWM A;  4GF1 A;  3LQ0 A;  2OXZ A;  3OHO A;  3CKI A;  1D5J A;  2FV5 A;  3DSL A;  1CXV A;  4XBH A;  1AF0 A;  1MMB A;  1PWQ A;  1ZTQ A;  3K7N A;  3ZXH A;  2DDY A;  1QJI A;  3LUM A;  1GE5 A;  1GKC A;  4GWN A;  456C A;  5CZM A;  4GQL A;  4JP4 A;  1GE6 A;  3P1V A;  4R3V A;  1JAQ A;  3KRY A;  2OVZ A;  1KUI A;  1RMZ A;  2OY2 A;  3DL1 A;  4PKW A;  2KRJ A;  1PWV A;  4ZR5 A;  2DW1 A;  4H3X A;  1Q3A A;  4L19 A;  4FVL A;  3UVC A;  3LIR A;  966C A;  1BKC I;  1KUG A;  3AYK A;  4H82 A;  2K9C A;  4A3W A;  2OXW A;  1C7K A;  3ZUK A;  4EFS A;  5BOY A;  3LIK A;  2YUF A;  3EDZ A;  3HDA P;  1G05 A;  4L6T A;  1AYK A;  1Y0V A;  1HV5 A;  1O0T A;  3F17 A;  4WF6 A;  1MMP A;  2Y6C A;  3HBU P;  2WO8 A;  4H76 A;  2MLR A;  4PKV A;  4HX3 A;  4G0D A;  3LE9 A;  3TS4 A;  3WV3 A;  4PKS A;  2X7M A;  1USN A;  1EUB A;  2OI0 A;  1GXD A;  1JJ9 A;  1QIB A;  1O0Q A;  1KAP P;  3Q2H A;  3RTS A;  4H2E A;  5BOT A;  1JH1 A;  3HB2 P;  4JPA A;  2WOA A;  2OW0 A;  3KEK A;  3EDI A;  1K7I A;  1ZS0 A;  1ZXC A;  1OM8 A;  2I47 A;  1AST A;  1IAE A;  1GE7 A;  3KEJ A;  1MMQ A;  1G9K A;  4H49 A;  2N8R A;  3BA0 A;  1KUH A;  1DMT A;  3G42 A;  1BQQ M;  2OXU A;  1G49 A;  1AKL A;  1IAA A;  1B3D A;  1PWP A;  2JSD A;  4PKU A;  1A86 A;  1OM7 A;  5L7F A;  2AIG P;  1GO7 P;  1KUF A;  1ND1 A;  1HOV A;  1GO8 P;  2JT5 A;  3HY9 A;  1SLM A;  4JA1 A;  1EAK A;  2CKI A;  5H8X A;  2MZH A;  2MZI A;  4AXQ A;  1K7G A;  2D1N A;  3O64 A;  4QKZ A;  3USN A;  4IN9 A;  3LMC A;  4H30 A;  2WO9 A;  1R1I A;  3AIG A;  5B5P A;  2E2D A;  4PKQ A;  2HU6 A;  3F15 A;  4GR3 A;  2PJT A;  1YOU A;  3NX7 A;  1QIA A;  1H71 P;  2DW2 A;  1RM8 A;  3ELM A;  3KEC A;  1XFU A;  1BKC E;  4I03 A;  3WV1 A;  1ZXV A;  4H1Q A;  1XAX A;  4I35 A;  1JAP A;  1C3I A;  2D1O A;  3F1A A;  4JIJ A;  2SRT A;  2CLT A;  3LIL A;  3LJT A;  1XFX A;  3HYG A;  4A7B A;  1UMT A;  1JK3 A;  1D8M A;  3KWV C;  4XM7 A;  5CUH A;  1G12 A;  2AYK A;  5D1U A;  3N2V A;  1CK7 A;  1YCM A;  3OHL A;  2X3A A;  3LUN A;  4H84 A;  1HFC A;  1D8F A;  1XFW A;  4GUY A;  1BUD A;  830C A;  1Z3J A;  4J4M A;  1HFS A;  1CGL A;  1DTH A;  1OZ9 A;  3I7G A;  5D1S A;  2W15 A;  4WKE A;  3MA2 A;  3F18 A;  2O36 A;  1QJJ A;  1HTD A;  5I2Z A;  1QIC A;  3LKA A;  1SU3 A;  3U1R A;  4ILW D;  3I7I A;  2ERP A;  4HMA A;  1QUA A;  1XUC A;  2FV9 A;  1I73 A;  1IAD A;  1YQY A;  4IUW A;  5D3C A;  2E3X A; 
