1Y9BA

Structure of conserved putative transcriptional factor from vibrio cholerae o1 biovar eltor str. n16961
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
81
structure length
81
Chain Sequence
TTLPRITARVDVDTQDLLAKAAALAGMSSINSFVLNAAIEKAKQVIEREQALKLSQADAVLLMEALDNPAVVNAKLKLASE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein
publication title Conserverd hypothetical protein from Vibrio cholerae O1 biovar eltor str. N16961
rcsb
source organism Vibrio cholerae o1 biovar eltor
molecule tags Structural genomics, unknown function
total genus 27
structure length 81
sequence length 81
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08681 DUF1778 Protein of unknown function (DUF1778)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.780 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1y9bA00
2JO1A 1Y9BA 2MKVA 2JP3A
chains in the Genus database with same CATH superfamily
1SQXJ 4GIFA 2L91A 5E79E 4HJGH 5KAIH 1IO4A 3A0HH 1PPJE 3FXEA 4AQRD 1OX3A 4I6MC 1AV1A 1NTZJ 4IL6X 5EFWB 3UIAA 4L73A 2KNCB 4D6TD 1YJNP 5KLVJ 3W68A 5H2FE 5APWA 3W67A 2N9BA 2YXQB 3HUSC 1BCCD 4H13D 1BSHA 1NH4A 1NU1K 3AE6C 1G2CB 4PV1B 2BEZF 3TGUD 3M0DA 2QJKB 3CCEP 3CX5I 5AW5B 2JJLA 2ZYGA 3MHVA 1KILD 2QE7H 1LTJA 1FJKA 4IOIH 1SQQK 3U1AA 3CMEP 1VF5B 2KLVA 1ZN5A 3HD7B 3TK1A 3H1IE 3VYIA 3F5HA 3RL0D 1URQD 4RJTA 1QL1A 5B66E 1L0NJ 1GL2C 1OW6A 1AQTA 2JDIH 1BE3J 4W7ZA 5AW2B 3AEEC 1K9MQ 2HPCA 1FZCC 2WPRA 1SQXK 2JWDA 3CCMP 3O6QB 4D6TE 1JMMA 4XFJA 2YMKA 1AA0A 5APSA 3VP8A 2R32A 3IR9A 3ZDMA 4WY4C 3CCJP 1ZP0C 4EYYQ 2HLOA 1FDIA 2NZ2A 1BCCE 1NTZK 1JUNA 3H1LG 1A02J 1ZW0A 2HODB 3TGUE 5KLVK 2HFED 2NPSD 1KILE 2W6JH 1NAFA 2KS1B 3CC7P 1EC5A 4UB6E 5BVZA 3H1JJ 1IFJA 1AVOA 1FDOA 2Q3EA 3BCCG 3L72J 4IFDK 1FAVA 2PP6A 3CMAP 1NWQA 1NTKD 3JC22 2FXOA 3HTKA 3V2PA 3CCSP 4IL6H 4OH8B 1L0NK 2D2CB 1GZLA 1X0TA 1ZV8A 3SWFA 3H1KJ 2FXPA 1QLED 3PLNA 1KQLA 1NU1G 1YITP 4EI2A 1LTGC 2O01N 1NOHA 3FXDA 4IFFA 2WSEH 3C9IA 3MGNA 1L4AC 2Q1KA 4C46A 2IZ1A 1PFIA 3M9HA 2OTKE 2I8DA 1EZVD 5AVTB 2G3AA 4ZKUA 5C39A 3BVHA 2BASA 1N7LA 1IK9A 3RK2D 5GTHH 2OYIA 1RE3A 4PD4D 1SVFA 3L75G 1NKZB 1EQ7A 1QVFO 2HPCB 5CCGC 1R8EA 1IFPA 1NTKE 3LW5J 3CC4P 5AVQB 3EWKA 1SQPD 1SQBJ 4H44B 2N9YB 1S5LX 1KB9D 5KTBA 1OMIA 2Y9ZA 1GDTA 1PGQA 1S9KD 1SLQA 1LTBC 2UWJE 1NTZG 2P58A 3CI9A 1OVVA 1OW8A 5CCHD 1RF1C 5KLVG 2QM8A 1RF0A 4U7JA 3CC2P 2LXBA 1N7SD 2OYHC 5AVSB 3KDPB 3A2AA 2IX7C 3IAOA 1OVUA 1YQ3C 1QEXA 1SQVJ 1VQ6P 2JO1A 5AW9B 1YYCA 1FZGA 4ASWA 1IZNB 2E74B 1U57A 3JCUE 1T2KC 4PD4E 3V6IA 4OWFA 3Q3DA 2FBWC 3SWYA 4WWIA 2ZXXA 1PZQA 2OTJP 1H88A 3HTKB 1OZHA 1MFTA 1L0NG 1KILA 4ASVA 1JY2O 1KORA 3PJSK 1SQPE 2P10A 3B5NC 3GF3A 1BE3G 1VL2A 1KB9E 3B4SA 1DD3A 1OVRA 1PL5A 1ZRTD 1S9KE 3CCRP 1EXJA 2R3CA 2E75C 1BDDA 1URQA 2A06E 1HH0A 2Y0DA 3RBXA 1SQBK 3VMAA 1E5WA 1PP9D 2WZ7A 3KQGA 1FE6A 1XTGB 2AXTE 1UIXA 2Y0CA 2K9YA 2WMMA 2N1TC 2KOGA 2Q5UA 2B9BA 3SWKA 4PJ0H 1GK4A 1KQGB 1Q90D 2YIUB 2OYIB 1DIPA 4HB1A 4GKGA 4DT0A 2IBZI 3FX0A 3TNUB 1HBWA 3H1JG 3V2NA 1VQ5P 1SQVK 4N78D 2YKOA 1M1JA 1RY3A 2NPSA 3CCQP 2KUBA 1OIPA 3L72G 3L71D 1JB0J 2RH0A 3M91A 