1Y9BA

Structure of conserved putative transcriptional factor from vibrio cholerae o1 biovar eltor str. n16961
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
81
structure length
81
Chain Sequence
TTLPRITARVDVDTQDLLAKAAALAGMSSINSFVLNAAIEKAKQVIEREQALKLSQADAVLLMEALDNPAVVNAKLKLASE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conserverd hypothetical protein from Vibrio cholerae O1 biovar eltor str. N16961
rcsb
source organism Vibrio cholerae o1 biovar eltor
molecule tags Structural genomics, unknown function
molecule keywords conserved hypothetical protein
total genus 27
structure length 81
sequence length 81
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08681 DUF1778 Protein of unknown function (DUF1778)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.780 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1y9bA00
2JP3A 1Y9BA 2JO1A 2MKVA
chains in the Genus database with same CATH superfamily
3B5NC 3UIAA 1WMKA 2GUSA 2IYPA 2KZIA 1EXIA 1R5LA 3O6QA 1HWTC 1P84I 1KN7A 5KAIE 2BEQD 1YJWP 2BCCJ 2IDBA 3VMXA 2JO1A 3L71G 1T8ZA 1BE3J 1QX8A 2KNCA 2YO2A 3AEFC 1J1DB 5AW8B 1KYOE 5GTHH 4H13D 1JUNA 2IBZG 1RQUA 1URQD 2Y9YA 3E1RA 3P8MC 1NAYA 4Y99B 3VMAA 5CCHA 2XU6A 3USSA 2L5GB 3TNUA 2WPQA 3PTZA 1SQVE 1KB9H 1VQLP 1OVUA 1N73A 1RF1B 1VF5C 1FOSF 2WWWA 4LC1A 1U7JA 4CPGA 2WTYA 4K35A 3ZDMA 1AQTA 1TU3F 1NGMB 1S1CX 4JBZA 2A45G 3H1ID 4I1LA 1LP1B 1LNQA 2PP6A 2R3CA 2O01N 3AECC 1LTJB 2OTKE 3GHGB 3V5BA 1NO4A 4BRYB 4ZNCA 1H89A 1FOSE 4PV1B 3V4WA 2FFDA 1VQNP 1BCCE 1DX7A 3CCEP 2WPVB 2CPSA 3ABVC 5CJ4A 1X9VA 3AE1C 1NTKK 1U57A 2OQQA 2XV5A 3H1LE 1BE3D 2OYHB 3JSVC 2Q9IA 1QVGO 1E5WA 1FS0E 3WU2H 1IFPA 2B9BA 2NPSD 4I7ZB 3KXDA 1CI6B 1FE6A 3KYQA 2P58A 4GODA 1OWAA 1PV3A 4HB1A 2E76B 1PPJE 4WVZA 3VP8A 3TGUE 3OAKA 2A06G 5KJ7D 1N73B 1IK9A 1ZOYC 2GA1A 3L74G 3V4QA 1OMIA 2V7QH 1N7SC 3HUSB 5L8RJ 2ZVOB 2QJKC 1RY3A 1EZVE 3L73G 1SQVD 3CX5E 2O1KA 1J2JB 2E75B 4QMAA 5APYA 1RF0A 2R32A 3L72E 3L36A 2H8PD 1URQA 1JY2O 1SQBE 5CCHD 1N7SA 3EWKA 1YQ4C 3TF5A 1JO5A 2M8RA 2RKLA 1GL2B 1JB0J 3FXEA 1L4AB 1SFCD 2FKWB 3D71A 2QA4P 3VMZA 1QLED 3PP5A 5M1BA 2VRSA 4L73A 1VL2A 4IL6E 2QE7H 1Q82Q 1NU1K 1FC2C 4D6TJ 2E74C 2QRXA 1LT9B 1SQQJ 2K9JA 1D7MA 1SVFA 1OXZA 2CPBA 1JCDA 2JDIH 3MTUE 3PRJA 2QG4A 2QSIA 3SFEC 1BCCJ 1OX3A 3H1KG 3GG2A 1AQ5A 1LWUB 3G9RA 1M1JA 3V2NA 4IFFA 1BDDA 2C0XA 1FDIA 2ZT9D 3A0HH 3AEGC 5EFWB 1FZCC 3CPWO 1Q81Q 1KFNA 3CC7P 1E79H 2KNCB 3H1HG 2HG5D 4GDOA 1EDLA 1NU1E 1ZXGA 4WY4D 1JY3O 2Z5HA 2KXPB 4YXWH 1USEA 2FYNB 1SQQG 1M57D 3E1IA 1NU1D 1L0LK 5KKZB 1W2EA 2QEXP 2G8YA 3TGUJ 1NTMG 4HYTB 1RQVA 3A5TA 1PL5A 1EDKA 1PGOA 1Y47A 1CZQA 1SLQA 3AEEC 3M0AA 4DOJA 4D6TE 3G4SP 1EXJA 2R3SA 1FZAA 1IO4A 3CCLP 3CX5I 3M9QA 4WY4C 1JY3P 1M56D 1M7LA 5AVZB 1HTLC 5AW7B 4D6TD 2XKMA 4DCKA 1KQSO 1RE3A 2JJLA 2ZXXA 5CHXA 1LWUA 3L37A 2Q3EA 1KQFB 1ZMEC 3FXDA 2B89A 1N7SD 4RO0A 1OVVA 3RBXA 1U7MA 3N7NA 2OYOA 1URQC 3MIWA 3MZWB 2E75D 2WSCH 3Q3DA 3MHVA 2FYUD 2M5AB 2JWDA 3L72J 2C9LY 4LLHA 3CI9A 4XE5B 2HR3A 1OFCX 1P84H 2YKOA 2W8ZA 3QWOC 5KJ7C 2MKVA 1KTMA 2BASA 5AW9B 1S5LX 1SQVJ 1HH0A 3LIEA 2WSEJ 