1Y93A

Crystal structure of the catalytic domain of human mmp12 complexed with acetohydroxamic acid at atomic resolution
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
158
structure length
158
Chain Sequence
b'GPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDDHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Macrophage metalloelastase
publication title Conformational variability of matrix metalloproteinases: Beyond a single 3D structure
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 39
structure length 158
sequence length 158
ec nomenclature ec 3.4.24.65: Macrophage elastase.
pdb deposition date 2004-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1y93A00
1KUIA 2WO9A 3DPFA 2X3BA 4H49A 3NX7A 2FV9A 2J83A 4WKEA 5I12A 1IADA 3DPEA 2OXZA 1QICA 2DDYA 2N8RA 2YB9A 1PWQA 1HTDA 3CKIA 4XCTA 3HY9A 2HU6A 1EUBA 4H84A 1CK7A 2MZIA 2MLRA 2JT5A 3OHOA 1HFSA 1BUDA 5B5OA 1OM6A 2I47A 1C3IA 4L19A 1ZXVA 1O0TA 1BQQM 1ZS0A 1HV5A 1IAGA 1D5JA 3U1RA 1C7KA 1GXDA 1G4KA 2DDFA 1R1JA 3HBVP 1FLSA 4AUOA 3EHYA 5D1TA 2JIHA 1CGLA 1QIAA 2L0RA 2X7MA 2Y6CA 1XFUA 4H1QA 2XS3A 2DW0A 4PKVA 1IAAA 2JT6A 1PWUA 1BZSA 5I3MA 1KAPP 3KMCA 1Y93A 1PWWA 3K7LA 4AIGA 3DNGA 4PKWA 4JP4A 1ATLA 3LJZA 1Q3AA 2CKIA 3AIGA 2J0TA 3F17A 2AYKA 3LIRA 1EAKA 1R55A 1A86A 4GWNA 1USNA 1D8FA 3VTGA 1WNIA 2W13A 3HBUP 3F18A 2XS4A 4PKUA 2EROA 1KUFA 4I35A 2PJTA 1H71P 5D7WA 1PWVA 1XURA 3I7IA 2KRJA 1SLNA 1JIWP 1BSWA 5I2ZA 3P24A 3TSKA 4QKZA 3G42A 2POJA 2OZRA 1UMTA 2YIGA 3KRYA 4AXQA 1B3DA 1S4BP 4A7BA 1OM8A 4G0DA 1BKCA 3EDGA 4CTHA 4ZR5A 3LK8A 1ASTA 3EDHA 1I76A 1R1HA 1CQRA 1YQYA 1ROSA 3LE9A 3WV2A 3HDAP 1BM6A 1MNCA 2O3EA 2O36A 4L6TA 1BQOA 4H3XA 4I03A 1K7GA 1XFYA 1KUGA 3HYGA 4FU4A 1YCMA 1FBLA 3GBOA 966CA 3DWBA 2Z2DA 4G9LA 1L6JA 1I73A 1CXVA 1HFCA 1BKCI 2JNPA 1R54A 2W0DA 4FXQA 2Y6DA 4JPAA 3VI1A 3K7NA 1KBCA 1K7QA 3B8ZA 1G05A 1GKCA 3P1VA 1JAOA 456CA 3E8RA 3AYUA 3KWVC 1C8TA 1AF0A 3LMCA 4GF1A 3L0TA 5BOYA 3LIKA 3WV1A 1UEAA 4XM7A 1B8YA 4PKQA 4A3WA 2DW2A 1GE7A 5BOTA 3O64A 1SRPA 1BUVM 1XUCA 3HY7A 1CAQA 1JH1A 2E3XA 1MMPA 4ILWD 3LGPA 3DSLA 2TCLA 3EDZA 4J4MA 3LEAA 1SMPA 2OW2A 4DPEA 3LQBA 1JKYA 2OI0A 3N2UA 4XM8A 1I1IP 1ZVXA 3LJTA 1PWPA 1EB6A 2WO8A 2USNA 1D8MA 4XBHA 5CUHA 4FXYP 2OW9A 1JAPA 1KUKA 2V4BA 4JIJA 3LUMA 3G5CA 3ZUKA 2D1OA 5LABA 3EDIA 1ND1A 4WKIA 3F1AA 4DF9A 1RM8A 4GUYA 4HX3A 2K2GA 1BIWA 4L63A 1MMQA 2MZEA 1GE6A 1UTTA 3F15A 1D7XA 1A85A 2SRTA 2E2DA 3LJGA 4Q1LA 3ELMA 3L0VA 3TT4A 4EFSA 3HDBA 2ERQA 3OHLA 5L7FA 4PKSA 4JA1A 5JMYA 3EWJA 1GE5A 3ZXHA 1O0QA 5D1SA 1HY7A 1XFZA 1OM7A 3KECA 1GKDA 5BPAA 1DMTA 3USNA 1RMZA 4JQGA 2OVXA 2OW1A 3LKAA 1XFWA 3V96B 1QUAA 5D3CA 2W12A 3Q2GA 4WF6A 1AYKA 2ERPA 5I0LA 2MZHA 2OW0A 1XUDA 3AYKA 1YOUA 2AIGP 1AKLA 1ZTQA 2WOAA 1BKCE 1KUHA 5D2BA 2OXWA 1IACA 1GO8P 1QJJA 4XM6A 3SHIA 2K9CA 