1W2BO 2L5GB 4I1LA 5CJ0A 1ZOYC 1LWUC 4HH2A 1ZRTE 3KPEA 1FBMA 2KB7P 2DW3A 2M3BA 3CX5D 1JY3N 1X8YA 2OGUA 2J59M 3CLQA 4K35A 1PP9E 1KN7A 2GM4A 4XE5B 1YHQP 5AVWB 1HWTC 2KYVA 4Z1MH 1J2JB 1M90Q 2HR3A 4PV1C 4JQ0D 2AXCA 3D6YA 2K1AA 5AVZB 1J1DB 4H13B 4W7YA 3TF5A 1VDFA 4U3FJ 3LW5H 2H8PD 2WT7A 1S1CX 4N6JA 5GTIE 1GMJA 3L4FA 4AYCA 2I1KA 4N78E 2FFDC 1KILB 1VQPP 3HD7C 1VQ9P 1L0LD 2QSIA 1BGYD 3L71E 4W80A 4GDOA 2KZIA 1X79B 4L76A 4NPFX 1T3JA 4OVNF 3RL0B 2M3EA 1URQB 1SQBG 3CCUP 3CX5E 1LTAC 1SFCC 3OA7A 3L73D 3AE2C 2W6AA 5AW3B 3D71A 3CCLP 1U7MA 1R5SA 1AFOA 3CWBD 5TJHA 2Q9IA 2WITA 5L8RJ 3RK3C 2WSCJ 4NPEA 2OYOA 4AUWA 4JF7A 1X22A 1SQVG 3CD6P 3EFFK 2FYNB 4RESB 1OFCX 1M1JB 2NPSB 2JEEA 5AW0B 3A7OA 1L0LE 3CPWO 2QA4P 1BGYE 3TSIA 2OQQA 1VQOP 3NMDA 1Y8AA 3WUVA 3N7NA 1S72P 1KTMA 1JCDA 1LJ2A 2E76D 1U7JA 1W5CE 3M06A 3L73E 5TISE 1S5LE 2P7JA 4C7RA 3H25A 3SFDC 1ZLLA 3L74D 2KLUA 3HRNA 2W6BA 2YXRB 2VRSA 5KAFE 3E7KA 2ZJSE 3CWBE 1M7LA 3U59A 1HF9A 3USSA 1NTMD 2RKLA 2FYUD 1RE4C 1IC2A 5DJTB 3GHGC 2IYOA 3V2QA 1FDMA 3PHLA 2QRXA 3LIDA 1T2KD 2BCCD 1W2EA 3BASA 3A3YB 1Q82Q 1FZAA 3H1HJ 2H43A 3CCVP 3RK2B 1XTCC 3B5ND 4JBZA 1JMBA 4UB8H 2YNYA 4H44C 2E75D 2WSFJ 4H0LD 1QL2A 3L74E 4LC1A 1FS0E 2CPSA 2R44A 3OW2O 1LT9C 1DH3A 2M5AA 1NO4A 1NTME 3O8ZA 3Q2YA 2FYUE 4OGQD 2HYNA 2QJPC 3A0BH 1KYOH 4WY4A 3C1LA 1AQ5A 1OWAA 2HG5D 3WU2H 5CBOA 1N7SB 1LGHB 1Z56A 4U3FG 1VQ7P 3AE4C 2BCCE 1S4XA 2E74C 3I5CA 1P84H 3AECC 1YJ9P 2H7HA 1EZVG 1NVOA 2O3JA 2WWWA 5APUA 1FJPA 5APQA 2B87A 3L70J 1Q81Q 2IFMA 4Y99C 3AE1C 1RH5B 2WTYA 3MUDC 1QX8A 2E42A 5KAIE 3A0HE 1JEKA 3AEFC 2XV5A 2FY8A 3VN0A 3H1LD 2IBZD 1JCCA 2WSCH 3FGAD 1SP4A 1T8ZA 1Q7YQ 2E5TA 1DX7A 2WPQA 3AE5C 3CXHH 2ZYDA 4YXWH 2H89C 1LTJB 2OTLP 1CZQA 3VOPA 2A45H 4DCKA 5AW7B 2Q7CA 2P2UA 1L4AA 2Y0EA 2YIUC 3BCCD 2KK7A 2ZT9D 4NPDA 1DEBA 2QJYB 2A45G 5AVVB 3BATA 3NFQA 1P84D 4BWNA 1OW7A 3Q5SA 3H1IJ 2IZ0A 2ZVNB 3HE5A 2ZAEB 1SFCD 3K5BA 1NU1D 1YJWP 2A06D 2M5AB 1JY2N 4JPZB 3H1LE 2IBZE 4YPCA 1H0TA 1J1EB 3L36A 4D6TJ 4YXDC 4BRYA 3KXDA 2C0XA 1SQQD 2QEXP 3ABVC 3RK3D 4XA4A 1PP9G 4I7ZB 1BCCJ 1RF1A 3CL3D 1J1DC 3JSVC 2YKPA 2V4HA 3TGUJ 2FYZA 2W27A 3BCCE 3L75D 3C8VA 3PH0A 1IFIA 5B5EH 2B87B 4JYCA 4EOTA 2YKQA 3E1IA 1SQXD 2WSFH 3H1HG 3G71P 1HGVA 3T97A 3FWNA 5AW6B 1P84E 3V5BA 1GW3A 1RQVA 1RHZB 2Q3IA 1S3JA 1NTZD 3RL0C 1URQC 4KT0J 1NU1E 2QG4A 3SSUA 1N73A 1CSBA 4IL6E 5KLVD 1X9VA 2OARA 1VQ8P 1NHLA 1QGKB 2BEQD 3B5NA 1Y9BA 1IJDB 1HJBA 1KQSO 1YBKA 3OAKA 3EFGA 1SQQE 3RK3E 1A02F 1FU1A 2J58A 3Q1MA 1D7MA 5APVA 2KSEA 1CI6A 2N1TA 3L75E 3D70A 1JY2P 3H6PA 1M1JC 2LXCB 1N8RQ 4KJMA 1GL2D 2JWAA 1L0ND 1SQXE 3Q5PA 2Y9YA 5KJ7C 5GTHE 2O01J 3P7KA 1BE3D 3L70G 3HE5B 5E79H 4L75A 3AE3C 3F89A 1PGJA 3WUUA 4N3YB 1NTZE 3P8MC 5BU8B 2IDBA 5AVRB 1KYOI 4WY4D 1BGYG 5KLVE 2XKMA 1NTKJ 1H0TB 2C9LY 4EIJA 5H2FH 3S9OA 2KXPB 1LWUA 2E76B 5APXA 1PPJG 1EDKA 1G1JA 2XDJA 1P84I 2KNCA 5KLIB 1RQUA 1T6AA 2CPBA 1NKNA 1VPCA 2QVAA 2QJKC 4YTPC 1IFDA 1USDA 4C7NA 3H1JD 1G2CA 1VF5C 1FOSF 5KKZB 3L72D 3L35A 1L0NE 2B88A 2JP3A 2GUVA 5B66H 4BXLA 2FXMA 1BE3E 1FZFA 2O1KA 1JTHA 3RK2C 2POHA 4CPGA 1N73B 3CXHI 3H1KD 2FFDA 3H1IG 