1Y93A

Crystal structure of the catalytic domain of human mmp12 complexed with acetohydroxamic acid at atomic resolution
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
158
structure length
158
Chain Sequence
GPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDDHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational variability of matrix metalloproteinases: Beyond a single 3D structure
pubmed doi rcsb
molecule keywords Macrophage metalloelastase
molecule tags Hydrolase
source organism Homo sapiens
total genus 39
structure length 158
sequence length 158
ec nomenclature ec 3.4.24.65: Macrophage elastase.
pdb deposition date 2004-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1y93A00
3B92A 4GUYA 1R55A 2OVXA 3CKIA 5I12A 2QPJA 1R1HA 1MMBA 3EDGA 1PWPA 3HYGA 3LK8A 1FBLA 1HFSA 4PKTA 3DL1A 4WK7A 5BPAA 5CXAA 1CK7A 1BQOA 1OS9A 1Q3AA 4IN9A 1GE6A 3Q2HA 5I0LA 1MMPA 1D8FA 3F19A 1YCMA 3HB2P 1J7NA 1KUIA 1YP1A 3LQBA 1G05A 4AUOA 1CAQA 1SLNA 1R1JA 3N2UA 1K7QA 1C8TA 2JIHA 1GE5A 3F15A 4AIGA 4G9LA 4IJOA 3KEJA 4PKSA 1RMZA 1QIBA 4G0DA 5D7WA 1JKYA 3I7IA 1OO9A 3F16A 2FV9A 1EB6A 3UVCA 1C7KA 4HX3A 4H49A 3LJGA 5B5PA 4XCTA 3K7LA 1XUDA 2RJQA 2J0TA 2I47A 2K9CA 1ZXVA 4PKWA 3B2ZA 3WV2A 2Z2DA 4DV8A 1USNA 3DSLA 1A86A 1CGLA 3LJTA 3EDIA 4GWMA 1B8YA 3TT4A 3O2XA 3AYUA 1SLMA 4XM8A 1BKCE 2RJPA 4ON1A 3KWVC 4R3VA 1KUFA 1ZXCA 1JK3A 1EAKA 1XFUA 1EUBA 3OHOA 1D8MA 4EFSA 3G42A 3F1AA 2MZHA 1GKCA 2POJA 1D5JA 1YOUA 3LUNA 3OHLA 1GKDA 1G9KA 3P1VA 1BSWA 1ZP5A 5L79A 3E8RA 1JANA 4ILWD 4Q1LA 3RTSA 1BUVM 1I76A 4FVLA 3WV3A 2AIGP 2JNPA 3I7GA 1CGFA 1XURA 1JJ9A 4WKEA 2O36A 5I4OA 1XFYA 1PWWA 4JPAA 4GR8A 966CA 4I35A 1JIWP 5CUHA 2OW2A 5D1UA 1DTHA 4L19A 2N8RA 1PWVA 1YQYA 4PKQA 2MLRA 1IAGA 2WO9A 1IADA 1JAPA 2X3CA 4FU4A 1ATLA 3F18A 2DW1A 2MZIA 3LQ0A 2X3AA 3LMCA 2DDYA 4XM7A 2WO8A 1UEAA 1JIZA 4FXQA 4GQLA 2DW2A 2X3BA 3LJZA 1AKLA 3AIGA 1G4KA 2W0DA 2O3EA 1HTDA 2W13A 2OY2A 4HMAA 2OXUA 1D7XA 3O64A 1ROSA 4WKIA 2L0RA 4QKZA 4A7BA 3HY9A 4WZVA 1QIAA 2XS3A 1CGEA 1I1IP 2CLTA 2MZEA 3LE9A 1CQRA 1SATA 3KMEA 1MNCA 4DPEA 3K7NA 1K7GA 5H8XA 1JAQA 3TSKA 2DDFA 1B3DA 1ZS0A 5D3CA 1Y8JA 1UTTA 1IACA 3DNGA 5I2ZA 3AYKA 3TS4A 3NX7A 5LABA 2OXZA 2OW0A 2W14A 1DMTA 1I73A 1RM8A 1ZVXA 3MA2A 3LGPA 5I43A 4L63A 2JT5A 1OS2A 4ZR5A 2Y6DA 1SRPA 2EROA 2A8HA 3TVCA 4H82A 1BQQM 4GF1A 1IAEA 2ERQA 4XM6A 1BKCI 3EHYA 3P24A 830CA 1WNIA 2J83A 1PWQA 4H2EA 1XUCA 3DPFA 5I3MA 4IUWA 3N2VA 3KEKA 1BIWA 3V96B 1FM1A 1OM6A 1OMJA 1BZSA 4FXYP 4DF9A 2JT6A 1A85A 2JSDA 4JQGA 2OZRA 2OVZA 1S4BP 2Y6CA 3ELMA 4PKUA 1XFZA 3L0VA 4I03A 1R1IA 3B8ZA 2E2DA 3ZUKA 3HBUP 4WF6A 4L6TA 1K7IA 1H71P 3LIKA 2DW0A 2TCLA 3GBOA 1GE7A 4PKRA 2PJTA 5D1TA 2X7MA 3F17A 2SRTA 1SU3A 2OW1A 1OM7A 3LKAA 1KUGA 1ASTA 5BOYA 1JAOA 2W15A 4H1QA 1C3IA 3HBVP 1Y0VA 1UMTA 3G5CA 5BOTA 1OM8A 