1QJIA 2QPJA 2OXUA 1GO7P 1QIBA 1CGEA 3RTSA 3N2VA 1J7NA 1OS2A 3MA2A 1K7IA 1ZP5A 4ON1A 830CA 2D1NA 1IAEA 4GWMA 1R1IA 1G12A 5D1UA 3B2ZA 5CXAA 3F16A 4R3VA 5CZMA 1SU3A 3I7GA 3KEKA 1JK3A 3EHXA 4H76A 3KHIA 1MMBA 4DV8A 2X3CA 2RJQA 3WV3A 4H2EA 1OS9A 1HOVA 4WZVA 1YP1A 2A8HA 1XFXA 1Z3JA 1SATA 4GR3A 3KMEA 2FV5A 1JIZA 4PKTA 3BA0A 2X3AA 1JJ9A 3HB2P 1XFVA 3LUNA 4GQLA 4IN9A 2RJPA 2JSDA 4IUWA 4DD8A 2DW1A 3O2XA 4GR8A 1SLMA 1CIZA 1UTZA 3KEJA 1Y8JA 3DL1A 3LQ0A 5B5PA 3Q2HA 3ZVSA 1ZXCA 5L79A 3RTTA 1DTHA 1IABA 2OY2A 4H30A 2OY4A 1FM1A 3B92A 4IJOA 2OVZA 5I4OA 1G49A 4HMAA 5I43A 3F19A 2W14A 4H82A 1Y0VA 2W15A 4WK7A 1JAQA 3TVCA 1UMSA 1OMJA 5H8XA 3UVCA 3TS4A 4AYKA 4PKRA 4FVLA 1OO9A 1G9KA 1MMRA 1CGFA 3LILA 1JANA 2CLTA 4GR0A 2MLSA
chains in the Genus database with same CATH superfamily
1KUIA 2WO9A 3DPFA 2X3BA 4H49A 3NX7A 2FV9A 2J83A 4WKEA 1XM5A 5I12A 1IADA 3DPEA 2OXZA 1QICA 2DDYA 2N8RA 2YB9A 1PWQA 1HTDA 3CKIA 4XCTA 3HY9A 2HU6A 1EUBA 4H84A 1CK7A 2MZIA 2MLRA 2JT5A 3OHOA 1HFSA 1BUDA 5B5OA 1OM6A 2I47A 1C3IA 4L19A 1ZXVA 1O0TA 1BQQM 1ZS0A 1HV5A 1IAGA 1D5JA 3U1RA 1C7KA 1GXDA 1G4KA 2DDFA 2YUFA 1R1JA 3HBVP 1FLSA 4AUOA 3EHYA 5D1TA 2JIHA 1CGLA 1QIAA 2L0RA 2X7MA 2Y6CA 1XFUA 4H1QA 2XS3A 2DW0A 4PKVA 1IAAA 2JT6A 1PWUA 1BZSA 5I3MA 1KAPP 3KMCA 1Y93A 1PWWA 3K7LA 4AIGA 3DNGA 4PKWA 4JP4A 1ATLA 3LJZA 1Q3AA 2CKIA 3AIGA 2J0TA 3F17A 2AYKA 3LIRA 1EAKA 1R55A 1A86A 4GWNA 1USNA 1D8FA 3VTGA 1WNIA 2W13A 3HBUP 3F18A 2XS4A 4PKUA 2EROA 1KUFA 4I35A 2PJTA 1H71P 5D7WA 1PWVA 1XURA 3I7IA 2KRJA 1SLNA 1JIWP 1BSWA 5I2ZA 3P24A 3TSKA 4QKZA 3DTKA 3G42A 2POJA 2OZRA 1UMTA 2YIGA 3KRYA 4AXQA 1B3DA 1S4BP 4A7BA 1OM8A 4G0DA 1BKCA 3EDGA 4CTHA 4ZR5A 3LK8A 1ASTA 1TVIA 3EDHA 1I76A 1R1HA 1CQRA 1YQYA 1ROSA 3LE9A 3WV2A 3HDAP 1BM6A 1MNCA 2O3EA 2O36A 4L6TA 1BQOA 4H3XA 4I03A 1K7GA 1XFYA 1KUGA 3HYGA 4FU4A 1YCMA 1FBLA 3GBOA 966CA 3DWBA 2Z2DA 4G9LA 1L6JA 1I73A 1CXVA 1HFCA 1BKCI 2JNPA 1R54A 2W0DA 4FXQA 2Y6DA 4JPAA 3VI1A 3K7NA 1KBCA 1K7QA 3B8ZA 1G05A 1GKCA 3P1VA 1JAOA 456CA 3E8RA 3AYUA 3KWVC 1C8TA 1AF0A 3LMCA 4GF1A 3L0TA 5BOYA 3LIKA 3WV1A 1UEAA 4XM7A 1B8YA 4PKQA 4A3WA 2DW2A 1GE7A 5BOTA 3O64A 1SRPA 1BUVM 3DTIA 1XUCA 3HY7A 1CAQA 1JH1A 2E3XA 1MMPA 4ILWD 3LGPA 3DSLA 2TCLA 3EDZA 4J4MA 3LEAA 1SMPA 2OW2A 4DPEA 3LQBA 1JKYA 2OI0A 1OZ9A 3N2UA 4XM8A 1I1IP 1ZVXA 3LJTA 1PWPA 1EB6A 2WO8A 2USNA 1D8MA 4XBHA 5CUHA 4FXYP 2OW9A 1JAPA 1KUKA 2V4BA 4JIJA 3LUMA 3G5CA 3ZUKA 2D1OA 5LABA 3EDIA 1XAXA 1ND1A 4WKIA 3F1AA 4DF9A 1RM8A 4GUYA 4HX3A 2K2GA 1BIWA 4L63A 1MMQA 2MZEA 1GE6A 1UTTA 3F15A 1D7XA 1A85A 2SRTA 2E2DA 3LJGA 4Q1LA 3ELMA 3L0VA 3TT4A 4EFSA 3HDBA 2ERQA 3OHLA 5L7FA 4PKSA 4JA1A 5JMYA 3EWJA 1GE5A 3ZXHA 1O0QA 5D1SA 1HY7A 1XFZA 1OM7A 3KECA 1GKDA 5BPAA 4L7AA 1DMTA 3USNA 1RMZA 4JQGA 2OVXA 2OW1A 3LKAA 1XFWA 3V96B 1QUAA 5D3CA 2W12A 3Q2GA 4WF6A 1AYKA 2ERPA 