1OXZA 3B5NB 1SQPJ 1MV8A 4RKUJ 1Q2NA 2A45I 3II6A 2P1JA 1HGZA 1S2EA 1FZBA 3G3ZA 1EDIA 3V4QA 1L4AD 2E75B 4H0LB 3M0AA 2E5YA 1NTKK 4GODA 4D6TG 1SFCA 1VQLP 5CCHC 2Z4EA 3NTNA 1PGPA 1GU4A 1MKMA 1CI6B 1BCCG 1N86A 2ZFCA 4OGQB 3H1JE 1N7SC 1VQNP 1EXIA 3TGUG 4UB6H 1NTMG 3L72E 1TU3F 2FYUG 3V4WA 1NAYA 4PJ0E 5CCGD 3WMM0 1HVVA 1GD2E 5CJ4A 1NYHA 1LTTC 1SQBD 2LR2A 4B86A 1LTSC 3H1KE 2C9NY 4GOEA 2D2CC 1GW4A 2NRGA 3KYQA 5CHXA 2IYPA 4R4LA 3GLMA 1Y47A 1LWUB 1JO5A 3LIEA 4M3LA 2R5BA 3KZIH 1GU5A 3IFMA 5DJUB 1JM0A 1KMIZ 3M0DC 2B89A 1SQPK 2W90A 1PP9J 2Z5HA 2V7QJ 3RGUA 1HJ0A 4HKZH 1LTJC 4C7NB 2KP8A 1SQVD 3HUSA 2WT7B 1FOSE 2H88C 2O01H 2K37A 2IFNA 1GTWA 1RE4A 5AW8B 2W8ZA 4QMAA 1JOCA 3GHGA 1JTHB 3AE9C 3NXSA 2QJYC 2MJZA 3EQ2A 4IFMA 1SQBE 2GUSA 1CW5A 2FFDB 2PFXA 2MKVA 2ZT9B 3B71A 1PV3A 1LNQA 3GG2A 3OJAB 1GL2A 3L71J 3AE7C 1MFZA 4O9BA 3A5TA 1NTKG 1AVYA 3SFEC 4DOJA 3ITKA 1UIIA 2N1TD 1FZCA 1ZR2A 1SFCB 1J1EC 1MZ9A 2WQYC 2WPSA 2LKMA 3E1RA 1SQVE 4I7ZC 2IBZG 1VQKP 3QH9A 1LT9A 3GMAA 1H89A 1IFNA 1K73Q 3RK3B 5APTA 3TYYA 3JCUH 2P67A 4PD4H 2R5DA 2ZVOB 2I1JA 1WMKA 5KJ7D 3M9BA 4RO0A 2O1JA 4TLFA 2AEMA 1KB9H 2ZXEB 3I55P 1ZR4A 1L0LJ 4ZMDA 1BGYJ 3Q5RA 3TDKA 2Q6QA 1SQPG 1KD1Q 1M8OB 2AXTH 1YTZT 1SS1A 2XU6A 3L73J 4PV1D 3MUDA 2A06G 1YIJP 3HUSB 3KZIE 1G1IA 3MTUE 3G4SP 3MD0A 4U3FD 3CWBJ 2YMYA 3AEGC 3AEBC 2OYIC 1RE3C 5APYA 3M9QA 5K5GB 1KYOD 3GHGB 1SQQG 1VF5D 3QWOC 3GF7A 3HD7D 2XNDH 1EDJA 1MUUA 3RBZA 1T3UA 2WVRA 4I2LC 4DZOA 1GL2B 2Z5IA 2G8YA 3IN6A 1LTIC 3TNUA 2QIWA 4ZKPA 1SQXG 4A7PA 5CCGA 5CBNA 1ZMEC 4UB8E 1RF0C 1FZCB 5M1BA 1NGMB 2V7QH 1L0LK 3I56P 3VMXA 1KFNA 2KI7B 2E76C 3V2RA 4WY4B 1LP1A 3L74J 3R4YA 2YO3A 3MP7B 2C0WA 5KLIC 1LT9B 5BU5A 3BRTB 3D6ZA 4H13C 4JYBA 4U3FE 5CMZA 3VP9A 2M8RA 3CXHD 1DD4A 3L37A 4EDFA 3VMZA 3A0BE 2QJPB 1KYOE 1FC2C 1NTMJ 2FYUJ 1VQMP 1NJIQ 2OYHA 1EZVE 5GTIH 1HUCA 5AW1B 4WVZA 5KKZC 1KILC 4HYTB 3WU2E 3PP5A 3S4RA 4GT1A 1BDCA 1FZEA 2BCCJ 3WUTA 1KC8Q 1K04A 3H32A 4L74A 2K9JA 2D2CD 1M57D 2IPPA 2SPZA 1N73C 1YQ4C 3CX5H 3P8CD 3AE8C 1VQ4P 1IK7A 4Y99B 3L71G 1GK6A 1R5LA 2KIKA 4WB4A 1YTZI 4H0LC 3MIWA 2XZRA 2PAJA 4WBAA 3HE4A 5AVYB 1PGOA 2WSSH 2KZJA 1ZXGA 1L4AB 1PIXA 3CXHE 1AJYA 2YO2A 3P32A 3U1CA 2RMZA 2FYNC 4OGQC 2NPSC 2KSJA 1EDLA 2PRRA 1IFMA 3H1HD 2M0BA 1NTMK 1KQFB 2FYUK 1YI2P 4R4MA 2JR8A 4H44D 1M56D 3G9RA 2GA1A 3P8CE 1L0LG 4GOFA 1EZVI 5TISH 1S5LH 5KJ7A 5AVUB 1BSNA 2AEFA 1HTLC 4BRYB 1N2DC 2PGDA 4MN4C 1LP1B 1KFMA 5KAFH 3H1KG 3G6EP 4LLHA 4PD4I 1L2PA 1RF1B 3L73G 1K05A 1KV4A 3H1LJ 2J5UA 3N4XA 2AEJA 3PTZA 2ZYAA 2OYHB 3R2PA 2R3SA 1KZUB 3VMYA 3CWBG 2E74D 4TT3H 1KB9I 3B8EB 3S1KA 3VTPC 2E43A 4ZNCA 2WPVB 3H1HE 3T97B 5AVXB 3KHUA 3H32B 3L70D 2W83C 2K9JB 4K3AA 4KHXA 5B5EE 3BCCJ 1JY3O 2ZT9C 3AEAC 3FWLA 3HD7A 1K8AQ 3MZWB 3GW6A 2FKWB 2JKVA 3AEDC 1PPJD 2RN0A 1JNMA 2K88A 3HE4B 1E79H 3BRVB 2CK3H 1NU1J 1DEEG 1LT1A 1QVGO 1USEA 2ITAA 3O6QA 3L74G 4Y28J 1WRGA 4DJGA 1H8AA 2N1TB 4LGDE 3IF4A 2QM7A 2XNXA 1SQQJ 2HODA 1WT6A 5CCHA 1Q86Q 2WSEJ 3L70E 1JY3P 1M1KQ 2KS1A 3RL0g 2K3RA 3L75J 5AW4B 1N7SA 2BCCG 3H1ID 3PRJA
chains in the Genus database with same CATH topology