2ERPA 1HY7A 456CA 1FLSA 4DD8A 1PWUA 1BKCA 1CIZA 1MMQA 3LIRA 5D2BA 1SMPA 1KAPP 2YB9A 3Q2GA 2V4BA 1CXVA 1QUAA 5L7FA 3RTTA 4GR0A 3EHXA 1O0QA 3KRYA 3VI1A 3HY7A 4H30A 1Z3JA 1AF0A 2YIGA 3DWBA 4AYKA 4XBHA 1UMSA 1HV5A 3LUMA 4GR3A 5CZMA 2OXWA 1QJIA 1R54A 4CTHA 1BM6A 1G12A 3ZXHA 1HOVA 1GO7P 1HFCA 1QJJA 3EDHA 1IAAA 3U1RA 4H76A 4H3XA 2W12A 3USNA 2USNA 1AYKA 4J4MA 1GO8P 2CKIA 1KUKA 3VTGA 4JA1A 2OI0A 4AXQA 2AYKA 2XS4A 3ZVSA 5B5OA 2HU6A 2D1NA 1QICA 1XFXA 3KECA 2MLSA 1KUHA 1IABA 1BUDA 1JH1A 2D1OA 4JP4A 4PKVA 2K2GA 1Y93A 1KBCA 1XFWA 4GWNA 3L0TA 3LILA 4A3WA 1XFVA 3HDBA 3BA0A 1GXDA 1ZTQA 3HDAP 2E3XA 1ND1A 1MMRA 3WV1A 4H84A 3SHIA 3DPEA 3KMCA 1UTZA 4JIJA 2OW9A 3LEAA 5D1SA 1G49A 1O0TA 2FV5A 2OY4A 3KHIA 2KRJA 3EDZA 5JMYA 2WOAA 3EWJA 1L6JA
chains in the Genus database with same CATH superfamily
3B92A 4GUYA 1R55A 2OVXA 3DTIA 3CKIA 5I12A 1XAXA 2QPJA 1R1HA 1MMBA 3EDGA 1PWPA 3HYGA 3LK8A 1FBLA 1HFSA 2YUFA 4PKTA 3DL1A 4WK7A 5BPAA 5CXAA 1CK7A 1BQOA 1OS9A 1Q3AA 4IN9A 1GE6A 3Q2HA 5I0LA 1MMPA 1D8FA 3F19A 1YCMA 3HB2P 1J7NA 1KUIA 1YP1A 3LQBA 1G05A 4AUOA 1CAQA 1SLNA 1R1JA 3N2UA 1K7QA 1C8TA 2JIHA 1GE5A 3F15A 4AIGA 4G9LA 4IJOA 3KEJA 4PKSA 1RMZA 1QIBA 4G0DA 5D7WA 1JKYA 3I7IA 1OO9A 3F16A 3DTKA 2FV9A 1EB6A 3UVCA 1C7KA 4HX3A 4H49A 3LJGA 5B5PA 4XCTA 3K7LA 1XUDA 2RJQA 2J0TA 2I47A 2K9CA 1ZXVA 4PKWA 3B2ZA 3WV2A 2Z2DA 4DV8A 1USNA 3DSLA 1A86A 1CGLA 3LJTA 3EDIA 4GWMA 1B8YA 3TT4A 3O2XA 3AYUA 1SLMA 4XM8A 1BKCE 2RJPA 4ON1A 3KWVC 4R3VA 1KUFA 1ZXCA 1JK3A 1EAKA 1XFUA 1EUBA 3OHOA 1D8MA 4EFSA 3G42A 3F1AA 2MZHA 1GKCA 2POJA 1D5JA 1YOUA 3LUNA 3OHLA 1GKDA 1G9KA 3P1VA 1BSWA 1ZP5A 5L79A 3E8RA 1JANA 4ILWD 4Q1LA 3RTSA 1BUVM 1I76A 4FVLA 3WV3A 2AIGP 2JNPA 3I7GA 1CGFA 1XURA 1JJ9A 4WKEA 2O36A 5I4OA 1XFYA 1PWWA 4JPAA 4GR8A 966CA 4I35A 1JIWP 5CUHA 2OW2A 5D1UA 1DTHA 4L19A 2N8RA 1PWVA 1YQYA 4PKQA 2MLRA 1IAGA 2WO9A 1IADA 1JAPA 2X3CA 4FU4A 1ATLA 3F18A 2DW1A 2MZIA 3LQ0A 2X3AA 3LMCA 2DDYA 4XM7A 2WO8A 1UEAA 1JIZA 4FXQA 4GQLA 2DW2A 2X3BA 3LJZA 1AKLA 3AIGA 1G4KA 2W0DA 2O3EA 1HTDA 2W13A 2OY2A 4HMAA 2OXUA 4L7AA 1D7XA 3O64A 1ROSA 4WKIA 2L0RA 4QKZA 4A7BA 3HY9A 4WZVA 1QIAA 2XS3A 1CGEA 1I1IP 2CLTA 2MZEA 3LE9A 1CQRA 1SATA 3KMEA 1MNCA 4DPEA 3K7NA 1K7GA 5H8XA 1JAQA 3TSKA 2DDFA 1B3DA 1ZS0A 5D3CA 1Y8JA 1UTTA 1IACA 3DNGA 5I2ZA 3AYKA 3TS4A 1XM5A 3NX7A 5LABA 2OXZA 2OW0A 1TVIA 2W14A 1DMTA 1I73A 1RM8A 1ZVXA 3MA2A 3LGPA 5I43A 4L63A 2JT5A 1OS2A 4ZR5A 2Y6DA 1SRPA 2EROA 2A8HA 3TVCA 4H82A 1BQQM 4GF1A 1IAEA 2ERQA 4XM6A 1BKCI 3EHYA 3P24A 830CA 1WNIA 2J83A 1PWQA 4H2EA 1XUCA 3DPFA 5I3MA 4IUWA 3N2VA 3KEKA 1BIWA 3V96B 1FM1A 1OM6A 1OMJA 1BZSA 4FXYP 4DF9A 2JT6A 1A85A 2JSDA 4JQGA 2OZRA 2OVZA 1S4BP 2Y6CA 3ELMA 4PKUA 1XFZA 3L0VA 4I03A 1R1IA 3B8ZA 2E2DA 3ZUKA 3HBUP 4WF6A 4L6TA 1K7IA 1H71P 3LIKA 2DW0A 2TCLA 3GBOA 1GE7A 4PKRA 2PJTA 5D1TA 2X7MA 3F17A 