4O9BA 3WMM0 3Q1MA 1KZUB 5AW0B 3D70A 1NKZB 2HPCA 2E42A 2PGDA 4U3FD 1P84D 1IFDA 2YMYA 1QGKB 2OYIB 1FZEA 2ZYAA 1RE3C 4C7NB 3IFMA 3SWYA 1SQVK 2R5BA 3M9BA 3SWKA 1G1IA 3V2RA 1K04A 4N78D 3WUVA 3AEDC 1ZN5A 4WY4A 4DJGA 5B66E 3TGUD 3RK3C 1R8EA 1HGVA 4W80A 5AVVB 3RL0C 1AA0A 2K3RA 1KD1Q 3AE2C 3F89A 4L74A 4JQ0D 1KFMA 3MD0A 5BU8B 2W6BA 2YKPA 1KYOI 2OARA 2ZT9B 1VQ6P 1GW4A 1PZQA 4C7RA 4GOEA 3A0BE 2HODB 4JF7A 1IFIA 1FZGA 1FZBA 1KB9I 1SQXG 5B66H 2IYOA 1VQMP 1VQ5P 2I8DA 3M0DA 3CXHD 2HYNA 1J1EC 3RK2D 3HUSA 3TDKA 4B86A 5AVXB 2KLVA 3RK3E 3AE5C 4BRYA 1S5LE 1WRGA 2M3EA 1HVVA 3G3ZA 5KLIC 1X8YA 3B4SA 3KZIH 2P7JA 2KLUA 1ZRTE 3FX0A 4I2LC 1J1DC 1FU1A 3GF7A 2YIUB 2XZRA 3H1LD 3M06A 3NTNA 1A02F 2V7QJ 2WQYC 1L0LE 4U3FG 4GIFA 2D2CC 1GD2E 1DIPA 2I1KA 4UB8H 3BCCJ 1VQPP 1NTZG 2KZJA 2H89C 4N3YB 2KS1B 3CWBD 1KILA 1NU1J 3FWLA 1LGHB 4K3AA 1GDTA 1EZVI 4JYCA 5C39A 1IJDB 2FXPA 3JCUH 4YXDC 1JY3N 1K8AQ 3ITKA 1FJPA 2FYUE 2AEFA 4H13C 4PD4I 2ZVNB 4ASWA 3GHGC 1KC8Q 1RF0C 3WUUA 4EI2A 3VYIA 5AW4B 3CWBG 2ZJSE 3H1JD 3CLQA 3MUDC 5KJ7A 3GF3A 2KUBA 3W67A 1AV1A 1M1KQ 1ZW0A 2H88C 2B87A 3L75G 3Q2YA 1YIJP 2L91A 1NJIQ 4C7NA 1KYOD 5GTIH 3C1LA 1S2EA 3KHUA 1G2CB 3HTKB 4H0LB 5APXA 4AYCA 5B5EE 1SQPD 2WSEH 3AE9C 5K5GB 1KB9E 1L0NK 5CCGA 1ZRTD 1NHLA 2IFMA 5KLVE 2BCCD 1RE4C 1K05A 3FWNA 3GLMA 5H2FH 3RGUA 2B87B 3RK3D 3VTPC 1PPJG 2HLOA 4WB4A 3GMAA 5APTA 3HUSC 3H32B 1SFCA 3CXHE 1NTZE 3M91A 3RBZA 3L74E 2LKMA 3CXHH 2KOGA 2WSFH 2KP8A 1S5LH 1NAFA 2LXBA 2IZ1A 3CMAP 4GT1A 4OVNF 3PLNA 3R4YA 2NPSC 4R4MA 1M1JC 4XA4A 1LTBC 1YQ3C 3HE4B 2FYUG 1QVFO 3IN6A 3LW5H 1OIPA 4KJMA 1BGYJ 1L2PA 4W7ZA 1SQBG 3RK2B 5KAFH 2OTLP 1AJYA 3CCJP 1GL2C 2QJPC 3CXHI 2IBZI 2QM7A 1KILD 1YI2P 2Z5IA 1K9MQ 1S72P 2O1JA 2E74B 5CMZA 1VF5D 2FFDC 3H25A 1N7LA 2YKQA 3B5NB 3AE6C 1GU4A 3SFDC 1Y8AA 1L4AD 1SFCB 1NTMD 1YBKA 4TLFA 1AFOA 3MGNA 2JP3A 2D2CD 5KLVG 3H1HE 2OTJP 1BGYG 1KQGB 4H44B 3L4FA 4IOIH 5GTHE 3KQGA 3C9IA 4WBAA 2A45I 2WVRA 5GTIE 3G71P 1H88A 3H1KJ 1SQPJ 2KSEA 2LR2A 3U59A 1FDMA 5AW3B 1FJKA 3AE3C 1DH3A 3CX5D 1NTME 1EZVD 3AE7C 4OGQB 4A7PA 4YTPC 2DW3A 2XNDH 4HKZH 5KAFE 5KLVJ 3PJSK 4H44D 2WT7B 2A45H 2AXCA 3RL0g 2AEJA 4OWFA 3L71J 2O01J 3BRTB 1KILE 4IFMA 3WU2E 3TNUB 2IX7C 2H7HA 3CCVP 1S9KD 1FDOA 4WY4B 1IZNB 1HBWA 1NVOA 1BE3E 3QH9A 2XDJA 4LGDE 2Q6QA 3HD7C 1MUUA 3TK1A 5CBOA 2LXCB 4RJTA 1DEBA 2WITA 5E79E 2GM4A 2KB7P 3N4XA 3U1AA 1N86A 3A7OA 3H1LG 4GOFA 1EDJA 1ZR2A 5CJ0A 3HE5A 1SQQD 1BGYE 1T3UA 4DT0A 2WPSA 2N9YB 4KT0J 4UB6H 2K37A 2N9BA 2KK7A 2N1TC 5KLVD 2JR8A 1N73C 1KB9D 3IR9A 2Z4EA 1GL2D 2SPZA 1BSHA 1EZVG 3L73E 4AQRD 4L75A 1NTZK 1KILB 1BSNA 2IBZE 2V4HA 3L72G 4ZKPA 1JMBA 2Y0DA 3HD7A 2IBZD 2K1AA 1RE4A 4PD4D 4PJ0E 1VF5B 1X0TA 1T2KC 1M8OB 1VQ4P 4U7JA 2YNYA 1VQOP 1BE3G 2KYVA 2R5DA 3AEBC 1GTWA 3HE5B 2KS1A 2Q7CA 3WUTA 3A0BH 3BVHA 1IFJA 2FY8A 1L4AC 1LTJC 1SQPK 1EQ7A 5AVSB 1GMJA 3H1IG 3P8CE 3PHLA 4L76A 2HODA 5APVA 1SQXD 1CI6A 3BATA 4PJ0H 1NTMJ 3V6IA 1JNMA 2OGUA 2WZ7A 1BDCA 5E79H 1R5SA 3D6YA 1H0TA 2JKVA 2YXQB 3KPEA 3PH0A 1GZLA 1S4XA 2M0BA 3B71A 3M9HA 4I7ZC 1J1EB 3B8EB 1LWUC 2E76C 1NWQA 1PFIA 2Y9ZA 1Q90D 2O3JA 4ZMDA 1LTJA 2POHA 1CW5A 