5I0LA 2MZHA 2OW0A 1XUDA 3AYKA 1YOUA 2AIGP 1AKLA 1ZTQA 2WOAA 1BKCE 1KUHA 5D2BA 2OXWA 1IACA 1GO8P 1QJJA 4XM6A 3SHIA 2K9CA 1QJIA 2QPJA 2OXUA 1GO7P 1QIBA 1CGEA 3RTSA 3N2VA 1J7NA 1OS2A 3MA2A 1K7IA 1ZP5A 4ON1A 830CA 2D1NA 1IAEA 4GWMA 1R1IA 1G12A 5D1UA 3B2ZA 5CXAA 3F16A 4R3VA 5CZMA 1SU3A 3I7GA 3KEKA 1JK3A 3EHXA 4H76A 3KHIA 1MMBA 4DV8A 2X3CA 2RJQA 3WV3A 4H2EA 1OS9A 1HOVA 4WZVA 1YP1A 2A8HA 1XFXA 1Z3JA 1SATA 4GR3A 3KMEA 2FV5A 1JIZA 4PKTA 3BA0A 2X3AA 1JJ9A 3HB2P 1XFVA 3LUNA 4GQLA 4IN9A 2RJPA 2JSDA 4IUWA 4DD8A 2DW1A 3O2XA 4GR8A 1SLMA 1CIZA 1UTZA 3KEJA 1Y8JA 3DL1A 3LQ0A 5B5PA 3Q2HA 3ZVSA 1ZXCA 5L79A 3RTTA 1DTHA 1IABA 2OY2A 4H30A 2OY4A 1FM1A 3B92A 4IJOA 2OVZA 5I4OA 1G49A 4HMAA 5I43A 3F19A 2W14A 4H82A 1Y0VA 2W15A 4WK7A 1JAQA 3TVCA 1UMSA 1OMJA 3DTEA 5H8XA 3UVCA 3TS4A 4AYKA 4PKRA 4FVLA 1OO9A 1G9KA 1MMRA 1CGFA 3LILA 1JANA 2CLTA 4GR0A 2MLSA
chains in the Genus database with same CATH topology
1KUIA 2WO9A 3DPFA 2X3BA 4H49A 3NX7A 2FV9A 2J83A 4WKEA 5I12A 1IADA 3DPEA 2OXZA 1QICA 2DDYA 2N8RA 2YB9A 1PWQA 1HTDA 3CKIA 4XCTA 3HY9A 2HU6A 1EUBA 4H84A 1CK7A 2MZIA 2MLRA 2JT5A 3OHOA 1HFSA 1BUDA 5B5OA 1OM6A 2I47A 1C3IA 4L19A 1ZXVA 1O0TA 1BQQM 1ZS0A 1HV5A 1IAGA 1D5JA 3U1RA 1C7KA 1GXDA 1G4KA 2DDFA 2YUFA 1R1JA 3HBVP 1FLSA 4AUOA 3EHYA 5D1TA 2JIHA 1CGLA 1QIAA 2L0RA 2X7MA 2Y6CA 1XFUA 4H1QA 2XS3A 2DW0A 4PKVA 1IAAA 2JT6A 1PWUA 1BZSA 5I3MA 1KAPP 3KMCA 1Y93A 1PWWA 3K7LA 4AIGA 3DNGA 4PKWA 4JP4A 1ATLA 3LJZA 1Q3AA 2CKIA 3AIGA 2J0TA 3F17A 2AYKA 3LIRA 1EAKA 1R55A 1A86A 4GWNA 1USNA 1D8FA 3VTGA 1WNIA 2W13A 3HBUP 3F18A 2XS4A 4PKUA 2EROA 1KUFA 4I35A 2PJTA 1H71P 5D7WA 1PWVA 1XURA 3I7IA 2KRJA 1SLNA 1JIWP 1BSWA 5I2ZA 3P24A 3TSKA 4QKZA 3DTKA 3G42A 2POJA 2OZRA 1UMTA 2YIGA 3KRYA 4AXQA 1B3DA 1S4BP 4A7BA 1OM8A 4G0DA 1BKCA 3EDGA 4CTHA 4ZR5A 3LK8A 1ASTA 3EDHA 1I76A 1R1HA 1CQRA 1YQYA 1ROSA 3LE9A 3WV2A 3HDAP 1BM6A 1MNCA 2O3EA 2O36A 4L6TA 1BQOA 4H3XA 4I03A 1K7GA 1XFYA 1KUGA 3HYGA 4FU4A 1YCMA 1FBLA 3GBOA 966CA 3DWBA 2Z2DA 4G9LA 1L6JA 1I73A 1CXVA 1HFCA 1BKCI 2JNPA 1R54A 2W0DA 4FXQA 2Y6DA 4JPAA 3VI1A 3K7NA 1KBCA 1K7QA 3B8ZA 1G05A 1GKCA 3P1VA 1JAOA 456CA 3E8RA 3AYUA 3KWVC 1C8TA 1AF0A 3LMCA 4GF1A 3L0TA 5BOYA 3LIKA 3WV1A 1UEAA 4XM7A 1B8YA 4PKQA 4A3WA 2DW2A 1GE7A 5BOTA 3O64A 1SRPA 1BUVM 3DTIA 1XUCA 3HY7A 1CAQA 1JH1A 2E3XA 1MMPA 4ILWD 3LGPA 3DSLA 2TCLA 3EDZA 4J4MA 3LEAA 1SMPA 2OW2A 4DPEA 3LQBA 1JKYA 2OI0A 3N2UA 4XM8A 1I1IP 1ZVXA 3LJTA 1PWPA 1EB6A 2WO8A 2USNA 1D8MA 4XBHA 5CUHA 4FXYP 2OW9A 1JAPA 1KUKA 2V4BA 4JIJA 3LUMA 3G5CA 3ZUKA 2D1OA 5LABA 3EDIA 1ND1A 4WKIA 3F1AA 4DF9A 1RM8A 4GUYA 4HX3A 2K2GA 1BIWA 4L63A 1MMQA 2MZEA 1GE6A 1UTTA 3F15A 1D7XA 1A85A 2SRTA 2E2DA 3LJGA 4Q1LA 3ELMA 3L0VA 3TT4A 4EFSA 3HDBA 2ERQA 3OHLA 5L7FA 4PKSA 4JA1A 5JMYA 3EWJA 1GE5A 3ZXHA 1O0QA 5D1SA 1HY7A 1XFZA 1OM7A 3KECA 1GKDA 5BPAA 