3ABVC 5L8RJ 2QIWA 2WPVB 3Q5PA 1ZP0C 2V7QJ 2WSCJ 1HJ0A 4I7ZB 2G3AA 1ZMEC 1WMKA 3T97B 1FDIA 1KORA 2NZ2A 4RKUJ 3AEFC 2O01J 2P10A 5M1BA 3GF3A 1NGMB 1PIXA 1AJYA 1VL2A 4Z1MH 1DD3A 2H88C 3AE3C 3FGAD 1PL5A 2E75B 4H0LB 4H44C 4IL6X 2E76C 3AE5C 2FYNC 3C8VA 4OGQC 4PV1C 1EXJA 2E75D 2E75C 2WSFJ 4H0LD 2ZT9C 2IDBA 3AEAC 2H89C 3D6YA 1KILE 2OQQA 3R4YA 3Q5RA 1R8EA 3AE9C 4H13B 5KLIC 3LW5J 2QJYC 1MKMA 3D6ZA 3EWKA 1KQFB 4H13C 4H13D 3S9OA 1UIXA 2K9YA 4H44B 1KTMA 4R4MA 3AE6C 3AEDC 1S5LX 2E76B 1DD4A 1RQVA 2YIUC 1S1CX 4OGQB 4PV1B 2MKVA 1OMIA 1GMJA 2BEZF 1FDOA 4H44D 2ZT9B 3B71A 1EXIA 3Q2YA 1PV3A 2E76D 4KT0J 4OGQD 1TU3F 3G9RA 4PV1D 2QJPC 2ZT9D 3H25A 3SFDC 2QSIA 3O6QA 1OW8A 1RQUA 5KKZC 3AE7C 2QJKC 4GDOA 4Y28J 4YTPC 2BEQD 1KQGB 1Q90D 1Y9BA 1NYHA 4U7JA 1DIPA 3SFEC 3AE4C 2D2CB 1OW7A 1VF5B 3AEGC 3AEBC 3Q5SA 1K04A 2E74C 2FXPA 2WQYC 1HF9A 2D2CD 2D2CC 1VF5D 1VF5C 3AECC 1YQ4C 3GF7A 3IAOA 3RK3E 1OW6A 3AE2C 1YQ3C 3AE8C 3Q1MA 2JP3A 4R4LA 1K05A 2WSEJ 1IK7A 3GLMA 1JB0J 3D71A 3AEEC 2J5UA 2JO1A 4I7ZC 1ZOYC 2E74B 3RL0g 3GMAA 1U57A 1ZRTE 3AE1C 2E74D 3D70A 4YXDC 1KMIZ 4TT3H 3Q3DA 2FBWC 2G8YA 4H0LC 3IN6A 4XFJA 2YMKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JO1 A;  1Y9B A;  2MKV A;  2JP3 A; 
#chains in the Genus database with same CATH topology
 1SQX J;  4GIF A;  2L91 A;  5E79 E;  4HJG H;  5KAI H;  1IO4 A;  3A0H H;  1PPJ E;  3FXE A;  4AQR D;  1OX3 A;  4I6M C;  1AV1 A;  1NTZ J;  4IL6 X;  5EFW B;  3UIA A;  4L73 A;  2KNC B;  4D6T D;  1YJN P;  5KLV J;  3W68 A;  5H2F E;  5APW A;  3W67 A;  2N9B A;  2YXQ B;  3HUS C;  1BCC D;  4H13 D;  1BSH A;  1NH4 A;  1NU1 K;  3AE6 C;  1G2C B;  4PV1 B;  2BEZ F;  3TGU D;  3M0D A;  2QJK B;  3CCE P;  3CX5 I;  5AW5 B;  2JJL A;  2ZYG A;  3MHV A;  1KIL D;  2QE7 H;  1LTJ A;  1FJK A;  4IOI H;  1SQQ K;  3U1A A;  3CME P;  1VF5 B;  2KLV A;  1ZN5 A;  3HD7 B;  3TK1 A;  3H1I E;  3VYI A;  3F5H A;  3RL0 D;  1URQ D;  4RJT A;  1QL1 A;  5B66 E;  1L0N J;  1GL2 C;  1OW6 A;  1AQT A;  2JDI H;  1BE3 J;  4W7Z A;  5AW2 B;  3AEE C;  1K9M Q;  2HPC A;  1FZC C;  2WPR A;  1SQX K;  2JWD A;  3CCM P;  3O6Q B;  4D6T E;  1JMM A;  4XFJ A;  2YMK A;  1AA0 A;  5APS A;  3VP8 A;  2R32 A;  3IR9 A;  3ZDM A;  4WY4 C;  3CCJ P;  1ZP0 C;  4EYY Q;  2HLO A;  1FDI A;  2NZ2 A;  1BCC E;  1NTZ K;  1JUN A;  3H1L G;  1A02 J;  1ZW0 A;  2HOD B;  3TGU E;  5KLV K;  2HFE D;  2NPS D;  1KIL E;  2W6J H;  1NAF A;  2KS1 B;  3CC7 P;  1EC5 A;  4UB6 E;  5BVZ A;  3H1J J;  1IFJ A;  1AVO A;  1FDO A;  2Q3E A;  3BCC G;  3L72 J;  4IFD K;  1FAV A;  2PP6 A;  3CMA P;  1NWQ A;  1NTK D;  3JC2 2;  2FXO A;  3HTK A;  3V2P A;  3CCS P;  4IL6 H;  4OH8 B;  1L0N K;  2D2C B;  1GZL A;  1X0T A;  1ZV8 A;  3SWF A;  3H1K J;  2FXP A;  1QLE D;  3PLN A;  1KQL A;  1NU1 G;  1YIT P;  4EI2 A;  1LTG C;  2O01 N;  1NOH A;  3FXD A;  4IFF A;  2WSE H;  3C9I A;  3MGN A;  1L4A C;  2Q1K A;  4C46 A;  2IZ1 A;  1PFI A;  3M9H A;  2OTK E;  2I8D A;  1EZV D;  5AVT B;  2G3A A;  4ZKU A;  5C39 A;  3BVH A;  2BAS A;  1N7L A;  1IK9 A;  3RK2 D;  5GTH H;  2OYI A;  1RE3 A;  4PD4 D;  1SVF A;  3L75 G;  1NKZ B;  1EQ7 A;  1QVF O;  2HPC B;  5CCG C;  1R8E A;  