2SRTA 1SU3A 2OW1A 1OM7A 3LKAA 1KUGA 1ASTA 5BOYA 1JAOA 2W15A 4H1QA 1C3IA 3HBVP 1Y0VA 1UMTA 3G5CA 5BOTA 1OM8A 2ERPA 1HY7A 456CA 1FLSA 1OZ9A 4DD8A 1PWUA 1BKCA 1CIZA 1MMQA 3LIRA 5D2BA 1SMPA 1KAPP 2YB9A 3Q2GA 2V4BA 1CXVA 1QUAA 5L7FA 3RTTA 4GR0A 3EHXA 1O0QA 3KRYA 3VI1A 3HY7A 4H30A 1Z3JA 1AF0A 2YIGA 3DWBA 4AYKA 4XBHA 1UMSA 1HV5A 3LUMA 4GR3A 5CZMA 2OXWA 1QJIA 1R54A 4CTHA 1BM6A 1G12A 3ZXHA 1HOVA 1GO7P 1HFCA 1QJJA 3EDHA 1IAAA 3U1RA 4H76A 4H3XA 2W12A 3USNA 2USNA 1AYKA 4J4MA 1GO8P 2CKIA 1KUKA 3VTGA 4JA1A 2OI0A 4AXQA 2AYKA 2XS4A 3ZVSA 5B5OA 2HU6A 2D1NA 1QICA 1XFXA 3KECA 2MLSA 1KUHA 1IABA 1BUDA 1JH1A 2D1OA 4JP4A 4PKVA 2K2GA 1Y93A 1KBCA 1XFWA 4GWNA 3L0TA 3LILA 4A3WA 1XFVA 3HDBA 3BA0A 1GXDA 1ZTQA 3HDAP 2E3XA 1ND1A 1MMRA 3WV1A 4H84A 3SHIA 3DPEA 3KMCA 1UTZA 4JIJA 2OW9A 3LEAA 5D1SA 1G49A 1O0TA 2FV5A 2OY4A 3KHIA 2KRJA 3EDZA 5JMYA 2WOAA 3EWJA 1L6JA 3DTEA
chains in the Genus database with same CATH topology
3B92A 4GUYA 1R55A 2OVXA 3DTIA 3CKIA 5I12A 2QPJA 1R1HA 1MMBA 3EDGA 1PWPA 3HYGA 3LK8A 1FBLA 1HFSA 2YUFA 4PKTA 3DL1A 4WK7A 5BPAA 5CXAA 1CK7A 1BQOA 1OS9A 1Q3AA 4IN9A 1GE6A 3Q2HA 5I0LA 1MMPA 1D8FA 3F19A 1YCMA 3HB2P 1J7NA 1KUIA 1YP1A 3LQBA 1G05A 4AUOA 1CAQA 1SLNA 1R1JA 3N2UA 1K7QA 1C8TA 2JIHA 1GE5A 3F15A 4AIGA 4G9LA 4IJOA 3KEJA 4PKSA 1RMZA 1QIBA 4G0DA 5D7WA 1JKYA 3I7IA 1OO9A 3F16A 3DTKA 2FV9A 1EB6A 3UVCA 1C7KA 4HX3A 4H49A 3LJGA 5B5PA 4XCTA 3K7LA 1XUDA 2RJQA 2J0TA 2I47A 2K9CA 1ZXVA 4PKWA 3B2ZA 3WV2A 2Z2DA 4DV8A 1USNA 3DSLA 1A86A 1CGLA 3LJTA 3EDIA 4GWMA 1B8YA 3TT4A 3O2XA 3AYUA 1SLMA 4XM8A 1BKCE 2RJPA 4ON1A 3KWVC 4R3VA 1KUFA 1ZXCA 1JK3A 1EAKA 1XFUA 1EUBA 3OHOA 1D8MA 4EFSA 3G42A 3F1AA 2MZHA 1GKCA 2POJA 1D5JA 1YOUA 3LUNA 3OHLA 1GKDA 1G9KA 3P1VA 1BSWA 1ZP5A 5L79A 3E8RA 1JANA 4ILWD 4Q1LA 3RTSA 1BUVM 1I76A 4FVLA 3WV3A 2AIGP 2JNPA 3I7GA 1CGFA 1XURA 1JJ9A 4WKEA 2O36A 5I4OA 1XFYA 1PWWA 4JPAA 4GR8A 966CA 4I35A 1JIWP 5CUHA 2OW2A 5D1UA 1DTHA 4L19A 2N8RA 1PWVA 1YQYA 4PKQA 2MLRA 1IAGA 2WO9A 1IADA 1JAPA 2X3CA 4FU4A 1ATLA 3F18A 2DW1A 2MZIA 3LQ0A 2X3AA 3LMCA 2DDYA 4XM7A 2WO8A 1UEAA 1JIZA 4FXQA 4GQLA 2DW2A 2X3BA 3LJZA 1AKLA 3AIGA 1G4KA 2W0DA 2O3EA 1HTDA 2W13A 2OY2A 4HMAA 2OXUA 4L7AA 1D7XA 3O64A 1ROSA 4WKIA 2L0RA 4QKZA 4A7BA 3HY9A 4WZVA 1QIAA 2XS3A 1CGEA 1I1IP 2CLTA 2MZEA 3LE9A 1CQRA 1SATA 3KMEA 1MNCA 4DPEA 3K7NA 1K7GA 5H8XA 1JAQA 3TSKA 2DDFA 1B3DA 1ZS0A 5D3CA 1Y8JA 1UTTA 1IACA 3DNGA 5I2ZA 3AYKA 3TS4A 3NX7A 5LABA 2OXZA 2OW0A 2W14A 1DMTA 1I73A 1RM8A 1ZVXA 3MA2A 3LGPA 5I43A 4L63A 2JT5A 1OS2A 4ZR5A 2Y6DA 1SRPA 2EROA 2A8HA 3TVCA 4H82A 1BQQM 4GF1A 1IAEA 2ERQA 4XM6A 1BKCI 3EHYA 3P24A 830CA 1WNIA 2J83A 1PWQA 4H2EA 1XUCA 3DPFA 5I3MA 4IUWA 3N2VA 3KEKA 1BIWA 3V96B 1FM1A 1OM6A 1OMJA 1BZSA 4FXYP 4DF9A 2JT6A 1A85A 2JSDA 4JQGA 2OZRA 2OVZA 1S4BP 2Y6CA 3ELMA 4PKUA 1XFZA 3L0VA 4I03A 1R1IA 3B8ZA 