2W6JH 1HF9A 3TGUG 3SSUA 4UB6E 5APQA 2P67A 1XTGB 1UIXA 2A06E 1NYHA 4I6MC 1SQQE 5AW6B 1N8RQ 1YTZT 1YITP 2E75C 1HJ0A 1YTZI 3HTKA 3L71D 2FYNC 1VDFA 1LT1A 3AE4C 2QM8A 1GL2A 4M3LA 3U1CA 1VQ8P 2RH0A 4D6TG 1SQBK 3CC4P 1JCCA 1L0LG 1LTTC 1JTHB 1WT6A 4U3FE 3V2QA 2K88A 1DD4A 2FXOA 1X22A 1KYOH 2NZ2A 1OZHA 1GK6A 2Q1KA 1H0TB 1NH4A 2CK3H 3M0DC 1W2BO 3H1HD 4HJGH 5BU5A 2M3BA 1K73Q 1VQ7P 5CBNA 1M90Q 4Y28J 1XTCC 2W27A 2ZAEB 1L0NG 5CCGD 1NTZJ 1YHQP 3BCCG 5AVYB 4AUWA 2QJYB 1LT9C 1FZCB 1LTAC 1PGQA 4ASVA 1QL1A 2BEZF 3KZIE 1PGJA 1URQB 1Q2NA 4IL6H 2ITAA 5DJTB 3CD6P 1P84E 2Q3IA 3HRNA 5KTBA 3I5CA 2WMMA 3LW5J 5CCHC 1IFMA 3OJAB 4R4LA 1MFTA 3T97A 3Q5PA 2KSJA 2M5AA 3P32A 2H43A 3O8ZA 1N2DC 2FYUK 4Y99C 3Q5RA 1CSBA 3MUDA 4Z1MH 3I55P 1DD3A 3L71E 1LTIC 2E43A 3L73J 3JCUE 3VMYA 3AEAC 3GHGA 1MZ9A 5KKZC 1OVRA 4W7YA 4XFJA 1RF1C 3CC2P 3KDPB 3VP9A 1NOHA 4EIJA 3BASA 1MKMA 1PP9E 1M1JB 1FZCA 1GU5A 1SQVG 5AW5B 1Y9BA 5DJUB 3RK3B 1AVYA 2ZXEB 2WT7A 1SS1A 5TJHA 3RK2C 1SQPE 1L4AA 1YYCA 1BCCG 2ZFCA 2IFNA 1LP1A 3MP7B 4IL6X 3BCCE 3V2PA 2QJPB 1RF1A 3L70E 3I56P 4YPCA 1Z56A 4PV1C 2E76D 3EQ2A 1NKNA 1YJNP 3BRVB 3A3YB 3NXSA 1QL2A 2WSSH 1GK4A 1NTZD 1EDIA 2GUVA 3P8CD 2A06D 5AVUB 2FFDB 2OYHC 4DZOA 2I1JA 2WSFJ 1EC5A 2O01H 2C9NY 1G2CA 2HFED 4JPZB 4HH2A 3L70J 3CCSP 2ZYGA 3CCMP 1JEKA 5KLIB 4PD4H 2E74D 5TISE 2IZ0A 3OW2O 2E5YA 1OW6A 4PD4E 1N7SB 2J58A 3A2AA 3NFQA 2QJKB 4OH8B 1PP9J 3F5HA 4TT3H 4UB8E 5AVWB 2OYIC 4OGQC 2NPSA 1L0LD 1NTKD 2D2CB 1JM0A 1PP9G 1VQ9P 3L73D 4WWIA 4N6JA 1RHZB 2AXTE 2PRRA 2WSCJ 3H1HJ 3L74J 1YJ9P 2YXRB 1FAVA 1L0NJ 1SQPG 2FBWC 2RMZA 2YO3A 3RL0B 5TISH 1KQLA 3OA7A 4KHXA 4H0LD 5AVTB 3CL3D 3L70G 3S1KA 3CMEP 4OGQD 2Y0EA 2NRGA 4C46A 4EOTA 2OYHA 1BGYD 3Q5SA 2QJYC 2ZT9C 3CWBE 2R44A 3HD7B 3W68A 2E5TA 1H8AA 4NPDA 2N1TD 4JYBA 1SQBD 1FZFA 1LJ2A 1SQXK 1ZLLA 3L75E 5AW1B 3L72D 3L70D 3R2PA 3RL0D 5APUA 4NPEA 3S4RA 1IK7A 5B5EH 1BCCD 3CCQP 3D6ZA 2G3AA 2W90A 4ZKUA 1LTSC 1NTKG 3HD7D 5H2FE 1PP9D 3HE4A 3VN0A 3SWFA 2QIWA 1JMMA 2N1TB 3H1KD 1NU1G 1PPJD 2FYUJ 2PAJA 1KV4A 1NTKJ 3H1KE 3IF4A 2YIUC 1DEEG 1RH5B 2QVAA 2Y0CA 2YMKA 1ZV8A 2AXTH 3NMDA 2P2UA 1HGZA 4U3FJ 1KILC 1Q86Q 1PIXA 2Q5UA 3TYYA 3C8VA 5AVRB 3CCUP 1G1JA 3B5ND 3L75D 3H1IJ 3H32A 2P10A 1FBMA 3FGAD 1S9KE 2BCCG 1USDA 1KMIZ 1S3JA 1JTHA 3H1IE 4H13B 1SP4A 2HPCB 1SQQK 4N78E 3G6EP 1LT9A 2K9JB 1W5CE 2MJZA 3O6QB 1NTMK 5AVQB 4IFDK 1UIIA 1KORA 1T6AA 3AE8C 3K5BA 2W6AA 1OW7A 1T2KD 2FYZA 2WPRA 1NTKE 4MN4C 2KI7B 2XNXA 3H1JG 3L35A 4GKGA 1OW8A 1SFCC 2N1TA 4H0LC 2OYIA 3IAOA 1IC2A 1X79B 1VPCA 3GW6A 4H44C 1AVOA 1JY2N 3JC22 4EDFA 5KLVK 1JOCA 1JY2P 1MFZA 2RN0A 4NPFX 4RESB 4PV1D 1L0LJ 5CCGC 1PGPA 4EYYQ 2IPPA 1HUCA 1ZP0C 2JEEA 3CX5H 3L75J 2UWJE 2K9YA 3L74D 5APWA 3TSIA 1Q7YQ 3II6A 2C0WA 3VOPA 4BXLA 2J5UA 2FXMA 1IFNA 3CWBJ 1QEXA 3T97B 3H1LJ 2NPSB 3EFGA 2BCCE 3LIDA 3H6PA 1MV8A 1LTGC 3A0HE 1A02J 5APSA 3CCRP 1L0NE 1VQKP 2JWAA 1T3JA 1SQBJ 2B88A 2P1JA 3BCCD 1L0ND 2PFXA 3P7KA 4RKUJ 5KAIH 3B5NA 3H1JJ 1ZR4A 2KIKA 1GW3A 2J59M 3E7KA 3S9OA 1SQXJ 1SQXE 5AW2B 1HJBA 2W83C 5BVZA 3EFFK 2AEMA 3H1JE 4BWNA 2ZYDA
chains in the Genus database with same CATH topology