4L7AA 1DMTA 3USNA 1RMZA 4JQGA 2OVXA 2OW1A 3LKAA 1XFWA 3V96B 1QUAA 5D3CA 2W12A 3Q2GA 4WF6A 1AYKA 2ERPA 5I0LA 2MZHA 2OW0A 1XUDA 3AYKA 1YOUA 2AIGP 1AKLA 1ZTQA 2WOAA 1BKCE 1KUHA 5D2BA 2OXWA 1IACA 1GO8P 1QJJA 4XM6A 3SHIA 2K9CA 1QJIA 2QPJA 2OXUA 1GO7P 1QIBA 1CGEA 3RTSA 3N2VA 1J7NA 1OS2A 3MA2A 1K7IA 1ZP5A 4ON1A 830CA 2D1NA 1IAEA 4GWMA 1R1IA 1G12A 5D1UA 3B2ZA 5CXAA 3F16A 4R3VA 5CZMA 1SU3A 3I7GA 3KEKA 1JK3A 3EHXA 4H76A 3KHIA 1MMBA 4DV8A 2X3CA 2RJQA 3WV3A 4H2EA 1OS9A 1HOVA 4WZVA 1YP1A 2A8HA 1XFXA 1Z3JA 1SATA 4GR3A 3KMEA 2FV5A 1JIZA 4PKTA 3BA0A 2X3AA 1JJ9A 3HB2P 1XFVA 3LUNA 4GQLA 4IN9A 2RJPA 2JSDA 4IUWA 4DD8A 2DW1A 3O2XA 4GR8A 1SLMA 1CIZA 1UTZA 3KEJA 1Y8JA 3DL1A 3LQ0A 5B5PA 3Q2HA 3ZVSA 1ZXCA 5L79A 3RTTA 1DTHA 1IABA 2OY2A 4H30A 2OY4A 1FM1A 3B92A 4IJOA 2OVZA 5I4OA 1G49A 4HMAA 5I43A 3F19A 2W14A 4H82A 1Y0VA 2W15A 4WK7A 1JAQA 3TVCA 1UMSA 1OMJA 3DTEA 5H8XA 3UVCA 3TS4A 4AYKA 4PKRA 4FVLA 1OO9A 1G9KA 1MMRA 1CGFA 3LILA 1JANA 2CLTA 4GR0A 2MLSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KUI A;  2WO9 A;  3DPF A;  2X3B A;  4H49 A;  3NX7 A;  2FV9 A;  2J83 A;  4WKE A;  5I12 A;  1IAD A;  3DPE A;  2OXZ A;  1QIC A;  2DDY A;  2N8R A;  2YB9 A;  1PWQ A;  1HTD A;  3CKI A;  4XCT A;  3HY9 A;  2HU6 A;  1EUB A;  4H84 A;  1CK7 A;  2MZI A;  2MLR A;  2JT5 A;  3OHO A;  1HFS A;  1BUD A;  5B5O A;  1OM6 A;  2I47 A;  1C3I A;  4L19 A;  1ZXV A;  1O0T A;  1BQQ M;  1ZS0 A;  1HV5 A;  1IAG A;  1D5J A;  3U1R A;  1C7K A;  1GXD A;  1G4K A;  2DDF A;  1R1J A;  3HBV P;  1FLS A;  4AUO A;  3EHY A;  5D1T A;  2JIH A;  1CGL A;  1QIA A;  2L0R A;  2X7M A;  2Y6C A;  1XFU A;  4H1Q A;  2XS3 A;  2DW0 A;  4PKV A;  1IAA A;  2JT6 A;  1PWU A;  1BZS A;  5I3M A;  1KAP P;  3KMC A;  1Y93 A;  1PWW A;  3K7L A;  4AIG A;  3DNG A;  4PKW A;  4JP4 A;  1ATL A;  3LJZ A;  1Q3A A;  2CKI A;  3AIG A;  2J0T A;  3F17 A;  2AYK A;  3LIR A;  1EAK A;  1R55 A;  1A86 A;  4GWN A;  1USN A;  1D8F A;  3VTG A;  1WNI A;  2W13 A;  3HBU P;  3F18 A;  2XS4 A;  4PKU A;  2ERO A;  1KUF A;  4I35 A;  2PJT A;  1H71 P;  5D7W A;  1PWV A;  1XUR A;  3I7I A;  2KRJ A;  1SLN A;  1JIW P;  1BSW A;  5I2Z A;  3P24 A;  3TSK A;  4QKZ A;  3G42 A;  2POJ A;  2OZR A;  1UMT A;  2YIG A;  3KRY A;  4AXQ A;  1B3D A;  1S4B P;  4A7B A;  1OM8 A;  4G0D A;  1BKC A;  3EDG A;  4CTH A;  4ZR5 A;  3LK8 A;  1AST A;  3EDH A;  1I76 A;  1R1H A;  1CQR A;  1YQY A;  1ROS A;  3LE9 A;  3WV2 A;  3HDA P;  1BM6 A;  1MNC A;  2O3E A;  2O36 A;  4L6T A;  1BQO A;  4H3X A;  4I03 A;  1K7G A;  1XFY A;  1KUG A;  3HYG A;  4FU4 A;  1YCM A;  1FBL A;  3GBO A;  966C A;  3DWB A;  2Z2D A;  4G9L A;  1L6J A;  1I73 A;  1CXV A;  1HFC A;  1BKC I;  2JNP A;  1R54 A;  2W0D A;  4FXQ A;  2Y6D A;  4JPA A;  3VI1 A;  3K7N A;  1KBC A;  1K7Q A;  3B8Z A;  1G05 A;  1GKC A;  3P1V A;  1JAO A;  456C A;  3E8R A;  3AYU