2E2DA 3ZUKA 3HBUP 4WF6A 4L6TA 1K7IA 1H71P 3LIKA 2DW0A 2TCLA 3GBOA 1GE7A 4PKRA 2PJTA 5D1TA 2X7MA 3F17A 2SRTA 1SU3A 2OW1A 1OM7A 3LKAA 1KUGA 1ASTA 5BOYA 1JAOA 2W15A 4H1QA 1C3IA 3HBVP 1Y0VA 1UMTA 3G5CA 5BOTA 1OM8A 2ERPA 1HY7A 456CA 1FLSA 4DD8A 1PWUA 1BKCA 1CIZA 1MMQA 3LIRA 5D2BA 1SMPA 1KAPP 2YB9A 3Q2GA 2V4BA 1CXVA 1QUAA 5L7FA 3RTTA 4GR0A 3EHXA 1O0QA 3KRYA 3VI1A 3HY7A 4H30A 1Z3JA 1AF0A 2YIGA 3DWBA 4AYKA 4XBHA 1UMSA 1HV5A 3LUMA 4GR3A 5CZMA 2OXWA 1QJIA 1R54A 4CTHA 1BM6A 1G12A 3ZXHA 1HOVA 1GO7P 1HFCA 1QJJA 3EDHA 1IAAA 3U1RA 4H76A 4H3XA 2W12A 3USNA 2USNA 1AYKA 4J4MA 1GO8P 2CKIA 1KUKA 3VTGA 4JA1A 2OI0A 4AXQA 2AYKA 2XS4A 3ZVSA 5B5OA 2HU6A 2D1NA 1QICA 1XFXA 3KECA 2MLSA 1KUHA 1IABA 1BUDA 1JH1A 2D1OA 4JP4A 4PKVA 2K2GA 1Y93A 1KBCA 1XFWA 4GWNA 3L0TA 3LILA 4A3WA 1XFVA 3HDBA 3BA0A 1GXDA 1ZTQA 3HDAP 2E3XA 1ND1A 1MMRA 3WV1A 4H84A 3SHIA 3DPEA 3KMCA 1UTZA 4JIJA 2OW9A 3LEAA 5D1SA 1G49A 1O0TA 2FV5A 2OY4A 3KHIA 2KRJA 3EDZA 5JMYA 2WOAA 3EWJA 1L6JA 3DTEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B92 A;  4GUY A;  1R55 A;  2OVX A;  3CKI A;  5I12 A;  2QPJ A;  1R1H A;  1MMB A;  3EDG A;  1PWP A;  3HYG A;  3LK8 A;  1FBL A;  1HFS A;  4PKT A;  3DL1 A;  4WK7 A;  5BPA A;  5CXA A;  1CK7 A;  1BQO A;  1OS9 A;  1Q3A A;  4IN9 A;  1GE6 A;  3Q2H A;  5I0L A;  1MMP A;  1D8F A;  3F19 A;  1YCM A;  3HB2 P;  1J7N A;  1KUI A;  1YP1 A;  3LQB A;  1G05 A;  4AUO A;  1CAQ A;  1SLN A;  1R1J A;  3N2U A;  1K7Q A;  1C8T A;  2JIH A;  1GE5 A;  3F15 A;  4AIG A;  4G9L A;  4IJO A;  3KEJ A;  4PKS A;  1RMZ A;  1QIB A;  4G0D A;  5D7W A;  1JKY A;  3I7I A;  1OO9 A;  3F16 A;  2FV9 A;  1EB6 A;  3UVC A;  1C7K A;  4HX3 A;  4H49 A;  3LJG A;  5B5P A;  4XCT A;  3K7L A;  1XUD A;  2RJQ A;  2J0T A;  2I47 A;  2K9C A;  1ZXV A;  4PKW A;  3B2Z A;  3WV2 A;  2Z2D A;  4DV8 A;  1USN A;  3DSL A;  1A86 A;  1CGL A;  3LJT A;  3EDI A;  4GWM A;  1B8Y A;  3TT4 A;  3O2X A;  3AYU A;  1SLM A;  4XM8 A;  1BKC E;  2RJP A;  4ON1 A;  3KWV C;  4R3V A;  1KUF A;  1ZXC A;  1JK3 A;  1EAK A;  1XFU A;  1EUB A;  3OHO A;  1D8M A;  4EFS A;  3G42 A;  3F1A A;  2MZH A;  1GKC A;  2POJ A;  1D5J A;  1YOU A;  3LUN A;  3OHL A;  1GKD A;  1G9K A;  3P1V A;  1BSW A;  1ZP5 A;  5L79 A;  3E8R A;  1JAN A;  4ILW D;  4Q1L A;  3RTS A;  1BUV M;  1I76 A;  4FVL A;  3WV3 A;  2AIG P;  2JNP A;  3I7G A;  1CGF A;  1XUR A;  1JJ9 A;  4WKE A;  2O36 A;  5I4O A;  1XFY A;  1PWW A;  4JPA A;  4GR8 A;  966C A;  4I35 A;  1JIW P;  5CUH A;  2OW2 A;  5D1U A;  1DTH A;  4L19 A;  2N8R A;  1PWV A;  1YQY A;  4PKQ A;  2MLR A;  1IAG A;  2WO9 A;  1IAD A;  1JAP A;  2X3C A;  4FU4 A;  1ATL A;  3F18 A;  2DW1 A;  2MZI A;  3LQ0 A;  2X3A A;  3LMC A;  2DDY A;  4XM7 A;  2WO8 A;  1UEA A;  1JIZ A;  4FXQ A;  4GQL A;  2DW2 A;  2X3B A;  3LJZ A;  1AKL A;  3AIG A;  1G4K A;  2W0D A;  2O3E A;  1HTD