1Y9BA

Structure of conserved putative transcriptional factor from vibrio cholerae o1 biovar eltor str. n16961
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
81
structure length
81
Chain Sequence
b'TTLPRITARVDVDTQDLLAKAAALAGMSSINSFVLNAAIEKAKQVIEREQALKLSQADAVLLMEALDNPAVVNAKLKLASE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein
publication title Conserverd hypothetical protein from Vibrio cholerae O1 biovar eltor str. N16961
rcsb
source organism Vibrio cholerae o1 biovar eltor
molecule tags Structural genomics, unknown function
total genus 27
structure length 81
sequence length 81
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08681 DUF1778 Protein of unknown function (DUF1778)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.780 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1y9bA00
2MKVA 2JP3A 2JO1A 1Y9BA
chains in the Genus database with same CATH superfamily
2E76C 2XNDH 4DCKA 1JTHA 3CMAP 1UIIA 2W90A 1GU4A 3H1IE 3L36A 1L4AC 4H13B 4JF7A 3L73G 3H25A 1J1DB 2FYUE 1HGVA 2Z4EA 1Q82Q 3VYIA 4NPFX 2IBZI 1M1JC 1NTKE 5CBNA 3EQ2A 2YIUC 2YXRB 4IFFA 2FBWC 2Q3EA 4GDOA 2JDIH 2NPSA 1AV1A 3TYYA 2W83C 1BGYG 5TISE 2R44A 3H1LG 3USSA 2OTKE 2IBZD 3E7KA 5H2FE 2M3BA 2N1TB 1RF1A 1LTJA 1KN7A 4K3AA 5CMZA 3L72E 2Q9IA 1SQBK 4JBZA 3JCUE 4UB6H 1LP1B 1VQ5P 1S9KD 3Q5RA 1X0TA 3PHLA 1GDTA 2KZJA 2E74D 5KAFH 1PV3A 2FFDA 3H6PA 2BCCG 1IC2A 2G8YA 3V4WA 1LNQA 2IYPA 2R3SA 2ZT9D 4Z1MH 1NTMJ 1QEXA 1FZCC 3P8MC 3A0HE 2E74C 1SQXG 2K37A 3I5CA 2K9JB 2C9LY 1GK6A 5GTIH 1H88A 1QLED 1HUCA 1IFDA 1U7JA 2QJYB 2ZT9C 2M5AB 3TGUG 5AW3B 4EDFA 1H8AA 2KLVA 1L0LK 3AECC 3OW2O 3H1JD 1YTZI 1KYOE 2KNCA 1X79B 2A06E 1OW7A 1NTZK 4TT3H 3ZDMA 3BVHA 2WT7B 2ITAA 3Q2YA 1S5LE 2IDBA 2QRXA 1RF1C 1VF5D 1LTJC 1NU1K 3H1HD 3AE9C 3VMZA 3B5NC 3H32A 2VRSA 1HWTC 1GW4A 3H1KJ 4YPCA 1UIXA 3CCMP 3A0BE 3CX5I 2ZAEB 2OYHA 1NO4A 1S5LX 1VQ4P 1URQA 2A45H 5AW8B 3O6QA 2IBZG 1SQBJ 2GM4A 1EC5A 4U3FJ 5KLVE 3CC7P 1T2KC 1DD4A 1OX3A 3CCQP 5CJ4A 4D6TE 3WUUA 3CX5D 3HTKA 1GK4A 1L0NJ 1SQPE 3R4YA 1JOCA 2IX7C 2ZXXA 5AVYB 3Q5PA 3HUSB 3HD7A 2LR2A 3S9OA 2E75B 5TISH 1J1DC 1SQQJ 4N6JA 1YJ9P 3CWBE 4LC1A 3HE4B 3RBXA 2JO1A 3B8EB 3WUVA 3JCUH 3Q3DA 1URQD 3B71A 2JWAA 2YKPA 1FDOA 4PD4I 1EQ7A 3BCCE 1VQKP 2N1TC 4C7RA 4JYCA 1Q81Q 1GTWA 1NTMD 2SPZA 1SQVE 1PFIA 3H1JG 1AJYA 1AFOA 2OTJP 2WSFJ 1QGKB 3WU2H 1GL2A 1VQ7P 2PP6A 1X22A 1LT1A 3GF7A 2D2CB 3CXHE 1H0TB 2WSCJ 1YYCA 1WT6A 2AEMA 1LTAC 3A3YB 4PD4D 1N73A 1OVUA 4PV1B 3HD7D 2POHA 3H1HG 2OTLP 3WUTA 1NH4A 2WTYA 1NYHA 2P1JA 4RJTA 1BCCE 1G2CA 1BE3E 1USDA 4AUWA 1KYOH 3CD6P 5AW9B 1NJIQ 1JY2N 3IFMA 5APTA 4GOEA 4IOIH 1KTMA 1YJWP 1KMIZ 3H1KD 4OGQB 1R5LA 2HFED 2WPVB 3TNUB 1IK7A 4NPEA 2PRRA 2YMYA 3V5BA 2C9NY 3A0BH 3VMAA 1SFCA 4U7JA 2KSJA 3WMM0 1RE3A 4I7ZB 1GL2D 1SQBD 1JM0A 4U3FD 2Q1KA 1LJ2A 1FOSF 5AW0B 4WY4A 1DH3A 3TDKA 3IN6A 3CL3D 3OA7A 4XFJA 1LTGC 1YHQP 1MKMA 1S4XA 3H1IJ 3N7NA 3M9BA 3CC4P 3BRVB 4W7YA 4CPGA 1EZVD 2YXQB 2FYUJ 1L0ND 1KILA 2Y9ZA 1CZQA 1NTKJ 4H44D 2AEFA 2R3CA 1BSHA 1SQQD 3L70E 2FKWB 1JMBA 3G3ZA 2C0WA 1FZEA 2WWWA 3NXSA 1CI6B 3O8ZA 3CCVP 4H44C 