A;  3KWV C;  1C8T A;  1AF0 A;  3LMC A;  4GF1 A;  3L0T A;  5BOY A;  3LIK A;  3WV1 A;  1UEA A;  4XM7 A;  1B8Y A;  4PKQ A;  4A3W A;  2DW2 A;  1GE7 A;  5BOT A;  3O64 A;  1SRP A;  1BUV M;  1XUC A;  3HY7 A;  1CAQ A;  1JH1 A;  2E3X A;  1MMP A;  4ILW D;  3LGP A;  3DSL A;  2TCL A;  3EDZ A;  4J4M A;  3LEA A;  1SMP A;  2OW2 A;  4DPE A;  3LQB A;  1JKY A;  2OI0 A;  3N2U A;  4XM8 A;  1I1I P;  1ZVX A;  3LJT A;  1PWP A;  1EB6 A;  2WO8 A;  2USN A;  1D8M A;  4XBH A;  5CUH A;  4FXY P;  2OW9 A;  1JAP A;  1KUK A;  2V4B A;  4JIJ A;  3LUM A;  3G5C A;  3ZUK A;  2D1O A;  5LAB A;  3EDI A;  1ND1 A;  4WKI A;  3F1A A;  4DF9 A;  1RM8 A;  4GUY A;  4HX3 A;  2K2G A;  1BIW A;  4L63 A;  1MMQ A;  2MZE A;  1GE6 A;  1UTT A;  3F15 A;  1D7X A;  1A85 A;  2SRT A;  2E2D A;  3LJG A;  4Q1L A;  3ELM A;  3L0V A;  3TT4 A;  4EFS A;  3HDB A;  2ERQ A;  3OHL A;  5L7F A;  4PKS A;  4JA1 A;  5JMY A;  3EWJ A;  1GE5 A;  3ZXH A;  1O0Q A;  5D1S A;  1HY7 A;  1XFZ A;  1OM7 A;  3KEC A;  1GKD A;  5BPA A;  1DMT A;  3USN A;  1RMZ A;  4JQG A;  2OVX A;  2OW1 A;  3LKA A;  1XFW A;  3V96 B;  1QUA A;  5D3C A;  2W12 A;  3Q2G A;  4WF6 A;  1AYK A;  2ERP A;  5I0L A;  2MZH A;  2OW0 A;  1XUD A;  3AYK A;  1YOU A;  2AIG P;  1AKL A;  1ZTQ A;  2WOA A;  1BKC E;  1KUH A;  5D2B A;  2OXW A;  1IAC A;  1GO8 P;  1QJJ A;  4XM6 A;  3SHI A;  2K9C A;  1QJI A;  2QPJ A;  2OXU A;  1GO7 P;  1QIB A;  1CGE A;  3RTS A;  3N2V A;  1J7N A;  1OS2 A;  3MA2 A;  1K7I A;  1ZP5 A;  4ON1 A;  830C A;  2D1N A;  1IAE A;  4GWM A;  1R1I A;  1G12 A;  5D1U A;  3B2Z A;  5CXA A;  3F16 A;  4R3V A;  5CZM A;  1SU3 A;  3I7G A;  3KEK A;  1JK3 A;  3EHX A;  4H76 A;  3KHI A;  1MMB A;  4DV8 A;  2X3C A;  2RJQ A;  3WV3 A;  4H2E A;  1OS9 A;  1HOV A;  4WZV A;  1YP1 A;  2A8H A;  1XFX A;  1Z3J A;  1SAT A;  4GR3 A;  3KME A;  2FV5 A;  1JIZ A;  4PKT A;  3BA0 A;  2X3A A;  1JJ9 A;  3HB2 P;  1XFV A;  3LUN A;  4GQL A;  4IN9 A;  2RJP A;  2JSD A;  4IUW A;  4DD8 A;  2DW1 A;  3O2X A;  4GR8 A;  1SLM A;  1CIZ A;  1UTZ A;  3KEJ A;  1Y8J A;  3DL1 A;  3LQ0 A;  5B5P A;  3Q2H A;  3ZVS A;  1ZXC A;  5L79 A;  3RTT A;  1DTH A;  1IAB A;  2OY2 A;  4H30 A;  2OY4 A;  1FM1 A;  3B92 A;  4IJO A;  2OVZ A;  5I4O A;  1G49 A;  4HMA A;  5I43 A;  3F19 A;  2W14 A;  4H82 A;  1Y0V A;  2W15 A;  4WK7 A;  1JAQ A;  3TVC A;  1UMS A;  1OMJ A;  5H8X A;  3UVC A;  3TS4 A;  4AYK A;  4PKR A;  4FVL A;  1OO9 A;  1G9K A;  1MMR A;  1CGF A;  3LIL A;  1JAN A;  2CLT A;  4GR0 A;  2MLS A; 
#chains in the Genus database with same CATH topology