A;  2W13 A;  2OY2 A;  4HMA A;  2OXU A;  1D7X A;  3O64 A;  1ROS A;  4WKI A;  2L0R A;  4QKZ A;  4A7B A;  3HY9 A;  4WZV A;  1QIA A;  2XS3 A;  1CGE A;  1I1I P;  2CLT A;  2MZE A;  3LE9 A;  1CQR A;  1SAT A;  3KME A;  1MNC A;  4DPE A;  3K7N A;  1K7G A;  5H8X A;  1JAQ A;  3TSK A;  2DDF A;  1B3D A;  1ZS0 A;  5D3C A;  1Y8J A;  1UTT A;  1IAC A;  3DNG A;  5I2Z A;  3AYK A;  3TS4 A;  3NX7 A;  5LAB A;  2OXZ A;  2OW0 A;  2W14 A;  1DMT A;  1I73 A;  1RM8 A;  1ZVX A;  3MA2 A;  3LGP A;  5I43 A;  4L63 A;  2JT5 A;  1OS2 A;  4ZR5 A;  2Y6D A;  1SRP A;  2ERO A;  2A8H A;  3TVC A;  4H82 A;  1BQQ M;  4GF1 A;  1IAE A;  2ERQ A;  4XM6 A;  1BKC I;  3EHY A;  3P24 A;  830C A;  1WNI A;  2J83 A;  1PWQ A;  4H2E A;  1XUC A;  3DPF A;  5I3M A;  4IUW A;  3N2V A;  3KEK A;  1BIW A;  3V96 B;  1FM1 A;  1OM6 A;  1OMJ A;  1BZS A;  4FXY P;  4DF9 A;  2JT6 A;  1A85 A;  2JSD A;  4JQG A;  2OZR A;  2OVZ A;  1S4B P;  2Y6C A;  3ELM A;  4PKU A;  1XFZ A;  3L0V A;  4I03 A;  1R1I A;  3B8Z A;  2E2D A;  3ZUK A;  3HBU P;  4WF6 A;  4L6T A;  1K7I A;  1H71 P;  3LIK A;  2DW0 A;  2TCL A;  3GBO A;  1GE7 A;  4PKR A;  2PJT A;  5D1T A;  2X7M A;  3F17 A;  2SRT A;  1SU3 A;  2OW1 A;  1OM7 A;  3LKA A;  1KUG A;  1AST A;  5BOY A;  1JAO A;  2W15 A;  4H1Q A;  1C3I A;  3HBV P;  1Y0V A;  1UMT A;  3G5C A;  5BOT A;  1OM8 A;  2ERP A;  1HY7 A;  456C A;  1FLS A;  4DD8 A;  1PWU A;  1BKC A;  1CIZ A;  1MMQ A;  3LIR A;  5D2B A;  1SMP A;  1KAP P;  2YB9 A;  3Q2G A;  2V4B A;  1CXV A;  1QUA A;  5L7F A;  3RTT A;  4GR0 A;  3EHX A;  1O0Q A;  3KRY A;  3VI1 A;  3HY7 A;  4H30 A;  1Z3J A;  1AF0 A;  2YIG A;  3DWB A;  4AYK A;  4XBH A;  1UMS A;  1HV5 A;  3LUM A;  4GR3 A;  5CZM A;  2OXW A;  1QJI A;  1R54 A;  4CTH A;  1BM6 A;  1G12 A;  3ZXH A;  1HOV A;  1GO7 P;  1HFC A;  1QJJ A;  3EDH A;  1IAA A;  3U1R A;  4H76 A;  4H3X A;  2W12 A;  3USN A;  2USN A;  1AYK A;  4J4M A;  1GO8 P;  2CKI A;  1KUK A;  3VTG A;  4JA1 A;  2OI0 A;  4AXQ A;  2AYK A;  2XS4 A;  3ZVS A;  5B5O A;  2HU6 A;  2D1N A;  1QIC A;  1XFX A;  3KEC A;  2MLS A;  1KUH A;  1IAB A;  1BUD A;  1JH1 A;  2D1O A;  4JP4 A;  4PKV A;  2K2G A;  1Y93 A;  1KBC A;  1XFW A;  4GWN A;  3L0T A;  3LIL A;  4A3W A;  1XFV A;  3HDB A;  3BA0 A;  1GXD A;  1ZTQ A;  3HDA P;  2E3X A;  1ND1 A;  1MMR A;  3WV1 A;  4H84 A;  3SHI A;  3DPE A;  3KMC A;  1UTZ A;  4JIJ A;  2OW9 A;  3LEA A;  5D1S A;  1G49 A;  1O0T A;  2FV5 A;  2OY4 A;  3KHI A;  2KRJ A;  3EDZ A;  5JMY A;  2WOA A;  3EWJ A;  1L6J A; 
#chains in the Genus database with same CATH topology