3CMEP 1L2PA 1NTMG 3GHGB 1M1JA 1NWQA 1LGHB 3V2RA 1T6AA 5B5EE 1NKZB 3S1KA 1L0LD 5AVSB 1A02J 1PGJA 1SFCD 3L72J 2NPSB 3HUSC 2KS1A 3CCUP 1P84E 2FXPA 2Q3IA 3CPWO 4GT1A 2E75C 4WY4D 1KZUB 3MD0A 1YQ3C 1SQXE 5TJHA 2HPCB 3SSUA 1QL2A 1SFCC 4C46A 2QM7A 4DOJA 1ZRTD 1IJDB 1KILD 4WY4C 2KSEA 2HR3A 2WMMA 2E76D 2RMZA 4ZKUA 3H1KG 3T97B 4YXDC 2WPSA 3L71E 4BXLA 1CW5A 3HE5A 1M56D 2XDJA 1Q7YQ 3AEEC 4LLHA 3L75E 2FFDB 1ZP0C 3SWFA 1SQBG 4U3FG 2P2UA 4IFDK 2K1AA 1PZQA 2A45I 2WSSH 3RBZA 1FZCA 1A02F 1SP4A 2OYIA 2LXBA 2QSIA 3C1LA 3G71P 2PFXA 1YTZT 1MV8A 3NFQA 2I1KA 4OVNF 2N9BA 2ZYGA 1SQQG 2L91A 1OWAA 1JY2P 5K5GB 3H1ID 4I1LA 2QG4A 4Y99C 1VQ6P 2KYVA 4RO0A 4OGQC 1LTIC 2FYUD 3FWLA 1VQMP 3AE6C 1LWUB 3B5NA 5KLVJ 3TF5A 5B66E 1L0LG 3QWOC 4GKGA 1PIXA 2K3RA 5KTBA 1JMMA 1GD2E 4D6TJ 1GZLA 4I7ZC 2OYHB 2ZJSE 1NTZG 3K5BA 5E79H 1MUUA 4WWIA 2JEEA 3L74D 1SQPJ 1NU1G 3PRJA 4L73A 2XNXA 1L0NK 4IL6H 2WSFH 1R5SA 4WB4A 2Q7CA 5APYA 1HJ0A 3C9IA 5KJ7D 5KKZB 1RE4C 3GLMA 3U1CA 3L72D 1SQQK 1EDJA 2WSCH 3CWBJ 3SFEC 2O1KA 3D6YA 2OYIC 5B5EH 3P8CE 3G9RA 2W6JH 4L74A 4ZMDA 3PLNA 2J59M 1M8OB 2JKVA 4C7NB 4DT0A 1VQLP 2ZVOB 3KDPB 1P84H 5KJ7C 1PGPA 1N8RQ 2WITA 1OW6A 3U59A 4ASVA 4LGDE 1CSBA 2QJPB 2I1JA 4PJ0H 3H1HE 3BCCJ 4TLFA 3B5ND 3NMDA 2KLUA 1SQVJ 1KYOI 4BWNA 1LT9B 3Q1MA 1NAFA 5GTHE 3I56P 1JO5A 1T8ZA 2ZVNB 2FXMA 2N1TA 1T2KD 5AVQB 3GW6A 2HYNA 3FGAD 4H0LD 2A45G 1KYOD 1JUNA 1BCCJ 2A06D 2KOGA 3H1IG 1PGQA 2KXPB 4YXWH 5CCGC 1BE3J 4OWFA 3M0AA 4XA4A 5KLIC 1AQTA 4H0LC 4H13D 4ZKPA 1OMIA 1FU1A 3M91A 1EDKA 2YNYA 1J2JB 1N7SB 2HODA 3E1RA 4GODA 4R4MA 3AEDC 1FC2C 5CHXA 2FYNB 2AEJA 2HG5D 4H13C 2OGUA 3L74G 5L8RJ 1OVVA 2KZIA 3M9HA 1YIJP 5KLVD 5H2FH 2R32A 3ITKA 1YITP 2XV5A 1FZAA 3AE5C 3EWKA 4D6TD 3L72G 3KXDA 2J58A 2N1TD 1JY3P 1WMKA 3W67A 1VDFA 2M8RA 3IAOA 1PP9E 3SWKA 1PGOA 1EDIA 3P32A 1SQPD 1U57A 3RK3B 2K88A 2AXTE 2FYUK 3RK2B 1HGZA 1Y47A 3A7OA 2H88C 4I6MC 1NTKK 2WT7A 3L70J 3V4QA 4PD4E 2ZYAA 3RL0B 3VP8A 2AXCA 3M06A 1LWUC 2CK3H 1K8AQ 4B86A 2YKOA 3FXDA 1MFTA 1KC8Q 1K73Q 4WVZA 3A0HH 1PPJD 4BRYA 1BDDA 5BU8B 4GOFA 5DJTB 4UB8E 1FJPA 5C39A 3Q5SA 1W2BO 1L4AB 3LW5J 1SQVD 2QA4P 1QL1A 5AW7B 2BEZF 5M1BA 5KKZC 2WPRA 1SQXJ 1M1JB 4W80A 3I55P 5DJUB 2YIUB 3FX0A 3LIDA 4WBAA 1JNMA 4HYTB 2C0XA 3BRTB 3CXHD 3IR9A 3HUSA 1S5LH 4JYBA 2QJYC 2UWJE 5GTHH 1IFIA 3RGUA 3L73E 3L71J 2QJPC 1EZVI 2JWDA 4EI2A 2Y0EA 1BCCD 1JEKA 1BE3D 1Q86Q 2MJZA 3L75J 2OYOA 1W5CE 3GF3A 4A7PA 1LT9C 2J5UA 5KLVG 4R4LA 1AVYA 1VQ9P 1HTLC 3L37A 1NAYA 2QJKB 1XTGB 2RKLA 2KB7P 2KP8A 1BGYE 2W6BA 3W68A 4D6TG 1HJBA 2KI7B 1M1KQ 1LTSC 3QH9A 3H1LE 4NPDA 3VTPC 1SQPG 5APQA 1YBKA 1KB9E 1S1CX 1AQ5A 1Q90D 5KAIE 1JTHB 4N78E 4YTPC 1L0LE 1ZN5A 4UB6E 5AW1B 1X9VA 3RK3E 2E74B 1NTZE 4I2LC 2E75D 1RHZB 1S2EA 1N7SC 2GUSA 1NU1E 2CPBA 2ZT9B 3CCRP 1PPJG 5CJ0A 2BCCE 1YI2P 2WQYC 2DW3A 3UIAA 2FYNC 1NHLA 4HKZH 1ZRTE 5KLVK 2N9YB 3L70D 1KILE 1GMJA 4JQ0D 4XE5B 2QEXP 1P84I 4IL6X 1SQVG 2E5YA 2PAJA 1RF1B 1M7LA 1LTJB 1EXIA 1ZW0A 3VMYA 1HBWA 1SQPK 3M9QA 3AE3C 2RH0A 3TGUE 1OFCX 1Y9BA 2IPPA 1IK9A 2Q6QA 4M3LA 2JR8A 5CCHD 2K9YA 3CXHH 1N86A 2O01H 3AEAC 3BASA 3RK2C 1VF5B 1P84D 3RL0g 1KFMA 5AVTB 