#chains in the Genus database with same CATH homology
 3Q2G A;  2OW2 A;  2XS4 A;  2DDF A;  2QPJ A;  3G5C A;  1GKD A;  1CGE A;  2OZR A;  4XM6 A;  5I0L A;  1MMR A;  1OS2 A;  1R55 A;  4WZV A;  1BIW A;  2L0R A;  1BKC A;  1C8T A;  3B92 A;  3HY7 A;  3LQB A;  3VI1 A;  1SLN A;  1XUD A;  1CIZ A;  1UTT A;  1BQO A;  3SHI A;  3DTI A;  2JT6 A;  1R1J A;  2XS3 A;  1B8Y A;  5L79 A;  1PWU A;  3V96 B;  4AUO A;  3P24 A;  1CQR A;  2MLS A;  4GR0 A;  4PKT A;  3TT4 A;  3EWJ A;  1BUV M;  3ZVS A;  1OO9 A;  5B5O A;  1XFV A;  1Y8J A;  4FXQ A;  2W0D A;  3EHY A;  3TVC A;  4CTH A;  1ZP5 A;  5CXA A;  3EDG A;  3LJZ A;  4DPE A;  1ZVX A;  2JNP A;  2W13 A;  1G4K A;  4FXY P;  2OW1 A;  2W14 A;  1UEA A;  4FU4 A;  5I4O A;  3GBO A;  1EB6 A;  1UTZ A;  4L7A A;  1ATL A;  3KMC A;  1R1H A;  3HDB A;  1D7X A;  4DD8 A;  3O2X A;  2USN A;  5I3M A;  2DW0 A;  2ERQ A;  2A8H A;  3LJG A;  3EHX A;  1SMP A;  3B2Z A;  1JAN A;  2Z2D A;  1JAO A;  1BZS A;  4ON1 A;  5D2B A;  5D1T A;  1L6J A;  2J0T A;  1YP1 A;  1OS9 A;  2X3B A;  1CAQ A;  3EDH A;  2J83 A;  1MNC A;  3DTE A;  1XFY A;  2OW9 A;  2YB9 A;  2Y6D A;  1FM1 A;  3AYU A;  3KHI A;  5JMY A;  4GR8 A;  3DWB A;  5D7W A;  4DV8 A;  1BM6 A;  3DPF A;  3LK8 A;  3VTG A;  2O3E A;  3F19 A;  1FBL A;  4AYK A;  1JIZ A;  3DTK A;  1SAT A;  3LEA A;  1UMS A;  2JIH A;  1I1I P;  1JIW P;  1CGF A;  3WV2 A;  2ERO A;  1HY7 A;  3F16 A;  1A85 A;  4G9L A;  1WNI A;  1J7N A;  3TSK A;  2W12 A;  1OMJ A;  3N2U A;  2RJP A;  4Q1L A;  2V4B A;  1BSW A;  1XUR A;  1IAC A;  1SRP A;  2OY4 A;  1FLS A;  4IJO A;  1IAB A;  1PWW A;  1ROS A;  1I76 A;  4XM8 A;  4WK7 A;  1JKY A;  3RTT A;  2YIG A;  3LGP A;  4PKR A;  1KUK A;  3DPE A;  1KBC A;  5BPA A;  2RJQ A;  3B8Z A;  3E8R A;  1XFZ A;  4DF9 A;  4L63 A;  1K7Q A;  2K2G A;  5I12 A;  4AIG A;  2POJ A;  3K7L A;  3DNG A;  2MZE A;  5I43 A;  4JQG A;  2OVX A;  1OM6 A;  3L0T A;  4XCT A;  3L0V A;  1S4B P;  3HBV P;  3KME A;  5LAB A;  1R54 A;  4WKI A;  2TCL A;  1IAG A;  2X3C A;  1Y93 A;  4GWM A;  4GF1 A;  3LQ0 A;  2OXZ A;  3OHO A;  3CKI A;  1D5J A;  2FV5 A;  3DSL A;  1CXV A;  4XBH A;  1AF0 A;  1MMB A;  1PWQ A;  1ZTQ A;  3K7N A;  