 3B92 A;  4GUY A;  1R55 A;  2OVX A;  3DTI A;  3CKI A;  5I12 A;  1XAX A;  2QPJ A;  1R1H A;  1MMB A;  3EDG A;  1PWP A;  3HYG A;  3LK8 A;  1FBL A;  1HFS A;  2YUF A;  4PKT A;  3DL1 A;  4WK7 A;  5BPA A;  5CXA A;  1CK7 A;  1BQO A;  1OS9 A;  1Q3A A;  4IN9 A;  1GE6 A;  3Q2H A;  5I0L A;  1MMP A;  1D8F A;  3F19 A;  1YCM A;  3HB2 P;  1J7N A;  1KUI A;  1YP1 A;  3LQB A;  1G05 A;  4AUO A;  1CAQ A;  1SLN A;  1R1J A;  3N2U A;  1K7Q A;  1C8T A;  2JIH A;  1GE5 A;  3F15 A;  4AIG A;  4G9L A;  4IJO A;  3KEJ A;  4PKS A;  1RMZ A;  1QIB A;  4G0D A;  5D7W A;  1JKY A;  3I7I A;  1OO9 A;  3F16 A;  3DTK A;  2FV9 A;  1EB6 A;  3UVC A;  1C7K A;  4HX3 A;  4H49 A;  3LJG A;  5B5P A;  4XCT A;  3K7L A;  1XUD A;  2RJQ A;  2J0T A;  2I47 A;  2K9C A;  1ZXV A;  4PKW A;  3B2Z A;  3WV2 A;  2Z2D A;  4DV8 A;  1USN A;  3DSL A;  1A86 A;  1CGL A;  3LJT A;  3EDI A;  4GWM A;  1B8Y A;  3TT4 A;  3O2X A;  3AYU A;  1SLM A;  4XM8 A;  1BKC E;  2RJP A;  4ON1 A;  3KWV C;  4R3V A;  1KUF A;  1ZXC A;  1JK3 A;  1EAK A;  1XFU A;  1EUB A;  3OHO A;  1D8M A;  4EFS A;  3G42 A;  3F1A A;  2MZH A;  1GKC A;  2POJ A;  1D5J A;  1YOU A;  3LUN A;  3OHL A;  1GKD A;  1G9K A;  3P1V A;  1BSW A;  1ZP5 A;  5L79 A;  3E8R A;  1JAN A;  4ILW D;  4Q1L A;  3RTS A;  1BUV M;  1I76 A;  4FVL A;  3WV3 A;  2AIG P;  2JNP A;  3I7G A;  1CGF A;  1XUR A;  1JJ9 A;  4WKE A;  2O36 A;  5I4O A;  1XFY A;  1PWW A;  4JPA A;  4GR8 A;  966C A;  4I35 A;  1JIW P;  5CUH A;  2OW2 A;  5D1U A;  1DTH A;  4L19 A;  2N8R A;  1PWV A;  1YQY A;  4PKQ A;  2MLR A;  1IAG A;  2WO9 A;  1IAD A;  1JAP A;  2X3C A;  4FU4 A;  1ATL A;  3F18 A;  2DW1 A;  2MZI A;  3LQ0 A;  2X3A A;  3LMC A;  2DDY A;  4XM7 A;  2WO8 A;  1UEA A;  1JIZ A;  4FXQ A;  4GQL A;  2DW2 A;  2X3B A;  3LJZ A;  1AKL A;  3AIG A;  1G4K A;  2W0D A;  2O3E A;  1HTD A;  2W13 A;  2OY2 A;  4HMA A;  2OXU A;  4L7A A;  1D7X A;  3O64 A;  1ROS A;  4WKI A;  2L0R A;  4QKZ A;  4A7B A;  3HY9 A;  4WZV A;  1QIA A;  2XS3 A;  1CGE A;  1I1I P;  2CLT A;  2MZE A;  3LE9 A;  1CQR A;  1SAT A;  3KME A;  1MNC A;  4DPE A;  3K7N A;  1K7G A;  5H8X A;  1JAQ A;  3TSK A;  2DDF A;  1B3D A;  1ZS0 A;  5D3C A;  1Y8J A;  1UTT A;  1IAC A;  3DNG A;  5I2Z A;  3AYK A;  3TS4 A;  1XM5 A;  3NX7 A;  5LAB A;  2OXZ A;  2OW0 A;  1TVI A;  2W14 A;  1DMT A;  1I73 A;  1RM8 A;  1ZVX A;  3MA2 A;  3LGP A;  5I43 A;  4L63 A;  2JT5 A;  1OS2 A;  4ZR5 A;  2Y6D A;  1SRP A;  2ERO A;  2A8H A;  3TVC A;  4H82 A;  1BQQ M;  4GF1 A;  1IAE A;  2ERQ A;  4XM6 A;  1BKC I;  3EHY A;  3P24 A;  830C A;  1WNI A;  2J83 A;  1PWQ A;  4H2E A;  1XUC A;  3DPF A;  5I3M A;  4IUW A;  3N2V A;  3KEK A;  1BIW A;  3V96 B;  1FM1 A;  1OM6 A;  1OMJ A;  1BZS A;  4FXY P;  4DF9 A;  2JT6 A;  1A85 A;  2JSD A;  4JQG A;  2OZR A;  2OVZ A;  1S4B P;  2Y6C A;  3ELM A;  4PKU A;  1XFZ A;  3L0V A;  4I03 A;  1R1I A;  3B8Z A;  2E2D A;  3ZUK A;  3HBU P;  4WF6 A;  4L6T A;  1K7I A;  1H71 P;  3LIK A;  2DW0 A;  2TCL A;  3GBO A;  1GE7 A;  4PKR A;  2PJT A;  5D1T A;  2X7M A;  3F17 A;  2SRT A;  1SU3 A;  2OW1 A;  1OM7 A;  3LKA A;  1KUG A;  1AST A;  5BOY A;  1JAO A;  2W15 A;  4H1Q A;  