1OIPA 3H1JJ 2D2CD 4UB8H 3MUDC 2W8ZA 4PV1D 2E42A 4KHXA 1VQPP 1BCCG 1T3UA 5CCHC 4KJMA 1RH5B 1IZNB 1KQLA 1JCDA 1RE4A 2JP3A 1NKNA 3H1HJ 3VN0A 2D2CC 4AQRD 3PTZA 3KZIE 2B87A 4PV1C 1YJNP 2WVRA 4IFMA 1FZGA 5AW4B 1EZVG 3L71D 3MGNA 5KJ7A 1SQVK 1L0NG 1CI6A 3PH0A 2YKQA 3R2PA 3A5TA 2IBZE 1JY3N 1EDLA 4HH2A 1K9MQ 4OGQD 3CCSP 1VPCA 3GHGA 3L75D 1YQ4C 3SWYA 2KNCB 2R5BA 3KYQA 2P67A 3M0DC 2V7QJ 3B4SA 1S9KE 5EFWB 3FWNA 2WSEH 1OXZA 3JSVC 1NTKD 3L74E 3H32B 1VQOP 1IFNA 2HPCA 1D7MA 5AVXB 4N3YB 4JPZB 1OW8A 1BSNA 3V6IA 4DZOA 1KB9H 3L70G 1HVVA 5KAIH 1URQB 1VL2A 5APVA 1KQFB 4L75A 5CCGA 2XU6A 3O6QB 4EYYQ 4Y28J 2ZXEB 2QJKC 1RF0C 3T97A 3AE1C 3ABVC 4MN4C 3KQGA 1W2EA 4DJGA 1FDIA 1J1EB 1ZV8A 3HTKB 1KORA 3C8VA 2BASA 3G4SP 2HODB 3H1JE 1DEBA 1LTBC 3TSIA 3WU2E 4HJGH 3HD7B 1N7LA 3LW5H 1PP9J 2QIWA 2BEQD 2NPSD 5CBOA 3GHGC 4ZNCA 1KV4A 4ASWA 3D70A 5AVVB 3PP5A 1KQGB 1MZ9A 2B9BA 3OJAB 3U1AA 5APUA 2B88A 2NPSC 3P8CD 1OZHA 3L71G 2O3JA 1LTTC 2GA1A 2O01J 3CC2P 5CCGD 1JCCA 2Q5UA 3D6ZA 1JB0J 3L75G 2QVAA 3MIWA 1ZR4A 1LWUA 1SS1A 3CX5E 1KQSO 3OAKA 1GL2B 3II6A 1LP1A 2RN0A 1DX7A 3L35A 3AE7C 2FYUG 3KZIH 1VF5C 4BRYB 1K05A 2P58A 1N73B 1NTKG 1SQXK 1FBMA 5AVZB 5AVWB 2FFDC 3D71A 2ZYDA 4H44B 1NGMB 2P10A 3EFFK 3L73J 1QVFO 1G2CB 3EFGA 3VOPA 5AW6B 3SFDC 1FZFA 2K9JA 2JJLA 4C7NA 4EOTA 1NOHA 1ZLLA 3E1IA 3VP9A 3KHUA 2H7HA 2GUVA 2M5AA 2WSEJ 5B66H 1RQUA 5AVRB 2LXCB 1NTME 1BGYJ 1M57D 2M0BA 3H1LJ 3MP7B 2L5GB 1SFCB 2IFMA 1KFNA 3F89A 2OQQA 2H8PD 4RESB 2Z5IA 4WY4B 5BVZA 1LT9A 1PPJE 1USEA 2IZ1A 2R5DA 1X8YA 1L0LJ 2Y9YA 1MFZA 1ZOYC 3CWBD 1AA0A 1PL5A 1DD3A 1FDMA 2NZ2A 3CLQA 2O1JA 1NTZJ 1KILB 1Z56A 1ZMEC 2OYHC 1JY2O 1E79H 1PP9D 2E76B 1NU1J 4AYCA 1URQC 1WRGA 2IZ0A 3CXHI 3MHVA 3NTNA 5AVUB 2BCCJ 2Z5HA 1TU3F 2O01N 3BCCD 4K35A 2M3EA 3LIEA 2CPSA 3JC22 3AE4C 3H1KE 1J1EC 4QMAA 4O9BA 2A06G 1N7SA 2IYOA 2FY8A 1IO4A 1BDCA 5AW5B 5APSA 1XTCC 3P7KA 2KUBA 1N2DC 3TGUJ 3HD7C 1SQBE 3CCLP 4U3FE 2KS1B 1VQNP 1FZBA 1AVOA 1VQ8P 2Y0CA 3CI9A 4RKUJ 2WPQA 3FXEA 2Y0DA 3AEFC 4Y99B 3A2AA 2NRGA 3HE4A 1EZVE 1G1IA 3CCEP 1L0NE 2V7QH 1QX8A 3CX5H 3CCJP 1FS0E 3AE8C 1Y8AA 1HH0A 5BU5A 3V2NA 3MZWB 1SQQE 4EIJA 3KPEA 2FYZA 3HE5B 1E5WA 3V2PA 1ZR2A 3L73D 3MUDA 2WZ7A 2YO2A 2W6AA 1K04A 2B89A 1T3JA 1M90Q 3GG2A 5CCHA 1IFPA 3GMAA 1GL2C 1SVFA 1N7SD 1DIPA 1KB9I 1H0TA 1FZCB 1FAVA 2OYIB 1RY3A 1NVOA 4L76A 2HLOA 1H89A 2B87B 1N73C 5E79E 3CWBG 2G3AA 2V4HA 4W7ZA 3S4RA 2XKMA 1BGYD 2OARA 5KAFE 1L4AA 4IL6E 3H1LD 4HB1A 3HRNA 2I8DA 3L4FA 3L74J 2YO3A 1PP9G 1FOSE 2IFNA 3F5HA 3VMXA 3IF4A 3MTUE 1OVRA 1KB9D 3AE2C 1G1JA 1S72P 2W27A 2AXTH 2PGDA 4N78D 5APWA 3M0DA 3BCCG 1Q2NA 4GIFA 2QE7H 3BATA 5GTIE 1S3JA 1GU5A 3RK3D 2E43A 4PD4H 3RK2D 1NTZD 3TNUA 1EXJA 1HF9A 5APXA 1DEEG 3B5NB 3N4XA 2KK7A 1NU1D 1QVGO 3RL0D 1SLQA 2FXOA 1ZXGA 4OH8B 4KT0J 3G6EP 2H43A 2LKMA 4PJ0E 1IFJA 2YMKA 3RK3C 2BCCD 3AEGC 1RE3C 2XZRA 1KD1Q 5AW2B 2MKVA 2QM8A 2P7JA 2ZFCA 3RL0C 1FE6A 1SQXD 1RF0A 3PJSK 1R8EA 2E5TA 3TK1A 2H89C 3V2QA 1BE3G 1RQVA 5KLIB 1FJKA 1U7MA 1JY3O 1IFMA 1NTMK 4H0LB 1L4AD 1KILC 2KIKA 1GW3A 3AEBC 3TGUD
chains in the Genus database with same CATH topology