4IL6X 1S5LX 4H44D 2WSEJ 3Q1MA 1WMKA 3D70A 4PV1C 3RL0g 2O01J 1KILE 2E76D 2BEQD 2IDBA 1FDOA 2JO1A 3AEFC 4H13D 1RQUA 1K04A 2WSFJ 1R8EA 3AEDC 3AE2C 2E74D 1HF9A 1VF5C 2ZT9B 1OW6A 4KT0J 4TT3H 4OGQC 1TU3F 2D2CB 1S1CX 1NGMB 3AECC 2WSCJ 4PV1B 2FBWC 2WPVB 3AE5C 4H0LD 3RK3E 3ABVC 5KLIC 3AE1C 4OGQD 1U57A 2OQQA 3Q5SA 1ZRTE 1VF5B 2ZT9C 3GF7A 4U7JA 2V7QJ 2WQYC 3AEBC 4I7ZB 1PV3A 2D2CC 2E76B 1DIPA 1ZOYC 1IK7A 2H89C 1GMJA 1OMIA 3D6ZA 2G3AA 5L8RJ 2QJKC 2E75B 4YXDC 2FXPA 2QIWA 4H13C 3D6YA 2YIUC 2YMKA 3B71A 4I7ZC 3EWKA 3GF3A 1PIXA 1YQ4C 2E76C 4YTPC 2H88C 1JB0J 1Q90D 3D71A 3C8VA 3Q2YA 1UIXA 5M1BA 1NYHA 1VL2A 4H0LB 2P10A 3FGAD 2E75C 1HJ0A 3AE9C 2E74C 1KMIZ 3O6QA 2FYNC 3AE4C 4H13B 1K05A 2QSIA 3GLMA 3SFEC 3GMAA 1DD4A 1KORA 2NZ2A 3G9RA 3AE8C 1FDIA 1OW7A 2ZT9D 3AEGC 3R4YA 4R4MA 4Y28J 1OW8A 4GDOA 4H0LC 1YQ3C 3IAOA 3IN6A 1AJYA 4H44C 2BEZF 2G8YA 2QJPC 1RQVA 4PV1D 1PL5A 3AEEC 1ZP0C 1EXJA 2K9YA 3LW5J 2E74B 4R4LA 1VF5D 3Q5PA 3H25A 2J5UA 3AE6C 3T97B 3SFDC 3Q5RA 1KQFB 1ZMEC 4Z1MH 1DD3A 2JP3A 2D2CD 1KQGB 4H44B 3AEAC 5KKZC 4RKUJ 2E75D 4XFJA 3Q3DA 1EXIA 3AE3C 3S9OA 1MKMA 3AE7C 1Y9BA 4OGQB 2QJYC 2MKVA 1KTMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JP3 A;  1Y9B A;  2JO1 A;  2MKV A; 
#chains in the Genus database with same CATH topology
 3B5N C;  3UIA A;  1WMK A;  2GUS A;  2IYP A;  2KZI A;  1EXI A;  1R5L A;  3O6Q A;  1HWT C;  1P84 I;  1KN7 A;  5KAI E;  2BEQ D;  1YJW P;  2BCC J;  2IDB A;  3VMX A;  2JO1 A;  3L71 G;  1T8Z A;  1BE3 J;  1QX8 A;  2KNC A;  2YO2 A;  3AEF C;  1J1D B;  5AW8 B;  1KYO E;  5GTH H;  4H13 D;  1JUN A;  2IBZ G;  1RQU A;  1URQ D;  2Y9Y A;  3E1R A;  3P8M C;  1NAY A;  4Y99 B;  3VMA A;  5CCH A;  2XU6 A;  3USS A;  2L5G B;  3TNU A;  2WPQ A;  3PTZ A;  1SQV E;  1KB9 H;  1VQL P;  1OVU A;  1N73 A;  1RF1 B;  1VF5 C;  1FOS F;  2WWW A;  4LC1 A;  1U7J A;  4CPG A;  2WTY A;  4K35 A;  3ZDM A;  1AQT A;  1TU3 F;  1NGM B;  1S1C X;  4JBZ A;  2A45 G;  3H1I D;  4I1L A;  1LP1 B;  1LNQ A;  2PP6 A;  2R3C A;  2O01 N;  3AEC C;  1LTJ B;  2OTK E;  3GHG B;  3V5B A;  1NO4 A;  4BRY B;  4ZNC A;  1H89 A;  1FOS E;  4PV1 B;  3V4W A;  2FFD A;  1VQN P;  1BCC E;  1DX7 A;  3CCE P;  2WPV B;  2CPS A;  3ABV C;  5CJ4 A;  1X9V A;  3AE1 C;  1NTK K;  1U57 A;  2OQQ A;  2XV5 A;  3H1L E;  1BE3 D;  2OYH B;  3JSV C;  2Q9I A;  1QVG O;  1E5W A;  1FS0 E;  3WU2 H;  1IFP A;  2B9B A;  2NPS D;  4I7Z B;  3KXD A;  1CI6 B;  1FE6 A;  3KYQ A;  2P58 A;  4GOD A;  1OWA A;  1PV3 A;  4HB1 A;  2E76 B;  1PPJ E;  4WVZ A;  3VP8 A;  3TGU E;  3OAK A;  2A06 G;  5KJ7 D;  1N73 B;  1IK9 A;  1ZOY C;  2GA1 A;  3L74 G;  3V4Q A;  1OMI A;  2V7Q H;  1N7S C;  3HUS B;  5L8R J;  2ZVO B;  2QJK C;  1RY3 A;  1EZV E;  3L73 G;  1SQV D;  3CX5 E;  2O1K A;  1J2J B;  2E75 B;  4QMA A;  5APY A;  1RF0 A;  2R32 A;  3L72 E;  3L36 A;  2H8P D;  1URQ A;  1JY2 O;  1SQB E;  5CCH D;  1N7S A;  3EWK A;  1YQ4 C;  3TF5 A;  1JO5 A;  2M8R A;  2RKL A;  1GL2 B;  1JB0 J;  3FXE A;  1L4A B;  1SFC D;  2FKW B;  3D71 A;  2QA4 P;  3VMZ A;  1QLE D;  3PP5 A;  5M1B A;  2VRS A;  4L73 A;  1VL2 A;  4IL6 E;  2QE7 H;  1Q82 Q;  1NU1 K;  1FC2 C;  4D6T