1C3I A;  3HBV P;  1Y0V A;  1UMT A;  3G5C A;  5BOT A;  1OM8 A;  2ERP A;  1HY7 A;  456C A;  1FLS A;  1OZ9 A;  4DD8 A;  1PWU A;  1BKC A;  1CIZ A;  1MMQ A;  3LIR A;  5D2B A;  1SMP A;  1KAP P;  2YB9 A;  3Q2G A;  2V4B A;  1CXV A;  1QUA A;  5L7F A;  3RTT A;  4GR0 A;  3EHX A;  1O0Q A;  3KRY A;  3VI1 A;  3HY7 A;  4H30 A;  1Z3J A;  1AF0 A;  2YIG A;  3DWB A;  4AYK A;  4XBH A;  1UMS A;  1HV5 A;  3LUM A;  4GR3 A;  5CZM A;  2OXW A;  1QJI A;  1R54 A;  4CTH A;  1BM6 A;  1G12 A;  3ZXH A;  1HOV A;  1GO7 P;  1HFC A;  1QJJ A;  3EDH A;  1IAA A;  3U1R A;  4H76 A;  4H3X A;  2W12 A;  3USN A;  2USN A;  1AYK A;  4J4M A;  1GO8 P;  2CKI A;  1KUK A;  3VTG A;  4JA1 A;  2OI0 A;  4AXQ A;  2AYK A;  2XS4 A;  3ZVS A;  5B5O A;  2HU6 A;  2D1N A;  1QIC A;  1XFX A;  3KEC A;  2MLS A;  1KUH A;  1IAB A;  1BUD A;  1JH1 A;  2D1O A;  4JP4 A;  4PKV A;  2K2G A;  1Y93 A;  1KBC A;  1XFW A;  4GWN A;  3L0T A;  3LIL A;  4A3W A;  1XFV A;  3HDB A;  3BA0 A;  1GXD A;  1ZTQ A;  3HDA P;  2E3X A;  1ND1 A;  1MMR A;  3WV1 A;  4H84 A;  3SHI A;  3DPE A;  3KMC A;  1UTZ A;  4JIJ A;  2OW9 A;  3LEA A;  5D1S A;  1G49 A;  1O0T A;  2FV5 A;  2OY4 A;  3KHI A;  2KRJ A;  3EDZ A;  5JMY A;  2WOA A;  3EWJ A;  1L6J A;  3DTE A; 
#chains in the Genus database with same CATH homology
 3B92 A;  4GUY A;  1R55 A;  2OVX A;  3DTI A;  3CKI A;  5I12 A;  2QPJ A;  1R1H A;  1MMB A;  3EDG A;  1PWP A;  3HYG A;  3LK8 A;  1FBL A;  1HFS A;  2YUF A;  4PKT A;  3DL1 A;  4WK7 A;  5BPA A;  5CXA A;  1CK7 A;  1BQO A;  1OS9 A;  1Q3A A;  4IN9 A;  1GE6 A;  3Q2H A;  5I0L A;  1MMP A;  1D8F A;  3F19 A;  1YCM A;  3HB2 P;  1J7N A;  1KUI A;  1YP1 A;  3LQB A;  1G05 A;  4AUO A;  1CAQ A;  1SLN A;  1R1J A;  3N2U A;  1K7Q A;  1C8T A;  2JIH A;  1GE5 A;  3F15 A;  4AIG A;  4G9L A;  4IJO A;  3KEJ A;  4PKS A;  1RMZ A;  1QIB A;  4G0D A;  5D7W A;  1JKY A;  3I7I A;  1OO9 A;  3F16 A;  3DTK A;  2FV9 A;  1EB6 A;  3UVC A;  1C7K A;  4HX3 A;  4H49 A;  3LJG A;  5B5P A;  4XCT A;  3K7L A;  1XUD A;  2RJQ A;  2J0T A;  2I47 A;  2K9C A;  1ZXV A;  4PKW A;  3B2Z A;  3WV2 A;  2Z2D A;  4DV8 A;  1USN A;  3DSL A;  1A86 A;  1CGL A;  3LJT A;  3EDI A;  4GWM A;  1B8Y A;  3TT4 A;  3O2X A;  3AYU A;  1SLM A;  4XM8 A;  1BKC E;  2RJP A;  4ON1 A;  3KWV C;  4R3V A;  1KUF A;  1ZXC A;  1JK3 A;  1EAK A;  1XFU A;  1EUB A;  3OHO A;  1D8M A;  4EFS A;  3G42 A;  3F1A A;  2MZH A;  1GKC A;  2POJ A;  1D5J A;  1YOU A;  3LUN A;  3OHL A;  1GKD A;  1G9K A;  3P1V A;  1BSW A;  1ZP5 A;  5L79 A;  3E8R A;  1JAN A;  4ILW D;  4Q1L A;  3RTS A;  1BUV M;  1I76 A;  4FVL A;  3WV3 A;  2AIG P;  2JNP A;  3I7G A;  1CGF A;  1XUR A;  1JJ9 A;  4WKE A;  2O36 A;  5I4O A;  1XFY A;  1PWW A;  4JPA A;  4GR8 A;  966C A;  4I35 A;  1JIW P;  5CUH A;  2OW2 A;  5D1U A;  1DTH A;  4L19 A;  2N8R A;  1PWV A;  1YQY A;  4PKQ A;  2MLR A;  