1WMKA 1YQ4C 3SFDC 3IAOA 2E76C 1KILE 2E74D 1AJYA 2QJPC 1GMJA 2G3AA 1PV3A 2E76D 2WSFJ 3D70A 3O6QA 1U57A 1PIXA 4YXDC 3T97B 2G8YA 4IL6X 3GF7A 1DD4A 1KQGB 2V7QJ 2H88C 4H13B 2D2CB 2ZT9D 4Z1MH 4I7ZC 2WSCJ 4H44D 1EXIA 3H25A 3FGAD 3AEEC 4PV1B 4H0LD 2WSEJ 1RQUA 3GF3A 3AE2C 3AE3C 2E74C 2J5UA 4R4LA 1ZP0C 4RKUJ 2YIUC 3AEFC 1Y9BA 2O01J 1NYHA 2K9YA 3R4YA 2OQQA 2FBWC 4GDOA 1OW8A 3AEAC 2ZT9C 3Q5PA 1HJ0A 1VF5B 5KLIC 3RL0g 3S9OA 3D6ZA 4H44C 3GLMA 1JB0J 4H0LC 1EXJA 2E75B 3AE8C 4H13D 2D2CD 1HF9A 3SFEC 2QSIA 1VL2A 1OMIA 3D6YA 1KQFB 3AECC 4PV1D 1S1CX 1ZOYC 3G9RA 1Q90D 3Q5SA 1PL5A 1DD3A 4KT0J 4Y28J 1KTMA 2QJKC 1OW7A 3AE1C 4R4MA 2YMKA 4YTPC 3ABVC 3LW5J 1KMIZ 2NZ2A 4OGQB 3AEDC 3AEGC 3AE7C 2JP3A 1FDIA 4TT3H 2WPVB 2JO1A 1ZMEC 1VF5C 3RK3E 3Q2YA 2IDBA 1OW6A 1K05A 2D2CC 2FXPA 4H13C 2E74B 2BEZF 5M1BA 1VF5D 5L8RJ 1IK7A 5KKZC 2E76B 1KORA 2E75C 2MKVA 1K04A 4PV1C 3C8VA 3AE9C 2E75D 3Q3DA 1R8EA 1YQ3C 3B71A 1UIXA 4U7JA 3GMAA 2H89C 3D71A 1TU3F 2ZT9B 1FDOA 1RQVA 4H44B 3Q5RA 1NGMB 1DIPA 4I7ZB 2P10A 3AE5C 4H0LB 2QJYC 3EWKA 4OGQC 3AE4C 2QIWA 1S5LX 2WQYC 4OGQD 3AE6C 2BEQD 3IN6A 2FYNC 3AEBC 4XFJA 3Q1MA 1ZRTE 1MKMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MKV A;  2JP3 A;  2JO1 A;  1Y9B A; 
#chains in the Genus database with same CATH topology
 2E76 C;  2XND H;  4DCK A;  1JTH A;  3CMA P;  1UII A;  2W90 A;  1GU4 A;  3H1I E;  3L36 A;  1L4A C;  4H13 B;  4JF7 A;  3L73 G;  3H25 A;  1J1D B;  2FYU E;  1HGV A;  2Z4E A;  1Q82 Q;  3VYI A;  4NPF X;  2IBZ I;  1M1J C;  1NTK E;  5CBN A;  3EQ2 A;  2YIU C;  2YXR B;  4IFF A;  2FBW C;  2Q3E A;  4GDO A;  2JDI H;  2NPS A;  1AV1 A;  3TYY A;  2W83 C;  1BGY G;  5TIS E;  2R44 A;  3H1L G;  3USS A;  2OTK E;  2IBZ D;  3E7K A;  5H2F E;  2M3B A;  2N1T B;  1RF1 A;  1LTJ A;  1KN7 A;  4K3A A;  5CMZ A;  3L72 E;  2Q9I A;  1SQB K;  4JBZ A;  3JCU E;  4UB6 H;  1LP1 B;  1VQ5 P;  1S9K D;  3Q5R A;  1X0T A;  3PHL A;  1GDT A;  2KZJ A;  2E74 D;  5KAF H;  1PV3 A;  2FFD A;  3H6P A;  2BCC G;  1IC2 A;  2G8Y A;  3V4W A;  1LNQ A;  2IYP A;  2R3S A;  2ZT9 D;  4Z1M H;  1NTM J;  1QEX A;  1FZC C;  3P8M C;  3A0H E;  2E74 C;  1SQX G;  2K37 A;  3I5C A;  2K9J B;  2C9L Y;  1GK6 A;  5GTI H;  1H88 A;  1QLE D;  1HUC A;  1IFD A;  1U7J A;  2QJY B;  2ZT9 C;  2M5A B;  3TGU G;  5AW3 B;  4EDF A;  1H8A A;  2KLV A;  1L0L K;  3AEC C;  3OW2 O;  3H1J D;  1YTZ I;  1KYO E;  2KNC A;  1X79 B;  2A06 E;  1OW7 A;  1NTZ K;  4TT3 H;  3ZDM A;  3BVH A;  2WT7 B;  2ITA A;  3Q2Y A;  1S5L E;  2IDB A;  2QRX A;  1RF1 C;  1VF5 D;  1LTJ C;  1NU1 K;  3H1H D;  3AE9 C;  3VMZ A;  3B5N C;  3H32 A;  2VRS A;  1HWT C;  1GW4 A;  3H1K J;  4YPC A;  1UIX A;  3CCM P;  3A0B E;  3CX5 I;  2ZAE B;  2OYH A;  1NO4 A;  1S5L X;  1VQ4 P;  1URQ A;  2A45 H;  5AW8 B;  3O6Q A;  2IBZ G;  1SQB J;  2GM4 A;  1EC5 A;  4U3F J;  5KLV E;  3CC7 P;  1T2K C;  1DD4 A;  1OX3 A;  3CCQ P;  5CJ4 A;  4D6T E;  3WUU A;  3CX5 D;  3HTK A;  1GK4 A;  1L0N J;  1SQP E;  3R4Y A;  1JOC A;  2IX7 C;  2ZXX A;  5AVY B;  3Q5P A;  3HUS B;  3HD7 A;  2LR2 A;  3S9O A;  2E75 B;  5TIS H;  1J1D C;  1SQQ J;  4N6J A;  1YJ9 P;  3CWB E;  4LC1 A;  3HE4 B;  3RBX A;  