J;  2E74 C;  2QRX A;  1LT9 B;  1SQQ J;  2K9J A;  1D7M A;  1SVF A;  1OXZ A;  2CPB A;  1JCD A;  2JDI H;  3MTU E;  3PRJ A;  2QG4 A;  2QSI A;  3SFE C;  1BCC J;  1OX3 A;  3H1K G;  3GG2 A;  1AQ5 A;  1LWU B;  3G9R A;  1M1J A;  3V2N A;  4IFF A;  1BDD A;  2C0X A;  1FDI A;  2ZT9 D;  3A0H H;  3AEG C;  5EFW B;  1FZC C;  3CPW O;  1Q81 Q;  1KFN A;  3CC7 P;  1E79 H;  2KNC B;  3H1H G;  2HG5 D;  4GDO A;  1EDL A;  1NU1 E;  1ZXG A;  4WY4 D;  1JY3 O;  2Z5H A;  2KXP B;  4YXW H;  1USE A;  2FYN B;  1SQQ G;  1M57 D;  3E1I A;  1NU1 D;  1L0L K;  5KKZ B;  1W2E A;  2QEX P;  2G8Y A;  3TGU J;  1NTM G;  4HYT B;  1RQV A;  3A5T A;  1PL5 A;  1EDK A;  1PGO A;  1Y47 A;  1CZQ A;  1SLQ A;  3AEE C;  3M0A A;  4DOJ A;  4D6T E;  3G4S P;  1EXJ A;  2R3S A;  1FZA A;  1IO4 A;  3CCL P;  3CX5 I;  3M9Q A;  4WY4 C;  1JY3 P;  1M56 D;  1M7L A;  5AVZ B;  1HTL C;  5AW7 B;  4D6T D;  2XKM A;  4DCK A;  1KQS O;  1RE3 A;  2JJL A;  2ZXX A;  5CHX A;  1LWU A;  3L37 A;  2Q3E A;  1KQF B;  1ZME C;  3FXD A;  2B89 A;  1N7S D;  4RO0 A;  1OVV A;  3RBX A;  1U7M A;  3N7N A;  2OYO A;  1URQ C;  3MIW A;  3MZW B;  2E75 D;  2WSC H;  3Q3D A;  3MHV A;  2FYU D;  2M5A B;  2JWD A;  3L72 J;  2C9L Y;  4LLH A;  3CI9 A;  4XE5 B;  2HR3 A;  1OFC X;  1P84 H;  2YKO A;  2W8Z A;  3QWO C;  5KJ7 C;  2MKV A;  1KTM A;  2BAS A;  5AW9 B;  1S5L X;  1SQV J;  1HH0 A;  3LIE A;  2WSE J;  4O9B A;  3WMM 0;  3Q1M A;  1KZU B;  5AW0 B;  3D70 A;  1NKZ B;  2HPC A;  2E42 A;  2PGD A;  4U3F D;  1P84 D;  1IFD A;  2YMY A;  1QGK B;  2OYI B;  1FZE A;  2ZYA A;  1RE3 C;  4C7N B;  3IFM A;  3SWY A;  1SQV K;  2R5B A;  3M9B A;  3SWK A;  1G1I A;  3V2R A;  1K04 A;  4N78 D;  3WUV A;  3AED C;  1ZN5 A;  4WY4 A;  4DJG A;  5B66 E;  3TGU D;  3RK3 C;  1R8E A;  1HGV A;  4W80 A;  5AVV B;  3RL0 C;  1AA0 A;  2K3R A;  1KD1 Q;  3AE2 C;  3F89 A;  4L74 A;  4JQ0 D;  1KFM A;  3MD0 A;  5BU8 B;  2W6B A;  2YKP A;  1KYO I;  2OAR A;  2ZT9 B;  1VQ6 P;  1GW4 A;  1PZQ A;  4C7R A;  4GOE A;  3A0B E;  2HOD B;  4JF7 A;  1IFI A;  1FZG A;  1FZB A;  1KB9 I;  1SQX G;  5B66 H;  2IYO A;  1VQM P;  1VQ5 P;  2I8D A;  3M0D A;  3CXH D;  2HYN A;  1J1E C;  3RK2 D;  3HUS A;  3TDK A;  4B86 A;  5AVX B;  2KLV A;  3RK3 E;  3AE5 C;  4BRY A;  1S5L E;  1WRG A;  2M3E A;  1HVV A;  3G3Z A;  5KLI C;  1X8Y A;  3B4S A;  3KZI H;  2P7J A;  2KLU A;  1ZRT E;  3FX0 A;  4I2L C;  1J1D C;  1FU1 A;  3GF7 A;  2YIU B;  2XZR A;  3H1L D;  3M06 A;  3NTN A;  1A02 F;  2V7Q J;  2WQY C;  1L0L E;  4U3F G;  4GIF A;  2D2C C;  1GD2 E;  1DIP A;  2I1K A;  4UB8 H;  3BCC J;  1VQP P;  1NTZ G;  2KZJ A;  2H89 C;  4N3Y B;  2KS1 B;  3CWB D;  1KIL A;  1NU1 J;  3FWL A;  1LGH B;  4K3A A;  1GDT A;  1EZV I;  4JYC A;  5C39 A;  1IJD B;  2FXP A;  3JCU H;  4YXD C;  1JY3 N;  1K8A Q;  3ITK A;  1FJP A;  2FYU E;  2AEF A;  4H13 C;  4PD4 I;  2ZVN B;  4ASW A;  3GHG C;  1KC8 Q;  1RF0 C;  3WUU A;  4EI2 A;  3VYI A;  5AW4 B;  3CWB G;  2ZJS E;  3H1J D;  3CLQ A;  3MUD C;  5KJ7 A;  3GF3 A;  2KUB A;  3W67 A;  1AV1 A;  1M1K Q;  1ZW0 A;  2H88 C;  2B87 A;  3L75 G;  3Q2Y A;  1YIJ P;  2L91 A;  1NJI Q;  4C7N A;  1KYO D;  5GTI H;  3C1L A;  