1IFP A;  1NTK E;  3LW5 J;  3CC4 P;  5AVQ B;  3EWK A;  1SQP D;  1SQB J;  4H44 B;  2N9Y B;  1S5L X;  1KB9 D;  5KTB A;  1OMI A;  2Y9Z A;  1GDT A;  1PGQ A;  1S9K D;  1SLQ A;  1LTB C;  2UWJ E;  1NTZ G;  2P58 A;  3CI9 A;  1OVV A;  1OW8 A;  5CCH D;  1RF1 C;  5KLV G;  2QM8 A;  1RF0 A;  4U7J A;  3CC2 P;  2LXB A;  1N7S D;  2OYH C;  5AVS B;  3KDP B;  3A2A A;  2IX7 C;  3IAO A;  1OVU A;  1YQ3 C;  1QEX A;  1SQV J;  1VQ6 P;  2JO1 A;  5AW9 B;  1YYC A;  1FZG A;  4ASW A;  1IZN B;  2E74 B;  1U57 A;  3JCU E;  1T2K C;  4PD4 E;  3V6I A;  4OWF A;  3Q3D A;  2FBW C;  3SWY A;  4WWI A;  2ZXX A;  1PZQ A;  2OTJ P;  1H88 A;  3HTK B;  1OZH A;  1MFT A;  1L0N G;  1KIL A;  4ASV A;  1JY2 O;  1KOR A;  3PJS K;  1SQP E;  2P10 A;  3B5N C;  3GF3 A;  1BE3 G;  1VL2 A;  1KB9 E;  3B4S A;  1DD3 A;  1OVR A;  1PL5 A;  1ZRT D;  1S9K E;  3CCR P;  1EXJ A;  2R3C A;  2E75 C;  1BDD A;  1URQ A;  2A06 E;  1HH0 A;  2Y0D A;  3RBX A;  1SQB K;  3VMA A;  1E5W A;  1PP9 D;  2WZ7 A;  3KQG A;  1FE6 A;  1XTG B;  2AXT E;  1UIX A;  2Y0C A;  2K9Y A;  2WMM A;  2N1T C;  2KOG A;  2Q5U A;  2B9B A;  3SWK A;  4PJ0 H;  1GK4 A;  1KQG B;  1Q90 D;  2YIU B;  2OYI B;  1DIP A;  4HB1 A;  4GKG A;  4DT0 A;  2IBZ I;  3FX0 A;  3TNU B;  1HBW A;  3H1J G;  3V2N A;  1VQ5 P;  1SQV K;  4N78 D;  2YKO A;  1M1J A;  1RY3 A;  2NPS A;  3CCQ P;  2KUB A;  1OIP A;  3L72 G;  3L71 D;  1JB0 J;  2RH0 A;  3M91 A;  1W2B O;  2L5G B;  4I1L A;  5CJ0 A;  1ZOY C;  1LWU C;  4HH2 A;  1ZRT E;  3KPE A;  1FBM A;  2KB7 P;  2DW3 A;  2M3B A;  3CX5 D;  1JY3 N;  1X8Y A;  2OGU A;  2J59 M;  3CLQ A;  4K35 A;  1PP9 E;  1KN7 A;  2GM4 A;  4XE5 B;  1YHQ P;  5AVW B;  1HWT C;  2KYV A;  4Z1M H;  1J2J B;  1M90 Q;  2HR3 A;  4PV1 C;  4JQ0 D;  2AXC A;  3D6Y A;  2K1A A;  5AVZ B;  1J1D B;  4H13 B;  4W7Y A;  3TF5 A;  1VDF A;  4U3F J;  3LW5 H;  2H8P D;  2WT7 A;  1S1C X;  4N6J A;  5GTI E;  1GMJ A;  3L4F A;  4AYC A;  2I1K A;  4N78 E;  2FFD C;  1KIL B;  1VQP P;  3HD7 C;  1VQ9 P;  1L0L D;  2QSI A;  1BGY D;  3L71 E;  4W80 A;  4GDO A;  2KZI A;  1X79 B;  4L76 A;  4NPF X;  1T3J A;  4OVN F;  3RL0 B;  2M3E A;  1URQ B;  1SQB G;  3CCU P;  3CX5 E;  1LTA C;  1SFC C;  3OA7 A;  3L73 D;  3AE2 C;  2W6A A;  5AW3 B;  3D71 A;  3CCL P;  1U7M A;  1R5S A;  1AFO A;  3CWB D;  5TJH A;  2Q9I A;  2WIT A;  5L8R J;  3RK3 C;  2WSC J;  4NPE A;  2OYO A;  4AUW A;  4JF7 A;  1X22 A;  1SQV G;  3CD6 P;  3EFF K;  2FYN B;  4RES B;  1OFC X;  1M1J B;  2NPS B;  2JEE A;  5AW0 B;  3A7O A;  1L0L E;  3CPW O;  2QA4 P;  1BGY E;  3TSI A;  2OQQ A;  1VQO P;  3NMD A;  1Y8A A;  3WUV A;  3N7N A;  1S72 P;  1KTM A;  1JCD A;  1LJ2 A;  2E76 D;  1U7J A;  1W5C E;  3M06 A;  3L73 E;  5TIS E;  1S5L E;  2P7J A;  4C7R A;  3H25 A;  3SFD C;  1ZLL A;  3L74 D;  2KLU A;  3HRN A;  2W6B A;  2YXR B;  2VRS A;  5KAF E;  3E7K A;  2ZJS E;  3CWB E;  1M7L A;  3U59 A;  1HF9 A;  3USS A;  1NTM D;  2RKL A;  2FYU D;  1RE4 C;  1IC2 A;  5DJT B;  3GHG C;  2IYO A;  3V2Q A;  1FDM A;  3PHL A;  2QRX A;  3LID A;  1T2K D;  2BCC D;  1W2E A;  3BAS A;  3A3Y B;  1Q82 Q;  1FZA A;  3H1H J;  2H43 A;  3CCV P;  3RK2 B;  1XTC C;  3B5N D;  