2JO1 A;  3B8E B;  3WUV A;  3JCU H;  3Q3D A;  1URQ D;  3B71 A;  2JWA A;  2YKP A;  1FDO A;  4PD4 I;  1EQ7 A;  3BCC E;  1VQK P;  2N1T C;  4C7R A;  4JYC A;  1Q81 Q;  1GTW A;  1NTM D;  2SPZ A;  1SQV E;  1PFI A;  3H1J G;  1AJY A;  1AFO A;  2OTJ P;  2WSF J;  1QGK B;  3WU2 H;  1GL2 A;  1VQ7 P;  2PP6 A;  1X22 A;  1LT1 A;  3GF7 A;  2D2C B;  3CXH E;  1H0T B;  2WSC J;  1YYC A;  1WT6 A;  2AEM A;  1LTA C;  3A3Y B;  4PD4 D;  1N73 A;  1OVU A;  4PV1 B;  3HD7 D;  2POH A;  3H1H G;  2OTL P;  3WUT A;  1NH4 A;  2WTY A;  1NYH A;  2P1J A;  4RJT A;  1BCC E;  1G2C A;  1BE3 E;  1USD A;  4AUW A;  1KYO H;  3CD6 P;  5AW9 B;  1NJI Q;  1JY2 N;  3IFM A;  5APT A;  4GOE A;  4IOI H;  1KTM A;  1YJW P;  1KMI Z;  3H1K D;  4OGQ B;  1R5L A;  2HFE D;  2WPV B;  3TNU B;  1IK7 A;  4NPE A;  2PRR A;  2YMY A;  3V5B A;  2C9N Y;  3A0B H;  3VMA A;  1SFC A;  4U7J A;  2KSJ A;  3WMM 0;  1RE3 A;  4I7Z B;  1GL2 D;  1SQB D;  1JM0 A;  4U3F D;  2Q1K A;  1LJ2 A;  1FOS F;  5AW0 B;  4WY4 A;  1DH3 A;  3TDK A;  3IN6 A;  3CL3 D;  3OA7 A;  4XFJ A;  1LTG C;  1YHQ P;  1MKM A;  1S4X A;  3H1I J;  3N7N A;  3M9B A;  3CC4 P;  3BRV B;  4W7Y A;  4CPG A;  1EZV D;  2YXQ B;  2FYU J;  1L0N D;  1KIL A;  2Y9Z A;  1CZQ A;  1NTK J;  4H44 D;  2AEF A;  2R3C A;  1BSH A;  1SQQ D;  3L70 E;  2FKW B;  1JMB A;  3G3Z A;  2C0W A;  1FZE A;  2WWW A;  3NXS A;  1CI6 B;  3O8Z A;  3CCV P;  4H44 C;  3CME P;  1L2P A;  1NTM G;  3GHG B;  1M1J A;  1NWQ A;  1LGH B;  3V2R A;  1T6A A;  5B5E E;  1NKZ B;  3S1K A;  1L0L D;  5AVS B;  1A02 J;  1PGJ A;  1SFC D;  3L72 J;  2NPS B;  3HUS C;  2KS1 A;  3CCU P;  1P84 E;  2FXP A;  2Q3I A;  3CPW O;  4GT1 A;  2E75 C;  4WY4 D;  1KZU B;  3MD0 A;  1YQ3 C;  1SQX E;  5TJH A;  2HPC B;  3SSU A;  1QL2 A;  1SFC C;  4C46 A;  2QM7 A;  4DOJ A;  1ZRT D;  1IJD B;  1KIL D;  4WY4 C;  2KSE A;  2HR3 A;  2WMM A;  2E76 D;  2RMZ A;  4ZKU A;  3H1K G;  3T97 B;  4YXD C;  2WPS A;  3L71 E;  4BXL A;  1CW5 A;  3HE5 A;  1M56 D;  2XDJ A;  1Q7Y Q;  3AEE C;  4LLH A;  3L75 E;  2FFD B;  1ZP0 C;  3SWF A;  1SQB G;  4U3F G;  2P2U A;  4IFD K;  2K1A A;  1PZQ A;  2A45 I;  2WSS H;  3RBZ A;  1FZC A;  1A02 F;  1SP4 A;  2OYI A;  2LXB A;  2QSI A;  3C1L A;  3G71 P;  2PFX A;  1YTZ T;  1MV8 A;  3NFQ A;  2I1K A;  4OVN F;  2N9B A;  2ZYG A;  1SQQ G;  2L91 A;  1OWA A;  1JY2 P;  5K5G B;  3H1I D;  4I1L A;  2QG4 A;  4Y99 C;  1VQ6 P;  2KYV A;  4RO0 A;  4OGQ C;  1LTI C;  2FYU D;  3FWL A;  1VQM P;  3AE6 C;  1LWU B;  3B5N A;  5KLV J;  3TF5 A;  5B66 E;  1L0L G;  3QWO C;  4GKG A;  1PIX A;  2K3R A;  5KTB A;  1JMM A;  1GD2 E;  4D6T J;  1GZL A;  4I7Z C;  2OYH B;  2ZJS E;  1NTZ G;  3K5B A;  5E79 H;  1MUU A;  4WWI A;  2JEE A;  3L74 D;  1SQP J;  1NU1 G;  3PRJ A;  4L73 A;  2XNX A;  1L0N K;  4IL6 H;  2WSF H;  1R5S A;  4WB4 A;  2Q7C A;  5APY A;  1HJ0 A;  3C9I A;  5KJ7 D;  5KKZ B;  1RE4 C;  3GLM A;  3U1C A;  3L72 D;  1SQQ K;  1EDJ A;  2WSC H;  3CWB J;  3SFE C;  2O1K A;  3D6Y A;  2OYI C;  5B5E H;  3P8C E;  3G9R A;  2W6J H;  4L74 A;  4ZMD A;  3PLN A;  2J59 M;  1M8O B;  2JKV A;  4C7N B;  4DT0 A;  1VQL P;  2ZVO B;  3KDP B;  1P84 H;  5KJ7 C;  