1S2E A;  3KHU A;  1G2C B;  3HTK B;  4H0L B;  5APX A;  4AYC A;  5B5E E;  1SQP D;  2WSE H;  3AE9 C;  5K5G B;  1KB9 E;  1L0N K;  5CCG A;  1ZRT D;  1NHL A;  2IFM A;  5KLV E;  2BCC D;  1RE4 C;  1K05 A;  3FWN A;  3GLM A;  5H2F H;  3RGU A;  2B87 B;  3RK3 D;  3VTP C;  1PPJ G;  2HLO A;  4WB4 A;  3GMA A;  5APT A;  3HUS C;  3H32 B;  1SFC A;  3CXH E;  1NTZ E;  3M91 A;  3RBZ A;  3L74 E;  2LKM A;  3CXH H;  2KOG A;  2WSF H;  2KP8 A;  1S5L H;  1NAF A;  2LXB A;  2IZ1 A;  3CMA P;  4GT1 A;  4OVN F;  3PLN A;  3R4Y A;  2NPS C;  4R4M A;  1M1J C;  4XA4 A;  1LTB C;  1YQ3 C;  3HE4 B;  2FYU G;  1QVF O;  3IN6 A;  3LW5 H;  1OIP A;  4KJM A;  1BGY J;  1L2P A;  4W7Z A;  1SQB G;  3RK2 B;  5KAF H;  2OTL P;  1AJY A;  3CCJ P;  1GL2 C;  2QJP C;  3CXH I;  2IBZ I;  2QM7 A;  1KIL D;  1YI2 P;  2Z5I A;  1K9M Q;  1S72 P;  2O1J A;  2E74 B;  5CMZ A;  1VF5 D;  2FFD C;  3H25 A;  1N7L A;  2YKQ A;  3B5N B;  3AE6 C;  1GU4 A;  3SFD C;  1Y8A A;  1L4A D;  1SFC B;  1NTM D;  1YBK A;  4TLF A;  1AFO A;  3MGN A;  2JP3 A;  2D2C D;  5KLV G;  3H1H E;  2OTJ P;  1BGY G;  1KQG B;  4H44 B;  3L4F A;  4IOI H;  5GTH E;  3KQG A;  3C9I A;  4WBA A;  2A45 I;  2WVR A;  5GTI E;  3G71 P;  1H88 A;  3H1K J;  1SQP J;  2KSE A;  2LR2 A;  3U59 A;  1FDM A;  5AW3 B;  1FJK A;  3AE3 C;  1DH3 A;  3CX5 D;  1NTM E;  1EZV D;  3AE7 C;  4OGQ B;  4A7P A;  4YTP C;  2DW3 A;  2XND H;  4HKZ H;  5KAF E;  5KLV J;  3PJS K;  4H44 D;  2WT7 B;  2A45 H;  2AXC A;  3RL0 g;  2AEJ A;  4OWF A;  3L71 J;  2O01 J;  3BRT B;  1KIL E;  4IFM A;  3WU2 E;  3TNU B;  2IX7 C;  2H7H A;  3CCV P;  1S9K D;  1FDO A;  4WY4 B;  1IZN B;  1HBW A;  1NVO A;  1BE3 E;  3QH9 A;  2XDJ A;  4LGD E;  2Q6Q A;  3HD7 C;  1MUU A;  3TK1 A;  5CBO A;  2LXC B;  4RJT A;  1DEB A;  2WIT A;  5E79 E;  2GM4 A;  2KB7 P;  3N4X A;  3U1A A;  1N86 A;  3A7O A;  3H1L G;  4GOF A;  1EDJ A;  1ZR2 A;  5CJ0 A;  3HE5 A;  1SQQ D;  1BGY E;  1T3U A;  4DT0 A;  2WPS A;  2N9Y B;  4KT0 J;  4UB6 H;  2K37 A;  2N9B A;  2KK7 A;  2N1T C;  5KLV D;  2JR8 A;  1N73 C;  1KB9 D;  3IR9 A;  2Z4E A;  1GL2 D;  2SPZ A;  1BSH A;  1EZV G;  3L73 E;  4AQR D;  4L75 A;  1NTZ K;  1KIL B;  1BSN A;  2IBZ E;  2V4H A;  3L72 G;  4ZKP A;  1JMB A;  2Y0D A;  3HD7 A;  2IBZ D;  2K1A A;  1RE4 A;  4PD4 D;  4PJ0 E;  1VF5 B;  1X0T A;  1T2K C;  1M8O B;  1VQ4 P;  4U7J A;  2YNY A;  1VQO P;  1BE3 G;  2KYV A;  2R5D A;  3AEB C;  1GTW A;  3HE5 B;  2KS1 A;  2Q7C A;  3WUT A;  3A0B H;  3BVH A;  1IFJ A;  2FY8 A;  1L4A C;  1LTJ C;  1SQP K;  1EQ7 A;  5AVS B;  1GMJ A;  3H1I G;  3P8C E;  3PHL A;  4L76 A;  2HOD A;  5APV A;  1SQX D;  1CI6 A;  3BAT A;  4PJ0 H;  1NTM J;  3V6I A;  1JNM A;  2OGU A;  2WZ7 A;  1BDC A;  5E79 H;  1R5S A;  3D6Y A;  1H0T A;  2JKV A;  2YXQ B;  3KPE A;  3PH0 A;  1GZL A;  1S4X A;  2M0B A;  3B71 A;  3M9H A;  4I7Z C;  1J1E B;  3B8E B;  1LWU C;  2E76 C;  1NWQ A;  1PFI A;  2Y9Z A;  1Q90 D;  2O3J A;  4ZMD A;  1LTJ A;  2POH A;  1CW5 A;  2W6J H;  1HF9 A;  3TGU G;  3SSU A;  4UB6 E;  5APQ A;  2P67 A;  1XTG B;  1UIX A;  2A06 E;  1NYH A;  4I6M C;  1SQQ E;  5AW6 B;  1N8R Q;  1YTZ T;  1YIT P;  2E75 C;  1HJ0 A;  