1IAG A;  2WO9 A;  1IAD A;  1JAP A;  2X3C A;  4FU4 A;  1ATL A;  3F18 A;  2DW1 A;  2MZI A;  3LQ0 A;  2X3A A;  3LMC A;  2DDY A;  4XM7 A;  2WO8 A;  1UEA A;  1JIZ A;  4FXQ A;  4GQL A;  2DW2 A;  2X3B A;  3LJZ A;  1AKL A;  3AIG A;  1G4K A;  2W0D A;  2O3E A;  1HTD A;  2W13 A;  2OY2 A;  4HMA A;  2OXU A;  4L7A A;  1D7X A;  3O64 A;  1ROS A;  4WKI A;  2L0R A;  4QKZ A;  4A7B A;  3HY9 A;  4WZV A;  1QIA A;  2XS3 A;  1CGE A;  1I1I P;  2CLT A;  2MZE A;  3LE9 A;  1CQR A;  1SAT A;  3KME A;  1MNC A;  4DPE A;  3K7N A;  1K7G A;  5H8X A;  1JAQ A;  3TSK A;  2DDF A;  1B3D A;  1ZS0 A;  5D3C A;  1Y8J A;  1UTT A;  1IAC A;  3DNG A;  5I2Z A;  3AYK A;  3TS4 A;  3NX7 A;  5LAB A;  2OXZ A;  2OW0 A;  2W14 A;  1DMT A;  1I73 A;  1RM8 A;  1ZVX A;  3MA2 A;  3LGP A;  5I43 A;  4L63 A;  2JT5 A;  1OS2 A;  4ZR5 A;  2Y6D A;  1SRP A;  2ERO A;  2A8H A;  3TVC A;  4H82 A;  1BQQ M;  4GF1 A;  1IAE A;  2ERQ A;  4XM6 A;  1BKC I;  3EHY A;  3P24 A;  830C A;  1WNI A;  2J83 A;  1PWQ A;  4H2E A;  1XUC A;  3DPF A;  5I3M A;  4IUW A;  3N2V A;  3KEK A;  1BIW A;  3V96 B;  1FM1 A;  1OM6 A;  1OMJ A;  1BZS A;  4FXY P;  4DF9 A;  2JT6 A;  1A85 A;  2JSD A;  4JQG A;  2OZR A;  2OVZ A;  1S4B P;  2Y6C A;  3ELM A;  4PKU A;  1XFZ A;  3L0V A;  4I03 A;  1R1I A;  3B8Z A;  2E2D A;  3ZUK A;  3HBU P;  4WF6 A;  4L6T A;  1K7I A;  1H71 P;  3LIK A;  2DW0 A;  2TCL A;  3GBO A;  1GE7 A;  4PKR A;  2PJT A;  5D1T A;  2X7M A;  3F17 A;  2SRT A;  1SU3 A;  2OW1 A;  1OM7 A;  3LKA A;  1KUG A;  1AST A;  5BOY A;  1JAO A;  2W15 A;  4H1Q A;  1C3I A;  3HBV P;  1Y0V A;  1UMT A;  3G5C A;  5BOT A;  1OM8 A;  2ERP A;  1HY7 A;  456C A;  1FLS A;  4DD8 A;  1PWU A;  1BKC A;  1CIZ A;  1MMQ A;  3LIR A;  5D2B A;  1SMP A;  1KAP P;  2YB9 A;  3Q2G A;  2V4B A;  1CXV A;  1QUA A;  5L7F A;  3RTT A;  4GR0 A;  3EHX A;  1O0Q A;  3KRY A;  3VI1 A;  3HY7 A;  4H30 A;  1Z3J A;  1AF0 A;  2YIG A;  3DWB A;  4AYK A;  4XBH A;  1UMS A;  1HV5 A;  3LUM A;  4GR3 A;  5CZM A;  2OXW A;  1QJI A;  1R54 A;  4CTH A;  1BM6 A;  1G12 A;  3ZXH A;  1HOV A;  1GO7 P;  1HFC A;  1QJJ A;  3EDH A;  1IAA A;  3U1R A;  4H76 A;  4H3X A;  2W12 A;  3USN A;  2USN A;  1AYK A;  4J4M A;  1GO8 P;  2CKI A;  1KUK A;  3VTG A;  4JA1 A;  2OI0 A;  4AXQ A;  2AYK A;  2XS4 A;  3ZVS A;  5B5O A;  2HU6 A;  2D1N A;  1QIC A;  1XFX A;  3KEC A;  2MLS A;  1KUH A;  1IAB A;  1BUD A;  1JH1 A;  2D1O A;  4JP4 A;  4PKV A;  2K2G A;  1Y93 A;  1KBC A;  1XFW A;  4GWN A;  3L0T A;  3LIL A;  4A3W A;  1XFV A;  3HDB A;  3BA0 A;  1GXD A;  1ZTQ A;  3HDA P;  2E3X A;  1ND1 A;  1MMR A;  3WV1 A;  4H84 A;  3SHI A;  3DPE A;  3KMC A;  1UTZ A;  4JIJ A;  2OW9 A;  3LEA A;  5D1S A;  1G49 A;  1O0T A;  2FV5 A;  2OY4 A;  3KHI A;  2KRJ A;  3EDZ A;  5JMY A;  2WOA A;  3EWJ A;  1L6J A;  3DTE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...