 1KUI A;  2WO9 A;  3DPF A;  2X3B A;  4H49 A;  3NX7 A;  2FV9 A;  2J83 A;  4WKE A;  1XM5 A;  5I12 A;  1IAD A;  3DPE A;  2OXZ A;  1QIC A;  2DDY A;  2N8R A;  2YB9 A;  1PWQ A;  1HTD A;  3CKI A;  4XCT A;  3HY9 A;  2HU6 A;  1EUB A;  4H84 A;  1CK7 A;  2MZI A;  2MLR A;  2JT5 A;  3OHO A;  1HFS A;  1BUD A;  5B5O A;  1OM6 A;  2I47 A;  1C3I A;  4L19 A;  1ZXV A;  1O0T A;  1BQQ M;  1ZS0 A;  1HV5 A;  1IAG A;  1D5J A;  3U1R A;  1C7K A;  1GXD A;  1G4K A;  2DDF A;  2YUF A;  1R1J A;  3HBV P;  1FLS A;  4AUO A;  3EHY A;  5D1T A;  2JIH A;  1CGL A;  1QIA A;  2L0R A;  2X7M A;  2Y6C A;  1XFU A;  4H1Q A;  2XS3 A;  2DW0 A;  4PKV A;  1IAA A;  2JT6 A;  1PWU A;  1BZS A;  5I3M A;  1KAP P;  3KMC A;  1Y93 A;  1PWW A;  3K7L A;  4AIG A;  3DNG A;  4PKW A;  4JP4 A;  1ATL A;  3LJZ A;  1Q3A A;  2CKI A;  3AIG A;  2J0T A;  3F17 A;  2AYK A;  3LIR A;  1EAK A;  1R55 A;  1A86 A;  4GWN A;  1USN A;  1D8F A;  3VTG A;  1WNI A;  2W13 A;  3HBU P;  3F18 A;  2XS4 A;  4PKU A;  2ERO A;  1KUF A;  4I35 A;  2PJT A;  1H71 P;  5D7W A;  1PWV A;  1XUR A;  3I7I A;  2KRJ A;  1SLN A;  1JIW P;  1BSW A;  5I2Z A;  3P24 A;  3TSK A;  4QKZ A;  3DTK A;  3G42 A;  2POJ A;  2OZR A;  1UMT A;  2YIG A;  3KRY A;  4AXQ A;  1B3D A;  1S4B P;  4A7B A;  1OM8 A;  4G0D A;  1BKC A;  3EDG A;  4CTH A;  4ZR5 A;  3LK8 A;  1AST A;  1TVI A;  3EDH A;  1I76 A;  1R1H A;  1CQR A;  1YQY A;  1ROS A;  3LE9 A;  3WV2 A;  3HDA P;  1BM6 A;  1MNC A;  2O3E A;  2O36 A;  4L6T A;  1BQO A;  4H3X A;  4I03 A;  1K7G A;  1XFY A;  1KUG A;  3HYG A;  4FU4 A;  1YCM A;  1FBL A;  3GBO A;  966C A;  3DWB A;  2Z2D A;  4G9L A;  1L6J A;  1I73 A;  1CXV A;  1HFC A;  1BKC I;  2JNP A;  1R54 A;  2W0D A;  4FXQ A;  2Y6D A;  4JPA A;  3VI1 A;  3K7N A;  1KBC A;  1K7Q A;  3B8Z A;  1G05 A;  1GKC A;  3P1V A;  1JAO A;  456C A;  3E8R A;  3AYU A;  3KWV C;  1C8T A;  1AF0 A;  3LMC A;  4GF1 A;  3L0T A;  5BOY A;  3LIK A;  3WV1 A;  1UEA A;  4XM7 A;  1B8Y A;  4PKQ A;  4A3W A;  2DW2 A;  1GE7 A;  5BOT A;  3O64 A;  1SRP A;  1BUV M;  3DTI A;  1XUC A;  3HY7 A;  1CAQ A;  1JH1 A;  2E3X A;  1MMP A;  4ILW D;  3LGP A;  3DSL A;  2TCL A;  3EDZ A;  4J4M A;  3LEA A;  1SMP A;  2OW2 A;  4DPE A;  3LQB A;  1JKY A;  2OI0 A;  1OZ9 A;  3N2U A;  4XM8 A;  1I1I P;  1ZVX A;  3LJT A;  1PWP A;  1EB6 A;  2WO8 A;  2USN A;  1D8M A;  4XBH A;  5CUH A;  4FXY P;  2OW9 A;  1JAP A;  1KUK A;  2V4B A;  4JIJ A;  3LUM A;  3G5C A;  3ZUK A;  2D1O A;  5LAB A;  3EDI A;  1XAX A;  1ND1 A;  4WKI A;  3F1A A;  4DF9 A;  1RM8 A;  4GUY A;  4HX3 A;  2K2G A;  1BIW A;  4L63 A;  1MMQ A;  2MZE A;  1GE6 A;  1UTT A;  3F15 A;  1D7X A;  1A85 A;  2SRT A;  2E2D A;  3LJG A;  4Q1L A;  3ELM A;  3L0V A;  3TT4 A;  4EFS A;  3HDB A;  2ERQ A;  3OHL A;  5L7F A;  4PKS A;  4JA1 A;  5JMY A;  3EWJ A;  1GE5 A;  3ZXH A;  1O0Q A;  5D1S A;  1HY7 A;  1XFZ A;  1OM7 A;  3KEC A;  1GKD A;  5BPA A;  4L7A A;  1DMT A;  3USN A;  1RMZ A;  4JQG A;  2OVX A;  2OW1 A;  3LKA A;  1XFW A;  3V96 B;  1QUA A;  5D3C A;  2W12 A;  3Q2G A;  4WF6 A;  1AYK A;  2ERP A;  5I0L A;  2MZH A;  2OW0 A;  1XUD A;  3AYK A;  1YOU A;  2AIG P;  1AKL A;  1ZTQ A;  2WOA