4JBZ A;  1JMB A;  4UB8 H;  2YNY A;  4H44 C;  2E75 D;  2WSF J;  4H0L D;  1QL2 A;  3L74 E;  4LC1 A;  1FS0 E;  2CPS A;  2R44 A;  3OW2 O;  1LT9 C;  1DH3 A;  2M5A A;  1NO4 A;  1NTM E;  3O8Z A;  3Q2Y A;  2FYU E;  4OGQ D;  2HYN A;  2QJP C;  3A0B H;  1KYO H;  4WY4 A;  3C1L A;  1AQ5 A;  1OWA A;  2HG5 D;  3WU2 H;  5CBO A;  1N7S B;  1LGH B;  1Z56 A;  4U3F G;  1VQ7 P;  3AE4 C;  2BCC E;  1S4X A;  2E74 C;  3I5C A;  1P84 H;  3AEC C;  1YJ9 P;  2H7H A;  1EZV G;  1NVO A;  2O3J A;  2WWW A;  5APU A;  1FJP A;  5APQ A;  2B87 A;  3L70 J;  1Q81 Q;  2IFM A;  4Y99 C;  3AE1 C;  1RH5 B;  2WTY A;  3MUD C;  1QX8 A;  2E42 A;  5KAI E;  3A0H E;  1JEK A;  3AEF C;  2XV5 A;  2FY8 A;  3VN0 A;  3H1L D;  2IBZ D;  1JCC A;  2WSC H;  3FGA D;  1SP4 A;  1T8Z A;  1Q7Y Q;  2E5T A;  1DX7 A;  2WPQ A;  3AE5 C;  3CXH H;  2ZYD A;  4YXW H;  2H89 C;  1LTJ B;  2OTL P;  1CZQ A;  3VOP A;  2A45 H;  4DCK A;  5AW7 B;  2Q7C A;  2P2U A;  1L4A A;  2Y0E A;  2YIU C;  3BCC D;  2KK7 A;  2ZT9 D;  4NPD A;  1DEB A;  2QJY B;  2A45 G;  5AVV B;  3BAT A;  3NFQ A;  1P84 D;  4BWN A;  1OW7 A;  3Q5S A;  3H1I J;  2IZ0 A;  2ZVN B;  3HE5 A;  2ZAE B;  1SFC D;  3K5B A;  1NU1 D;  1YJW P;  2A06 D;  2M5A B;  1JY2 N;  4JPZ B;  3H1L E;  2IBZ E;  4YPC A;  1H0T A;  1J1E B;  3L36 A;  4D6T J;  4YXD C;  4BRY A;  3KXD A;  2C0X A;  1SQQ D;  2QEX P;  3ABV C;  3RK3 D;  4XA4 A;  1PP9 G;  4I7Z B;  1BCC J;  1RF1 A;  3CL3 D;  1J1D C;  3JSV C;  2YKP A;  2V4H A;  3TGU J;  2FYZ A;  2W27 A;  3BCC E;  3L75 D;  3C8V A;  3PH0 A;  1IFI A;  5B5E H;  2B87 B;  4JYC A;  4EOT A;  2YKQ A;  3E1I A;  1SQX D;  2WSF H;  3H1H G;  3G71 P;  1HGV A;  3T97 A;  3FWN A;  5AW6 B;  1P84 E;  3V5B A;  1GW3 A;  1RQV A;  1RHZ B;  2Q3I A;  1S3J A;  1NTZ D;  3RL0 C;  1URQ C;  4KT0 J;  1NU1 E;  2QG4 A;  3SSU A;  1N73 A;  1CSB A;  4IL6 E;  5KLV D;  1X9V A;  2OAR A;  1VQ8 P;  1NHL A;  1QGK B;  2BEQ D;  3B5N A;  1Y9B A;  1IJD B;  1HJB A;  1KQS O;  1YBK A;  3OAK A;  3EFG A;  1SQQ E;  3RK3 E;  1A02 F;  1FU1 A;  2J58 A;  3Q1M A;  1D7M A;  5APV A;  2KSE A;  1CI6 A;  2N1T A;  3L75 E;  3D70 A;  1JY2 P;  3H6P A;  1M1J C;  2LXC B;  1N8R Q;  4KJM A;  1GL2 D;  2JWA A;  1L0N D;  1SQX E;  3Q5P A;  2Y9Y A;  5KJ7 C;  5GTH E;  2O01 J;  3P7K A;  1BE3 D;  3L70 G;  3HE5 B;  5E79 H;  4L75 A;  3AE3 C;  3F89 A;  1PGJ A;  3WUU A;  4N3Y B;  1NTZ E;  3P8M C;  5BU8 B;  2IDB A;  5AVR B;  1KYO I;  4WY4 D;  1BGY G;  5KLV E;  2XKM A;  1NTK J;  1H0T B;  2C9L Y;  4EIJ A;  5H2F H;  3S9O A;  2KXP B;  1LWU A;  2E76 B;  5APX A;  1PPJ G;  1EDK A;  1G1J A;  2XDJ A;  1P84 I;  2KNC A;  5KLI B;  1RQU A;  1T6A A;  2CPB A;  1NKN A;  1VPC A;  2QVA A;  2QJK C;  4YTP C;  1IFD A;  1USD A;  4C7N A;  3H1J D;  1G2C A;  1VF5 C;  1FOS F;  5KKZ B;  3L72 D;  3L35 A;  1L0N E;  2B88 A;  2JP3 A;  2GUV A;  5B66 H;  4BXL A;  2FXM A;  1BE3 E;  1FZF A;  2O1K A;  1JTH A;  3RK2 C;  2POH A;  4CPG A;  1N73 B;  3CXH I;  3H1K D;  2FFD A;  3H1I G;  1OXZ A;  3B5N B;  1SQP J;  1MV8 A;  4RKU J;  1Q2N A;  2A45 I;  3II6 A;  2P1J A;  1HGZ A;  1S2E A;  1FZB A;  3G3Z A;  1EDI A;  3V4Q A;  1L4A D;  2E75 B;  