1YTZ I;  3HTK A;  3L71 D;  2FYN C;  1VDF A;  1LT1 A;  3AE4 C;  2QM8 A;  1GL2 A;  4M3L A;  3U1C A;  1VQ8 P;  2RH0 A;  4D6T G;  1SQB K;  3CC4 P;  1JCC A;  1L0L G;  1LTT C;  1JTH B;  1WT6 A;  4U3F E;  3V2Q A;  2K88 A;  1DD4 A;  2FXO A;  1X22 A;  1KYO H;  2NZ2 A;  1OZH A;  1GK6 A;  2Q1K A;  1H0T B;  1NH4 A;  2CK3 H;  3M0D C;  1W2B O;  3H1H D;  4HJG H;  5BU5 A;  2M3B A;  1K73 Q;  1VQ7 P;  5CBN A;  1M90 Q;  4Y28 J;  1XTC C;  2W27 A;  2ZAE B;  1L0N G;  5CCG D;  1NTZ J;  1YHQ P;  3BCC G;  5AVY B;  4AUW A;  2QJY B;  1LT9 C;  1FZC B;  1LTA C;  1PGQ A;  4ASV A;  1QL1 A;  2BEZ F;  3KZI E;  1PGJ A;  1URQ B;  1Q2N A;  4IL6 H;  2ITA A;  5DJT B;  3CD6 P;  1P84 E;  2Q3I A;  3HRN A;  5KTB A;  3I5C A;  2WMM A;  3LW5 J;  5CCH C;  1IFM A;  3OJA B;  4R4L A;  1MFT A;  3T97 A;  3Q5P A;  2KSJ A;  2M5A A;  3P32 A;  2H43 A;  3O8Z A;  1N2D C;  2FYU K;  4Y99 C;  3Q5R A;  1CSB A;  3MUD A;  4Z1M H;  3I55 P;  1DD3 A;  3L71 E;  1LTI C;  2E43 A;  3L73 J;  3JCU E;  3VMY A;  3AEA C;  3GHG A;  1MZ9 A;  5KKZ C;  1OVR A;  4W7Y A;  4XFJ A;  1RF1 C;  3CC2 P;  3KDP B;  3VP9 A;  1NOH A;  4EIJ A;  3BAS A;  1MKM A;  1PP9 E;  1M1J B;  1FZC A;  1GU5 A;  1SQV G;  5AW5 B;  1Y9B A;  5DJU B;  3RK3 B;  1AVY A;  2ZXE B;  2WT7 A;  1SS1 A;  5TJH A;  3RK2 C;  1SQP E;  1L4A A;  1YYC A;  1BCC G;  2ZFC A;  2IFN A;  1LP1 A;  3MP7 B;  4IL6 X;  3BCC E;  3V2P A;  2QJP B;  1RF1 A;  3L70 E;  3I56 P;  4YPC A;  1Z56 A;  4PV1 C;  2E76 D;  3EQ2 A;  1NKN A;  1YJN P;  3BRV B;  3A3Y B;  3NXS A;  1QL2 A;  2WSS H;  1GK4 A;  1NTZ D;  1EDI A;  2GUV A;  3P8C D;  2A06 D;  5AVU B;  2FFD B;  2OYH C;  4DZO A;  2I1J A;  2WSF J;  1EC5 A;  2O01 H;  2C9N Y;  1G2C A;  2HFE D;  4JPZ B;  4HH2 A;  3L70 J;  3CCS P;  2ZYG A;  3CCM P;  1JEK A;  5KLI B;  4PD4 H;  2E74 D;  5TIS E;  2IZ0 A;  3OW2 O;  2E5Y A;  1OW6 A;  4PD4 E;  1N7S B;  2J58 A;  3A2A A;  3NFQ A;  2QJK B;  4OH8 B;  1PP9 J;  3F5H A;  4TT3 H;  4UB8 E;  5AVW B;  2OYI C;  4OGQ C;  2NPS A;  1L0L D;  1NTK D;  2D2C B;  1JM0 A;  1PP9 G;  1VQ9 P;  3L73 D;  4WWI A;  4N6J A;  1RHZ B;  2AXT E;  2PRR A;  2WSC J;  3H1H J;  3L74 J;  1YJ9 P;  2YXR B;  1FAV A;  1L0N J;  1SQP G;  2FBW C;  2RMZ A;  2YO3 A;  3RL0 B;  5TIS H;  1KQL A;  3OA7 A;  4KHX A;  4H0L D;  5AVT B;  3CL3 D;  3L70 G;  3S1K A;  3CME P;  4OGQ D;  2Y0E A;  2NRG A;  4C46 A;  4EOT A;  2OYH A;  1BGY D;  3Q5S A;  2QJY C;  2ZT9 C;  3CWB E;  2R44 A;  3HD7 B;  3W68 A;  2E5T A;  1H8A A;  4NPD A;  2N1T D;  4JYB A;  1SQB D;  1FZF A;  1LJ2 A;  1SQX K;  1ZLL A;  3L75 E;  5AW1 B;  3L72 D;  3L70 D;  3R2P A;  3RL0 D;  5APU A;  4NPE A;  3S4R A;  1IK7 A;  5B5E H;  1BCC D;  3CCQ P;  3D6Z A;  2G3A A;  2W90 A;  4ZKU A;  1LTS C;  1NTK G;  3HD7 D;  5H2F E;  1PP9 D;  3HE4 A;  3VN0 A;  3SWF A;  2QIW A;  1JMM A;  2N1T B;  3H1K D;  1NU1 G;  1PPJ D;  2FYU J;  2PAJ A;  1KV4 A;  1NTK J;  3H1K E;  3IF4 A;  2YIU C;  1DEE G;  1RH5 B;  2QVA A;  2Y0C A;  2YMK A;  1ZV8 A;  2AXT H;  3NMD A;  2P2U A;  1HGZ A;  4U3F J;  1KIL C;  1Q86 Q;  1PIX A;  2Q5U A;  3TYY A;  3C8V A;  5AVR B;  3CCU P;  1G1J A;  3B5N D;  3L75 D;  3H1I