A;  1BKC E;  1KUH A;  5D2B A;  2OXW A;  1IAC A;  1GO8 P;  1QJJ A;  4XM6 A;  3SHI A;  2K9C A;  1QJI A;  2QPJ A;  2OXU A;  1GO7 P;  1QIB A;  1CGE A;  3RTS A;  3N2V A;  1J7N A;  1OS2 A;  3MA2 A;  1K7I A;  1ZP5 A;  4ON1 A;  830C A;  2D1N A;  1IAE A;  4GWM A;  1R1I A;  1G12 A;  5D1U A;  3B2Z A;  5CXA A;  3F16 A;  4R3V A;  5CZM A;  1SU3 A;  3I7G A;  3KEK A;  1JK3 A;  3EHX A;  4H76 A;  3KHI A;  1MMB A;  4DV8 A;  2X3C A;  2RJQ A;  3WV3 A;  4H2E A;  1OS9 A;  1HOV A;  4WZV A;  1YP1 A;  2A8H A;  1XFX A;  1Z3J A;  1SAT A;  4GR3 A;  3KME A;  2FV5 A;  1JIZ A;  4PKT A;  3BA0 A;  2X3A A;  1JJ9 A;  3HB2 P;  1XFV A;  3LUN A;  4GQL A;  4IN9 A;  2RJP A;  2JSD A;  4IUW A;  4DD8 A;  2DW1 A;  3O2X A;  4GR8 A;  1SLM A;  1CIZ A;  1UTZ A;  3KEJ A;  1Y8J A;  3DL1 A;  3LQ0 A;  5B5P A;  3Q2H A;  3ZVS A;  1ZXC A;  5L79 A;  3RTT A;  1DTH A;  1IAB A;  2OY2 A;  4H30 A;  2OY4 A;  1FM1 A;  3B92 A;  4IJO A;  2OVZ A;  5I4O A;  1G49 A;  4HMA A;  5I43 A;  3F19 A;  2W14 A;  4H82 A;  1Y0V A;  2W15 A;  4WK7 A;  1JAQ A;  3TVC A;  1UMS A;  1OMJ A;  3DTE A;  5H8X A;  3UVC A;  3TS4 A;  4AYK A;  4PKR A;  4FVL A;  1OO9 A;  1G9K A;  1MMR A;  1CGF A;  3LIL A;  1JAN A;  2CLT A;  4GR0 A;  2MLS A; 
#chains in the Genus database with same CATH homology
 1KUI A;  2WO9 A;  3DPF A;  2X3B A;  4H49 A;  3NX7 A;  2FV9 A;  2J83 A;  4WKE A;  5I12 A;  1IAD A;  3DPE A;  2OXZ A;  1QIC A;  2DDY A;  2N8R A;  2YB9 A;  1PWQ A;  1HTD A;  3CKI A;  4XCT A;  3HY9 A;  2HU6 A;  1EUB A;  4H84 A;  1CK7 A;  2MZI A;  2MLR A;  2JT5 A;  3OHO A;  1HFS A;  1BUD A;  5B5O A;  1OM6 A;  2I47 A;  1C3I A;  4L19 A;  1ZXV A;  1O0T A;  1BQQ M;  1ZS0 A;  1HV5 A;  1IAG A;  1D5J A;  3U1R A;  1C7K A;  1GXD A;  1G4K A;  2DDF A;  2YUF A;  1R1J A;  3HBV P;  1FLS A;  4AUO A;  3EHY A;  5D1T A;  2JIH A;  1CGL A;  1QIA A;  2L0R A;  2X7M A;  2Y6C A;  1XFU A;  4H1Q A;  2XS3 A;  2DW0 A;  4PKV A;  1IAA A;  2JT6 A;  1PWU A;  1BZS A;  5I3M A;  1KAP P;  3KMC A;  1Y93 A;  1PWW A;  3K7L A;  4AIG A;  3DNG A;  4PKW A;  4JP4 A;  1ATL A;  3LJZ A;  1Q3A A;  2CKI A;  3AIG A;  2J0T A;  3F17 A;  2AYK A;  3LIR A;  1EAK A;  1R55 A;  1A86 A;  4GWN A;  1USN A;  1D8F A;  3VTG A;  1WNI A;  2W13 A;  3HBU P;  3F18 A;  2XS4 A;  4PKU A;  2ERO A;  1KUF A;  4I35 A;  2PJT A;  1H71 P;  5D7W A;  1PWV A;  1XUR A;  3I7I A;  2KRJ A;  1SLN A;  1JIW P;  1BSW A;  5I2Z A;  3P24 A;  3TSK A;  4QKZ A;  3DTK A;  3G42 A;  2POJ A;  2OZR A;  1UMT A;  2YIG A;  3KRY A;  4AXQ A;  1B3D A;  1S4B P;  4A7B A;  1OM8 A;  4G0D A;  1BKC A;  3EDG A;  4CTH A;  4ZR5 A;  3LK8 A;  1AST A;  3EDH A;  1I76 A;  1R1H A;  1CQR A;  1YQY A;  1ROS A;  3LE9 A;  3WV2 A;  3HDA P;  1BM6 A;  1MNC A;  2O3E A;  2O36 A;  4L6T A;  1BQO A;  4H3X A;  4I03 A;  1K7G A;  1XFY A;  1KUG A;  3HYG A;  4FU4 A;  1YCM A;  