4H0L B;  3M0A A;  2E5Y A;  1NTK K;  4GOD A;  4D6T G;  1SFC A;  1VQL P;  5CCH C;  2Z4E A;  3NTN A;  1PGP A;  1GU4 A;  1MKM A;  1CI6 B;  1BCC G;  1N86 A;  2ZFC A;  4OGQ B;  3H1J E;  1N7S C;  1VQN P;  1EXI A;  3TGU G;  4UB6 H;  1NTM G;  3L72 E;  1TU3 F;  2FYU G;  3V4W A;  1NAY A;  4PJ0 E;  5CCG D;  3WMM 0;  1HVV A;  1GD2 E;  5CJ4 A;  1NYH A;  1LTT C;  1SQB D;  2LR2 A;  4B86 A;  1LTS C;  3H1K E;  2C9N Y;  4GOE A;  2D2C C;  1GW4 A;  2NRG A;  3KYQ A;  5CHX A;  2IYP A;  4R4L A;  3GLM A;  1Y47 A;  1LWU B;  1JO5 A;  3LIE A;  4M3L A;  2R5B A;  3KZI H;  1GU5 A;  3IFM A;  5DJU B;  1JM0 A;  1KMI Z;  3M0D C;  2B89 A;  1SQP K;  2W90 A;  1PP9 J;  2Z5H A;  2V7Q J;  3RGU A;  1HJ0 A;  4HKZ H;  1LTJ C;  4C7N B;  2KP8 A;  1SQV D;  3HUS A;  2WT7 B;  1FOS E;  2H88 C;  2O01 H;  2K37 A;  2IFN A;  1GTW A;  1RE4 A;  5AW8 B;  2W8Z A;  4QMA A;  1JOC A;  3GHG A;  1JTH B;  3AE9 C;  3NXS A;  2QJY C;  2MJZ A;  3EQ2 A;  4IFM A;  1SQB E;  2GUS A;  1CW5 A;  2FFD B;  2PFX A;  2MKV A;  2ZT9 B;  3B71 A;  1PV3 A;  1LNQ A;  3GG2 A;  3OJA B;  1GL2 A;  3L71 J;  3AE7 C;  1MFZ A;  4O9B A;  3A5T A;  1NTK G;  1AVY A;  3SFE C;  4DOJ A;  3ITK A;  1UII A;  2N1T D;  1FZC A;  1ZR2 A;  1SFC B;  1J1E C;  1MZ9 A;  2WQY C;  2WPS A;  2LKM A;  3E1R A;  1SQV E;  4I7Z C;  2IBZ G;  1VQK P;  3QH9 A;  1LT9 A;  3GMA A;  1H89 A;  1IFN A;  1K73 Q;  3RK3 B;  5APT A;  3TYY A;  3JCU H;  2P67 A;  4PD4 H;  2R5D A;  2ZVO B;  2I1J A;  1WMK A;  5KJ7 D;  3M9B A;  4RO0 A;  2O1J A;  4TLF A;  2AEM A;  1KB9 H;  2ZXE B;  3I55 P;  1ZR4 A;  1L0L J;  4ZMD A;  1BGY J;  3Q5R A;  3TDK A;  2Q6Q A;  1SQP G;  1KD1 Q;  1M8O B;  2AXT H;  1YTZ T;  1SS1 A;  2XU6 A;  3L73 J;  4PV1 D;  3MUD A;  2A06 G;  1YIJ P;  3HUS B;  3KZI E;  1G1I A;  3MTU E;  3G4S P;  3MD0 A;  4U3F D;  3CWB J;  2YMY A;  3AEG C;  3AEB C;  2OYI C;  1RE3 C;  5APY A;  3M9Q A;  5K5G B;  1KYO D;  3GHG B;  1SQQ G;  1VF5 D;  3QWO C;  3GF7 A;  3HD7 D;  2XND H;  1EDJ A;  1MUU A;  3RBZ A;  1T3U A;  2WVR A;  4I2L C;  4DZO A;  1GL2 B;  2Z5I A;  2G8Y A;  3IN6 A;  1LTI C;  3TNU A;  2QIW A;  4ZKP A;  1SQX G;  4A7P A;  5CCG A;  5CBN A;  1ZME C;  4UB8 E;  1RF0 C;  1FZC B;  5M1B A;  1NGM B;  2V7Q H;  1L0L K;  3I56 P;  3VMX A;  1KFN A;  2KI7 B;  2E76 C;  3V2R A;  4WY4 B;  1LP1 A;  3L74 J;  3R4Y A;  2YO3 A;  3MP7 B;  2C0W A;  5KLI C;  1LT9 B;  5BU5 A;  3BRT B;  3D6Z A;  4H13 C;  4JYB A;  4U3F E;  5CMZ A;  3VP9 A;  2M8R A;  3CXH D;  1DD4 A;  3L37 A;  4EDF A;  3VMZ A;  3A0B E;  2QJP B;  1KYO E;  1FC2 C;  1NTM J;  2FYU J;  1VQM P;  1NJI Q;  2OYH A;  1EZV E;  5GTI H;  1HUC A;  5AW1 B;  4WVZ A;  5KKZ C;  1KIL C;  4HYT B;  3WU2 E;  3PP5 A;  3S4R A;  4GT1 A;  1BDC A;  1FZE A;  2BCC J;  3WUT A;  1KC8 Q;  1K04 A;  3H32 A;  4L74 A;  2K9J A;  2D2C D;  1M57 D;  2IPP A;  2SPZ A;  1N73 C;  1YQ4 C;  3CX5 H;  3P8C D;  3AE8 C;  1VQ4 P;  1IK7 A;  4Y99 B;  3L71 G;  1GK6 A;  1R5L A;  2KIK A;  4WB4 A;  1YTZ I;  4H0L C;  3MIW A;  2XZR A;  2PAJ A;  4WBA A;  3HE4 A;  5AVY B;  1PGO A;  2WSS H;  2KZJ A;  1ZXG A;  1L4A B;  1PIX A;  3CXH E;  1AJY A;  2YO2 A;  3P32 A;  