1PGP A;  1N8R Q;  2WIT A;  1OW6 A;  3U59 A;  4ASV A;  4LGD E;  1CSB A;  2QJP B;  2I1J A;  4PJ0 H;  3H1H E;  3BCC J;  4TLF A;  3B5N D;  3NMD A;  2KLU A;  1SQV J;  1KYO I;  4BWN A;  1LT9 B;  3Q1M A;  1NAF A;  5GTH E;  3I56 P;  1JO5 A;  1T8Z A;  2ZVN B;  2FXM A;  2N1T A;  1T2K D;  5AVQ B;  3GW6 A;  2HYN A;  3FGA D;  4H0L D;  2A45 G;  1KYO D;  1JUN A;  1BCC J;  2A06 D;  2KOG A;  3H1I G;  1PGQ A;  2KXP B;  4YXW H;  5CCG C;  1BE3 J;  4OWF A;  3M0A A;  4XA4 A;  5KLI C;  1AQT A;  4H0L C;  4H13 D;  4ZKP A;  1OMI A;  1FU1 A;  3M91 A;  1EDK A;  2YNY A;  1J2J B;  1N7S B;  2HOD A;  3E1R A;  4GOD A;  4R4M A;  3AED C;  1FC2 C;  5CHX A;  2FYN B;  2AEJ A;  2HG5 D;  4H13 C;  2OGU A;  3L74 G;  5L8R J;  1OVV A;  2KZI A;  3M9H A;  1YIJ P;  5KLV D;  5H2F H;  2R32 A;  3ITK A;  1YIT P;  2XV5 A;  1FZA A;  3AE5 C;  3EWK A;  4D6T D;  3L72 G;  3KXD A;  2J58 A;  2N1T D;  1JY3 P;  1WMK A;  3W67 A;  1VDF A;  2M8R A;  3IAO A;  1PP9 E;  3SWK A;  1PGO A;  1EDI A;  3P32 A;  1SQP D;  1U57 A;  3RK3 B;  2K88 A;  2AXT E;  2FYU K;  3RK2 B;  1HGZ A;  1Y47 A;  3A7O A;  2H88 C;  4I6M C;  1NTK K;  2WT7 A;  3L70 J;  3V4Q A;  4PD4 E;  2ZYA A;  3RL0 B;  3VP8 A;  2AXC A;  3M06 A;  1LWU C;  2CK3 H;  1K8A Q;  4B86 A;  2YKO A;  3FXD A;  1MFT A;  1KC8 Q;  1K73 Q;  4WVZ A;  3A0H H;  1PPJ D;  4BRY A;  1BDD A;  5BU8 B;  4GOF A;  5DJT B;  4UB8 E;  1FJP A;  5C39 A;  3Q5S A;  1W2B O;  1L4A B;  3LW5 J;  1SQV D;  2QA4 P;  1QL1 A;  5AW7 B;  2BEZ F;  5M1B A;  5KKZ C;  2WPR A;  1SQX J;  1M1J B;  4W80 A;  3I55 P;  5DJU B;  2YIU B;  3FX0 A;  3LID A;  4WBA A;  1JNM A;  4HYT B;  2C0X A;  3BRT B;  3CXH D;  3IR9 A;  3HUS A;  1S5L H;  4JYB A;  2QJY C;  2UWJ E;  5GTH H;  1IFI A;  3RGU A;  3L73 E;  3L71 J;  2QJP C;  1EZV I;  2JWD A;  4EI2 A;  2Y0E A;  1BCC D;  1JEK A;  1BE3 D;  1Q86 Q;  2MJZ A;  3L75 J;  2OYO A;  1W5C E;  3GF3 A;  4A7P A;  1LT9 C;  2J5U A;  5KLV G;  4R4L A;  1AVY A;  1VQ9 P;  1HTL C;  3L37 A;  1NAY A;  2QJK B;  1XTG B;  2RKL A;  2KB7 P;  2KP8 A;  1BGY E;  2W6B A;  3W68 A;  4D6T G;  1HJB A;  2KI7 B;  1M1K Q;  1LTS C;  3QH9 A;  3H1L E;  4NPD A;  3VTP C;  1SQP G;  5APQ A;  1YBK A;  1KB9 E;  1S1C X;  1AQ5 A;  1Q90 D;  5KAI E;  1JTH B;  4N78 E;  4YTP C;  1L0L E;  1ZN5 A;  4UB6 E;  5AW1 B;  1X9V A;  3RK3 E;  2E74 B;  1NTZ E;  4I2L C;  2E75 D;  1RHZ B;  1S2E A;  1N7S C;  2GUS A;  1NU1 E;  2CPB A;  2ZT9 B;  3CCR P;  1PPJ G;  5CJ0 A;  2BCC E;  1YI2 P;  2WQY C;  2DW3 A;  3UIA A;  2FYN C;  1NHL A;  4HKZ H;  1ZRT E;  5KLV K;  2N9Y B;  3L70 D;  1KIL E;  1GMJ A;  4JQ0 D;  4XE5 B;  2QEX P;  1P84 I;  4IL6 X;  1SQV G;  2E5Y A;  2PAJ A;  1RF1 B;  1M7L A;  1LTJ B;  1EXI A;  1ZW0 A;  3VMY A;  1HBW A;  1SQP K;  3M9Q A;  3AE3 C;  2RH0 A;  3TGU E;  1OFC X;  1Y9B A;  2IPP A;  1IK9 A;  2Q6Q A;  4M3L A;  2JR8 A;  5CCH D;  2K9Y A;  3CXH H;  1N86 A;  2O01 H;  3AEA C;  3BAS A;  3RK2 C;  1VF5 B;  1P84 D;  3RL0 g;  1KFM A;  5AVT B;  1OIP A;  3H1J J;  2D2C D;  4UB8 H;  3MUD C;  2W8Z A;  4PV1 D;  2E42 A;  4KHX A;  1VQP P;  1BCC G;  1T3U A;  5CCH C;  4KJM A;  1RH5 B;  1IZN B;  1KQL A;  