J;  3H32 A;  2P10 A;  1FBM A;  3FGA D;  1S9K E;  2BCC G;  1USD A;  1KMI Z;  1S3J A;  1JTH A;  3H1I E;  4H13 B;  1SP4 A;  2HPC B;  1SQQ K;  4N78 E;  3G6E P;  1LT9 A;  2K9J B;  1W5C E;  2MJZ A;  3O6Q B;  1NTM K;  5AVQ B;  4IFD K;  1UII A;  1KOR A;  1T6A A;  3AE8 C;  3K5B A;  2W6A A;  1OW7 A;  1T2K D;  2FYZ A;  2WPR A;  1NTK E;  4MN4 C;  2KI7 B;  2XNX A;  3H1J G;  3L35 A;  4GKG A;  1OW8 A;  1SFC C;  2N1T A;  4H0L C;  2OYI A;  3IAO A;  1IC2 A;  1X79 B;  1VPC A;  3GW6 A;  4H44 C;  1AVO A;  1JY2 N;  3JC2 2;  4EDF A;  5KLV K;  1JOC A;  1JY2 P;  1MFZ A;  2RN0 A;  4NPF X;  4RES B;  4PV1 D;  1L0L J;  5CCG C;  1PGP A;  4EYY Q;  2IPP A;  1HUC A;  1ZP0 C;  2JEE A;  3CX5 H;  3L75 J;  2UWJ E;  2K9Y A;  3L74 D;  5APW A;  3TSI A;  1Q7Y Q;  3II6 A;  2C0W A;  3VOP A;  4BXL A;  2J5U A;  2FXM A;  1IFN A;  3CWB J;  1QEX A;  3T97 B;  3H1L J;  2NPS B;  3EFG A;  2BCC E;  3LID A;  3H6P A;  1MV8 A;  1LTG C;  3A0H E;  1A02 J;  5APS A;  3CCR P;  1L0N E;  1VQK P;  2JWA A;  1T3J A;  1SQB J;  2B88 A;  2P1J A;  3BCC D;  1L0N D;  2PFX A;  3P7K A;  4RKU J;  5KAI H;  3B5N A;  3H1J J;  1ZR4 A;  2KIK A;  1GW3 A;  2J59 M;  3E7K A;  3S9O A;  1SQX J;  1SQX E;  5AW2 B;  1HJB A;  2W83 C;  5BVZ A;  3EFF K;  2AEM A;  3H1J E;  4BWN A;  2ZYD A; 
#chains in the Genus database with same CATH homology
 4IL6 X;  1S5L X;  4H44 D;  2WSE J;  3Q1M A;  1WMK A;  3D70 A;  4PV1 C;  3RL0 g;  2O01 J;  1KIL E;  2E76 D;  2BEQ D;  2IDB A;  1FDO A;  2JO1 A;  3AEF C;  4H13 D;  1RQU A;  1K04 A;  2WSF J;  1R8E A;  3AED C;  3AE2 C;  2E74 D;  1HF9 A;  1VF5 C;  2ZT9 B;  1OW6 A;  4KT0 J;  4TT3 H;  4OGQ C;  1TU3 F;  2D2C B;  1S1C X;  1NGM B;  3AEC C;  2WSC J;  4PV1 B;  2FBW C;  2WPV B;  3AE5 C;  4H0L D;  3RK3 E;  3ABV C;  5KLI C;  3AE1 C;  4OGQ D;  1U57 A;  2OQQ A;  3Q5S A;  1ZRT E;  1VF5 B;  2ZT9 C;  3GF7 A;  4U7J A;  2V7Q J;  2WQY C;  3AEB C;  4I7Z B;  1PV3 A;  2D2C C;  2E76 B;  1DIP A;  1ZOY C;  1IK7 A;  2H89 C;  1GMJ A;  1OMI A;  3D6Z A;  2G3A A;  5L8R J;  2QJK C;  2E75 B;  4YXD C;  2FXP A;  2QIW A;  4H13 C;  3D6Y A;  2YIU C;  2YMK A;  3B71 A;  4I7Z C;  3EWK A;  3GF3 A;  1PIX A;  1YQ4 C;  2E76 C;  4YTP C;  2H88 C;  1JB0 J;  1Q90 D;  3D71 A;  3C8V A;  3Q2Y A;  1UIX A;  5M1B A;  1NYH A;  1VL2 A;  4H0L B;  2P10 A;  3FGA D;  2E75 C;  1HJ0 A;  3AE9 C;  2E74 C;  1KMI Z;  3O6Q A;  2FYN C;  3AE4 C;  4H13 B;  1K05 A;  2QSI A;  3GLM A;  3SFE C;  3GMA A;  1DD4 A;  1KOR A;  2NZ2 A;  3G9R A;  3AE8 C;  1FDI A;  1OW7 A;  2ZT9 D;  3AEG C;  3R4Y A;  4R4M A;  4Y28 J;  1OW8 A;  4GDO A;  4H0L C;  1YQ3 C;  3IAO A;  3IN6 A;  1AJY A;  4H44 C;  2BEZ F;  2G8Y A;  2QJP C;  1RQV A;  4PV1 D;  1PL5 A;  3AEE C;  1ZP0 C;  1EXJ A;  2K9Y A;  3LW5 J;  2E74 B;  4R4L A;  1VF5 D;  3Q5P A;  3H25 A;  2J5U A;  3AE6 C;  3T97 B;  3SFD C;  3Q5R A;  1KQF B;  1ZME C;  4Z1M H;  1DD3 A;  2JP3 A;  2D2C D;  1KQG B;  4H44 B;  3AEA C;  5KKZ C;  4RKU J;  2E75 D;  4XFJ A;  3Q3D A;  1EXI A;  3AE3 C;  3S9O A;  1MKM A;  3AE7 C;  1Y9B A;  4OGQ B;  2QJY C;  2MKV A;  1KTM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...