3U1C A;  2RMZ A;  2FYN C;  4OGQ C;  2NPS C;  2KSJ A;  1EDL A;  2PRR A;  1IFM A;  3H1H D;  2M0B A;  1NTM K;  1KQF B;  2FYU K;  1YI2 P;  4R4M A;  2JR8 A;  4H44 D;  1M56 D;  3G9R A;  2GA1 A;  3P8C E;  1L0L G;  4GOF A;  1EZV I;  5TIS H;  1S5L H;  5KJ7 A;  5AVU B;  1BSN A;  2AEF A;  1HTL C;  4BRY B;  1N2D C;  2PGD A;  4MN4 C;  1LP1 B;  1KFM A;  5KAF H;  3H1K G;  3G6E P;  4LLH A;  4PD4 I;  1L2P A;  1RF1 B;  3L73 G;  1K05 A;  1KV4 A;  3H1L J;  2J5U A;  3N4X A;  2AEJ A;  3PTZ A;  2ZYA A;  2OYH B;  3R2P A;  2R3S A;  1KZU B;  3VMY A;  3CWB G;  2E74 D;  4TT3 H;  1KB9 I;  3B8E B;  3S1K A;  3VTP C;  2E43 A;  4ZNC A;  2WPV B;  3H1H E;  3T97 B;  5AVX B;  3KHU A;  3H32 B;  3L70 D;  2W83 C;  2K9J B;  4K3A A;  4KHX A;  5B5E E;  3BCC J;  1JY3 O;  2ZT9 C;  3AEA C;  3FWL A;  3HD7 A;  1K8A Q;  3MZW B;  3GW6 A;  2FKW B;  2JKV A;  3AED C;  1PPJ D;  2RN0 A;  1JNM A;  2K88 A;  3HE4 B;  1E79 H;  3BRV B;  2CK3 H;  1NU1 J;  1DEE G;  1LT1 A;  1QVG O;  1USE A;  2ITA A;  3O6Q A;  3L74 G;  4Y28 J;  1WRG A;  4DJG A;  1H8A A;  2N1T B;  4LGD E;  3IF4 A;  2QM7 A;  2XNX A;  1SQQ J;  2HOD A;  1WT6 A;  5CCH A;  1Q86 Q;  2WSE J;  3L70 E;  1JY3 P;  1M1K Q;  2KS1 A;  3RL0 g;  2K3R A;  3L75 J;  5AW4 B;  1N7S A;  2BCC G;  3H1I D;  3PRJ A; 
#chains in the Genus database with same CATH homology
 3ABV C;  5L8R J;  2QIW A;  2WPV B;  3Q5P A;  1ZP0 C;  2V7Q J;  2WSC J;  1HJ0 A;  4I7Z B;  2G3A A;  1ZME C;  1WMK A;  3T97 B;  1FDI A;  1KOR A;  2NZ2 A;  4RKU J;  3AEF C;  2O01 J;  2P10 A;  5M1B A;  3GF3 A;  1NGM B;  1PIX A;  1AJY A;  1VL2 A;  4Z1M H;  1DD3 A;  2H88 C;  3AE3 C;  3FGA D;  1PL5 A;  2E75 B;  4H0L B;  4H44 C;  4IL6 X;  2E76 C;  3AE5 C;  2FYN C;  3C8V A;  4OGQ C;  4PV1 C;  1EXJ A;  2E75 D;  2E75 C;  2WSF J;  4H0L D;  2ZT9 C;  2IDB A;  3AEA C;  2H89 C;  3D6Y A;  1KIL E;  2OQQ A;  3R4Y A;  3Q5R A;  1R8E A;  3AE9 C;  4H13 B;  5KLI C;  3LW5 J;  2QJY C;  1MKM A;  3D6Z A;  3EWK A;  1KQF B;  4H13 C;  4H13 D;  3S9O A;  1UIX A;  2K9Y A;  4H44 B;  1KTM A;  4R4M A;  3AE6 C;  3AED C;  1S5L X;  2E76 B;  1DD4 A;  1RQV A;  2YIU C;  1S1C X;  4OGQ B;  4PV1 B;  2MKV A;  1OMI A;  1GMJ A;  2BEZ F;  1FDO A;  4H44 D;  2ZT9 B;  3B71 A;  1EXI A;  3Q2Y A;  1PV3 A;  2E76 D;  4KT0 J;  4OGQ D;  1TU3 F;  3G9R A;  4PV1 D;  2QJP C;  2ZT9 D;  3H25 A;  3SFD C;  2QSI A;  3O6Q A;  1OW8 A;  1RQU A;  5KKZ C;  3AE7 C;  2QJK C;  4GDO A;  4Y28 J;  4YTP C;  2BEQ D;  1KQG B;  1Q90 D;  1Y9B A;  1NYH A;  4U7J A;  1DIP A;  3SFE C;  3AE4 C;  2D2C B;  1OW7 A;  1VF5 B;  3AEG C;  3AEB C;  3Q5S A;  1K04 A;  2E74 C;  2FXP A;  2WQY C;  1HF9 A;  2D2C D;  2D2C C;  1VF5 D;  1VF5 C;  3AEC C;  1YQ4 C;  3GF7 A;  3IAO A;  3RK3 E;  1OW6 A;  3AE2 C;  1YQ3 C;  3AE8 C;  3Q1M A;  2JP3 A;  4R4L A;  1K05 A;  2WSE J;  1IK7 A;  3GLM A;  1JB0 J;  3D71 A;  3AEE C;  2J5U A;  2JO1 A;  4I7Z C;  1ZOY C;  2E74 B;  3RL0 g;  3GMA A;  1U57 A;  1ZRT E;  3AE1 C;  2E74 D;  3D70 A;  4YXD C;  1KMI Z;  4TT3 H;  3Q3D A;  2FBW C;  2G8Y A;  4H0L C;  3IN6 A;  4XFJ A;  2YMK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...