1JCD A;  1RE4 A;  2JP3 A;  1NKN A;  3H1H J;  3VN0 A;  2D2C C;  4AQR D;  3PTZ A;  3KZI E;  2B87 A;  4PV1 C;  1YJN P;  2WVR A;  4IFM A;  1FZG A;  5AW4 B;  1EZV G;  3L71 D;  3MGN A;  5KJ7 A;  1SQV K;  1L0N G;  1CI6 A;  3PH0 A;  2YKQ A;  3R2P A;  3A5T A;  2IBZ E;  1JY3 N;  1EDL A;  4HH2 A;  1K9M Q;  4OGQ D;  3CCS P;  1VPC A;  3GHG A;  3L75 D;  1YQ4 C;  3SWY A;  2KNC B;  2R5B A;  3KYQ A;  2P67 A;  3M0D C;  2V7Q J;  3B4S A;  1S9K E;  5EFW B;  3FWN A;  2WSE H;  1OXZ A;  3JSV C;  1NTK D;  3L74 E;  3H32 B;  1VQO P;  1IFN A;  2HPC A;  1D7M A;  5AVX B;  4N3Y B;  4JPZ B;  1OW8 A;  1BSN A;  3V6I A;  4DZO A;  1KB9 H;  3L70 G;  1HVV A;  5KAI H;  1URQ B;  1VL2 A;  5APV A;  1KQF B;  4L75 A;  5CCG A;  2XU6 A;  3O6Q B;  4EYY Q;  4Y28 J;  2ZXE B;  2QJK C;  1RF0 C;  3T97 A;  3AE1 C;  3ABV C;  4MN4 C;  3KQG A;  1W2E A;  4DJG A;  1FDI A;  1J1E B;  1ZV8 A;  3HTK B;  1KOR A;  3C8V A;  2BAS A;  3G4S P;  2HOD B;  3H1J E;  1DEB A;  1LTB C;  3TSI A;  3WU2 E;  4HJG H;  3HD7 B;  1N7L A;  3LW5 H;  1PP9 J;  2QIW A;  2BEQ D;  2NPS D;  5CBO A;  3GHG C;  4ZNC A;  1KV4 A;  4ASW A;  3D70 A;  5AVV B;  3PP5 A;  1KQG B;  1MZ9 A;  2B9B A;  3OJA B;  3U1A A;  5APU A;  2B88 A;  2NPS C;  3P8C D;  1OZH A;  3L71 G;  2O3J A;  1LTT C;  2GA1 A;  2O01 J;  3CC2 P;  5CCG D;  1JCC A;  2Q5U A;  3D6Z A;  1JB0 J;  3L75 G;  2QVA A;  3MIW A;  1ZR4 A;  1LWU A;  1SS1 A;  3CX5 E;  1KQS O;  3OAK A;  1GL2 B;  3II6 A;  1LP1 A;  2RN0 A;  1DX7 A;  3L35 A;  3AE7 C;  2FYU G;  3KZI H;  1VF5 C;  4BRY B;  1K05 A;  2P58 A;  1N73 B;  1NTK G;  1SQX K;  1FBM A;  5AVZ B;  5AVW B;  2FFD C;  3D71 A;  2ZYD A;  4H44 B;  1NGM B;  2P10 A;  3EFF K;  3L73 J;  1QVF O;  1G2C B;  3EFG A;  3VOP A;  5AW6 B;  3SFD C;  1FZF A;  2K9J A;  2JJL A;  4C7N A;  4EOT A;  1NOH A;  1ZLL A;  3E1I A;  3VP9 A;  3KHU A;  2H7H A;  2GUV A;  2M5A A;  2WSE J;  5B66 H;  1RQU A;  5AVR B;  2LXC B;  1NTM E;  1BGY J;  1M57 D;  2M0B A;  3H1L J;  3MP7 B;  2L5G B;  1SFC B;  2IFM A;  1KFN A;  3F89 A;  2OQQ A;  2H8P D;  4RES B;  2Z5I A;  4WY4 B;  5BVZ A;  1LT9 A;  1PPJ E;  1USE A;  2IZ1 A;  2R5D A;  1X8Y A;  1L0L J;  2Y9Y A;  1MFZ A;  1ZOY C;  3CWB D;  1AA0 A;  1PL5 A;  1DD3 A;  1FDM A;  2NZ2 A;  3CLQ A;  2O1J A;  1NTZ J;  1KIL B;  1Z56 A;  1ZME C;  2OYH C;  1JY2 O;  1E79 H;  1PP9 D;  2E76 B;  1NU1 J;  4AYC A;  1URQ C;  1WRG A;  2IZ0 A;  3CXH I;  3MHV A;  3NTN A;  5AVU B;  2BCC J;  2Z5H A;  1TU3 F;  2O01 N;  3BCC D;  4K35 A;  2M3E A;  3LIE A;  2CPS A;  3JC2 2;  3AE4 C;  3H1K E;  1J1E C;  4QMA A;  4O9B A;  2A06 G;  1N7S A;  2IYO A;  2FY8 A;  1IO4 A;  1BDC A;  5AW5 B;  5APS A;  1XTC C;  3P7K A;  2KUB A;  1N2D C;  3TGU J;  3HD7 C;  1SQB E;  3CCL P;  4U3F E;  2KS1 B;  1VQN P;  1FZB A;  1AVO A;  1VQ8 P;  2Y0C A;  3CI9 A;  4RKU J;  2WPQ A;  3FXE A;  2Y0D A;  3AEF C;  4Y99 B;  3A2A A;  2NRG A;  3HE4 A;  1EZV E;  1G1I A;  3CCE P;  1L0N E;  2V7Q H;  1QX8 A;  3CX5 H;  3CCJ P;  1FS0 E;  3AE8 C;  1Y8A A;  1HH0 A;  5BU5 A;  3V2N A;  3MZW B;  1SQQ E;  4EIJ A;  3KPE A;  2FYZ A;  3HE5 B;  1E5W A;  3V2P A;  1ZR2 A;  3L73 D;  3MUD A;  