3ZXH A;  2DDY A;  1QJI A;  3LUM A;  1GE5 A;  1GKC A;  4GWN A;  456C A;  5CZM A;  4GQL A;  4JP4 A;  1GE6 A;  3P1V A;  4R3V A;  1JAQ A;  3KRY A;  2OVZ A;  1KUI A;  1RMZ A;  2OY2 A;  3DL1 A;  4PKW A;  2KRJ A;  1PWV A;  4ZR5 A;  2DW1 A;  4H3X A;  1Q3A A;  4L19 A;  4FVL A;  3UVC A;  3LIR A;  966C A;  1BKC I;  1KUG A;  3AYK A;  4H82 A;  2K9C A;  4A3W A;  2OXW A;  1C7K A;  3ZUK A;  4EFS A;  5BOY A;  3LIK A;  2YUF A;  3EDZ A;  3HDA P;  1G05 A;  4L6T A;  1AYK A;  1Y0V A;  1HV5 A;  1O0T A;  3F17 A;  4WF6 A;  1MMP A;  2Y6C A;  3HBU P;  2WO8 A;  4H76 A;  2MLR A;  4PKV A;  4HX3 A;  4G0D A;  3LE9 A;  3TS4 A;  3WV3 A;  4PKS A;  2X7M A;  1USN A;  1EUB A;  2OI0 A;  1GXD A;  1JJ9 A;  1QIB A;  1O0Q A;  1KAP P;  3Q2H A;  3RTS A;  4H2E A;  5BOT A;  1JH1 A;  3HB2 P;  4JPA A;  2WOA A;  2OW0 A;  3KEK A;  3EDI A;  1K7I A;  1ZS0 A;  1ZXC A;  1OM8 A;  2I47 A;  1AST A;  1IAE A;  1GE7 A;  3KEJ A;  1MMQ A;  1G9K A;  4H49 A;  2N8R A;  3BA0 A;  1KUH A;  1DMT A;  3G42 A;  1BQQ M;  2OXU A;  1G49 A;  1AKL A;  1IAA A;  1B3D A;  1PWP A;  2JSD A;  4PKU A;  1A86 A;  1OM7 A;  5L7F A;  2AIG P;  1GO7 P;  1KUF A;  1ND1 A;  1HOV A;  1GO8 P;  2JT5 A;  3HY9 A;  1SLM A;  4JA1 A;  1EAK A;  2CKI A;  5H8X A;  2MZH A;  2MZI A;  4AXQ A;  1K7G A;  2D1N A;  3O64 A;  4QKZ A;  3USN A;  4IN9 A;  3LMC A;  4H30 A;  2WO9 A;  1R1I A;  3AIG A;  5B5P A;  2E2D A;  4PKQ A;  2HU6 A;  3F15 A;  4GR3 A;  2PJT A;  1YOU A;  3NX7 A;  1QIA A;  1H71 P;  2DW2 A;  1RM8 A;  3ELM A;  3KEC A;  1XFU A;  1BKC E;  4I03 A;  3WV1 A;  1ZXV A;  4H1Q A;  4I35 A;  1JAP A;  1C3I A;  2D1O A;  3F1A A;  4JIJ A;  2SRT A;  2CLT A;  3LIL A;  3LJT A;  1XFX A;  3HYG A;  4A7B A;  1UMT A;  1JK3 A;  1D8M A;  3KWV C;  4XM7 A;  5CUH A;  1G12 A;  2AYK A;  5D1U A;  3N2V A;  1CK7 A;  1YCM A;  3OHL A;  2X3A A;  3LUN A;  4H84 A;  1HFC A;  1D8F A;  1XFW A;  4GUY A;  1BUD A;  830C A;  1Z3J A;  4J4M A;  1HFS A;  1CGL A;  1DTH A;  3I7G A;  5D1S A;  2W15 A;  4WKE A;  3MA2 A;  3F18 A;  2O36 A;  1QJJ A;  1HTD A;  5I2Z A;  1QIC A;  3LKA A;  1SU3 A;  3U1R A;  4ILW D;  3I7I A;  2ERP A;  4HMA A;  1QUA A;  1XUC A;  2FV9 A;  1I73 A;  1IAD A;  1YQY A;  4IUW A;  5D3C A;  2E3X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...