1FBL A;  3GBO A;  966C A;  3DWB A;  2Z2D A;  4G9L A;  1L6J A;  1I73 A;  1CXV A;  1HFC A;  1BKC I;  2JNP A;  1R54 A;  2W0D A;  4FXQ A;  2Y6D A;  4JPA A;  3VI1 A;  3K7N A;  1KBC A;  1K7Q A;  3B8Z A;  1G05 A;  1GKC A;  3P1V A;  1JAO A;  456C A;  3E8R A;  3AYU A;  3KWV C;  1C8T A;  1AF0 A;  3LMC A;  4GF1 A;  3L0T A;  5BOY A;  3LIK A;  3WV1 A;  1UEA A;  4XM7 A;  1B8Y A;  4PKQ A;  4A3W A;  2DW2 A;  1GE7 A;  5BOT A;  3O64 A;  1SRP A;  1BUV M;  3DTI A;  1XUC A;  3HY7 A;  1CAQ A;  1JH1 A;  2E3X A;  1MMP A;  4ILW D;  3LGP A;  3DSL A;  2TCL A;  3EDZ A;  4J4M A;  3LEA A;  1SMP A;  2OW2 A;  4DPE A;  3LQB A;  1JKY A;  2OI0 A;  3N2U A;  4XM8 A;  1I1I P;  1ZVX A;  3LJT A;  1PWP A;  1EB6 A;  2WO8 A;  2USN A;  1D8M A;  4XBH A;  5CUH A;  4FXY P;  2OW9 A;  1JAP A;  1KUK A;  2V4B A;  4JIJ A;  3LUM A;  3G5C A;  3ZUK A;  2D1O A;  5LAB A;  3EDI A;  1ND1 A;  4WKI A;  3F1A A;  4DF9 A;  1RM8 A;  4GUY A;  4HX3 A;  2K2G A;  1BIW A;  4L63 A;  1MMQ A;  2MZE A;  1GE6 A;  1UTT A;  3F15 A;  1D7X A;  1A85 A;  2SRT A;  2E2D A;  3LJG A;  4Q1L A;  3ELM A;  3L0V A;  3TT4 A;  4EFS A;  3HDB A;  2ERQ A;  3OHL A;  5L7F A;  4PKS A;  4JA1 A;  5JMY A;  3EWJ A;  1GE5 A;  3ZXH A;  1O0Q A;  5D1S A;  1HY7 A;  1XFZ A;  1OM7 A;  3KEC A;  1GKD A;  5BPA A;  4L7A A;  1DMT A;  3USN A;  1RMZ A;  4JQG A;  2OVX A;  2OW1 A;  3LKA A;  1XFW A;  3V96 B;  1QUA A;  5D3C A;  2W12 A;  3Q2G A;  4WF6 A;  1AYK A;  2ERP A;  5I0L A;  2MZH A;  2OW0 A;  1XUD A;  3AYK A;  1YOU A;  2AIG P;  1AKL A;  1ZTQ A;  2WOA A;  1BKC E;  1KUH A;  5D2B A;  2OXW A;  1IAC A;  1GO8 P;  1QJJ A;  4XM6 A;  3SHI A;  2K9C A;  1QJI A;  2QPJ A;  2OXU A;  1GO7 P;  1QIB A;  1CGE A;  3RTS A;  3N2V A;  1J7N A;  1OS2 A;  3MA2 A;  1K7I A;  1ZP5 A;  4ON1 A;  830C A;  2D1N A;  1IAE A;  4GWM A;  1R1I A;  1G12 A;  5D1U A;  3B2Z A;  5CXA A;  3F16 A;  4R3V A;  5CZM A;  1SU3 A;  3I7G A;  3KEK A;  1JK3 A;  3EHX A;  4H76 A;  3KHI A;  1MMB A;  4DV8 A;  2X3C A;  2RJQ A;  3WV3 A;  4H2E A;  1OS9 A;  1HOV A;  4WZV A;  1YP1 A;  2A8H A;  1XFX A;  1Z3J A;  1SAT A;  4GR3 A;  3KME A;  2FV5 A;  1JIZ A;  4PKT A;  3BA0 A;  2X3A A;  1JJ9 A;  3HB2 P;  1XFV A;  3LUN A;  4GQL A;  4IN9 A;  2RJP A;  2JSD A;  4IUW A;  4DD8 A;  2DW1 A;  3O2X A;  4GR8 A;  1SLM A;  1CIZ A;  1UTZ A;  3KEJ A;  1Y8J A;  3DL1 A;  3LQ0 A;  5B5P A;  3Q2H A;  3ZVS A;  1ZXC A;  5L79 A;  3RTT A;  1DTH A;  1IAB A;  2OY2 A;  4H30 A;  2OY4 A;  1FM1 A;  3B92 A;  4IJO A;  2OVZ A;  5I4O A;  1G49 A;  4HMA A;  5I43 A;  3F19 A;  2W14 A;  4H82 A;  1Y0V A;  2W15 A;  4WK7 A;  1JAQ A;  3TVC A;  1UMS A;  1OMJ A;  3DTE A;  5H8X A;  3UVC A;  3TS4 A;  4AYK A;  4PKR A;  4FVL A;  1OO9 A;  1G9K A;  1MMR A;  1CGF A;  3LIL A;  1JAN A;  2CLT A;  4GR0 A;  2MLS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...