2WZ7 A;  2YO2 A;  2W6A A;  1K04 A;  2B89 A;  1T3J A;  1M90 Q;  3GG2 A;  5CCH A;  1IFP A;  3GMA A;  1GL2 C;  1SVF A;  1N7S D;  1DIP A;  1KB9 I;  1H0T A;  1FZC B;  1FAV A;  2OYI B;  1RY3 A;  1NVO A;  4L76 A;  2HLO A;  1H89 A;  2B87 B;  1N73 C;  5E79 E;  3CWB G;  2G3A A;  2V4H A;  4W7Z A;  3S4R A;  2XKM A;  1BGY D;  2OAR A;  5KAF E;  1L4A A;  4IL6 E;  3H1L D;  4HB1 A;  3HRN A;  2I8D A;  3L4F A;  3L74 J;  2YO3 A;  1PP9 G;  1FOS E;  2IFN A;  3F5H A;  3VMX A;  3IF4 A;  3MTU E;  1OVR A;  1KB9 D;  3AE2 C;  1G1J A;  1S72 P;  2W27 A;  2AXT H;  2PGD A;  4N78 D;  5APW A;  3M0D A;  3BCC G;  1Q2N A;  4GIF A;  2QE7 H;  3BAT A;  5GTI E;  1S3J A;  1GU5 A;  3RK3 D;  2E43 A;  4PD4 H;  3RK2 D;  1NTZ D;  3TNU A;  1EXJ A;  1HF9 A;  5APX A;  1DEE G;  3B5N B;  3N4X A;  2KK7 A;  1NU1 D;  1QVG O;  3RL0 D;  1SLQ A;  2FXO A;  1ZXG A;  4OH8 B;  4KT0 J;  3G6E P;  2H43 A;  2LKM A;  4PJ0 E;  1IFJ A;  2YMK A;  3RK3 C;  2BCC D;  3AEG C;  1RE3 C;  2XZR A;  1KD1 Q;  5AW2 B;  2MKV A;  2QM8 A;  2P7J A;  2ZFC A;  3RL0 C;  1FE6 A;  1SQX D;  1RF0 A;  3PJS K;  1R8E A;  2E5T A;  3TK1 A;  2H89 C;  3V2Q A;  1BE3 G;  1RQV A;  5KLI B;  1FJK A;  1U7M A;  1JY3 O;  1IFM A;  1NTM K;  4H0L B;  1L4A D;  1KIL C;  2KIK A;  1GW3 A;  3AEB C;  3TGU D; 
#chains in the Genus database with same CATH homology
 1WMK A;  1YQ4 C;  3SFD C;  3IAO A;  2E76 C;  1KIL E;  2E74 D;  1AJY A;  2QJP C;  1GMJ A;  2G3A A;  1PV3 A;  2E76 D;  2WSF J;  3D70 A;  3O6Q A;  1U57 A;  1PIX A;  4YXD C;  3T97 B;  2G8Y A;  4IL6 X;  3GF7 A;  1DD4 A;  1KQG B;  2V7Q J;  2H88 C;  4H13 B;  2D2C B;  2ZT9 D;  4Z1M H;  4I7Z C;  2WSC J;  4H44 D;  1EXI A;  3H25 A;  3FGA D;  3AEE C;  4PV1 B;  4H0L D;  2WSE J;  1RQU A;  3GF3 A;  3AE2 C;  3AE3 C;  2E74 C;  2J5U A;  4R4L A;  1ZP0 C;  4RKU J;  2YIU C;  3AEF C;  1Y9B A;  2O01 J;  1NYH A;  2K9Y A;  3R4Y A;  2OQQ A;  2FBW C;  4GDO A;  1OW8 A;  3AEA C;  2ZT9 C;  3Q5P A;  1HJ0 A;  1VF5 B;  5KLI C;  3RL0 g;  3S9O A;  3D6Z A;  4H44 C;  3GLM A;  1JB0 J;  4H0L C;  1EXJ A;  2E75 B;  3AE8 C;  4H13 D;  2D2C D;  1HF9 A;  3SFE C;  2QSI A;  1VL2 A;  1OMI A;  3D6Y A;  1KQF B;  3AEC C;  4PV1 D;  1S1C X;  1ZOY C;  3G9R A;  1Q90 D;  3Q5S A;  1PL5 A;  1DD3 A;  4KT0 J;  4Y28 J;  1KTM A;  2QJK C;  1OW7 A;  3AE1 C;  4R4M A;  2YMK A;  4YTP C;  3ABV C;  3LW5 J;  1KMI Z;  2NZ2 A;  4OGQ B;  3AED C;  3AEG C;  3AE7 C;  2JP3 A;  1FDI A;  4TT3 H;  2WPV B;  2JO1 A;  1ZME C;  1VF5 C;  3RK3 E;  3Q2Y A;  2IDB A;  1OW6 A;  1K05 A;  2D2C C;  2FXP A;  4H13 C;  2E74 B;  2BEZ F;  5M1B A;  1VF5 D;  5L8R J;  1IK7 A;  5KKZ C;  2E76 B;  1KOR A;  2E75 C;  2MKV A;  1K04 A;  4PV1 C;  3C8V A;  3AE9 C;  2E75 D;  3Q3D A;  1R8E A;  1YQ3 C;  3B71 A;  1UIX A;  4U7J A;  3GMA A;  2H89 C;  3D71 A;  1TU3 F;  2ZT9 B;  1FDO A;  1RQV A;  4H44 B;  3Q5R A;  1NGM B;  1DIP A;  4I7Z B;  2P10 A;  3AE5 C;  4H0L B;  2QJY C;  3EWK A;  4OGQ C;  3AE4 C;  2QIW A;  1S5L X;  2WQY C;  4OGQ D;  3AE6 C;  2BEQ D;  3IN6 A;  2FYN C;  3AEB C;  4XFJ A;  3Q1M A;  1ZRT E;  1MKM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...