1Y9BA

Structure of conserved putative transcriptional factor from vibrio cholerae o1 biovar eltor str. n16961
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
81
structure length
81
Chain Sequence
TTLPRITARVDVDTQDLLAKAAALAGMSSINSFVLNAAIEKAKQVIEREQALKLSQADAVLLMEALDNPAVVNAKLKLASE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conserverd hypothetical protein from Vibrio cholerae O1 biovar eltor str. N16961
rcsb
source organism Vibrio cholerae o1 biovar eltor
molecule tags Structural genomics, unknown function
molecule keywords conserved hypothetical protein
total genus 27
structure length 81
sequence length 81
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08681 DUF1778 Protein of unknown function (DUF1778)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.780 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1y9bA00
2JP3A 1Y9BA 2MKVA 2JO1A
chains in the Genus database with same CATH superfamily
4WY4A 2Q9IA 1J1EB 1Q2NA 2W83C 5GTIE 2W27A 3BASA 3L71D 4UB8H 3SFEC 2NPSA 2NZ2A 5CCGC 4N78D 1PZQA 1H88A 2KSEA 1M57D 2WPSA 3L72G 5GTHH 1BCCG 3H1LD 1JMBA 3NXSA 4OVNF 2QSIA 1FOSE 3A7OA 3EFGA 3A0HE 1S5LX 2QJKC 3Q5PA 1QL2A 4N3YB 1PP9D 4HYTB 1RF0C 2B9BA 1VQMP 1AQ5A 1GW4A 1SQPK 2KP8A 1X9VA 3AE6C 2RMZA 2ZFCA 3PLNA 2C0WA 4OGQC 2WPVB 1NU1G 1T2KD 1FJPA 1JTHB 2E75D 4XE5B 5B5EE 4KT0J 2K9JB 3L35A 1K73Q 3F5HA 4YTPC 1ZOYC 1SQPG 2M8RA 4W7YA 1HH0A 1P84E 3CWBD 4RKUJ 1LT9A 1N7LA 1SQQJ 1YTZT 2KZIA 2MJZA 3II6A 3VMYA 3VP8A 3HE5B 1YJ9P 4NPEA 2JDIH 2P1JA 3GHGB 3GLMA 5AW2B 1YBKA 1SQVD 1TU3F 4W80A 4WY4B 5KAIH 2KUBA 3A0BH 1SS1A 1KORA 1T6AA 2QE7H 1MZ9A 2J5UA 4HJGH 3RL0B 3VN0A 1NTMJ 2W90A 2XV5A 4U3FE 5AW7B 1RE3C 3G71P 4L73A 1BDDA 4H13B 1KB9H 4EYYQ 1SQBE 1ZRTD 3CPWO 1HGZA 2IZ1A 1N7SC 1SQXD 3H25A 1K9MQ 4D6TE 1NU1D 1VL2A 2Q3IA 2Y9YA 1AQTA 3L70D 5CBNA 1VQNP 5M1BA 1M1JA 3HD7C 3HRNA 1LTAC 3CCQP 3TNUB 2JP3A 2P2UA 2G3AA 1VQ6P 4IFFA 3L74G 1OVUA 1P84H 1EXJA 1KILB 3D6YA 2HR3A 3CX5I 2NPSB 2Y0EA 1H89A 5AW9B 2E5YA 3KXDA 4U3FD 2AXTH 2C0XA 1JUNA 1FZCB 3USSA 1M7LA 1SQBG 1ZP0C 5AVVB 3RL0D 4PD4H 3VP9A 3CC7P 4KJMA 5KAIE 2KYVA 3A0BE 4GT1A 1RE3A 2QRXA 3V2QA 4EI2A 1GL2D 2G8YA 3GF3A 4OGQD 1NTKE 1Q82Q 1DEEG 2KLUA 3CC2P 1EC5A 3GMAA 2CPSA 1YI2P 3H1JJ 1VF5D 2K3RA 5KLIC 2O3JA 3E7KA 1P84D 2OYIA 1EZVD 1KILA 1NTME 3C9IA 4GDOA 5KAFE 3RK3E 1QVFO 2NPSD 2P67A 3H32A 2BCCD 3I5CA 4HH2A 2B89A 2E5TA 1KILD 3H1LG 3GHGA 1M1JB 5KKZB 3WUTA 3H1ID 5E79H 4BRYB 2A06D 1NHLA 3M0DC 1S5LH 1LTJA 1LT9B 2KK7A 2QVAA 1NTKG 2IBZI 4DJGA 5CMZA 5AVTB 1PP9J 2YO3A 1PP9E 1M90Q 1PFIA 2P7JA 2L91A 3AEGC 2IFNA 1H0TB 1GL2B 1IO4A 1OW6A 2HYNA 2LXBA 5TISE 5KLVK 2KNCB 1FE6A 1AVYA 3S9OA 1SQVK 4HB1A 1NTKK 1N7SD 4OWFA 1YQ3C 2N9YB 2Q5UA 4UB8E 1R5LA 2Z5HA 3BCCD 1KYOE 3GHGC 3SWYA 1SQXE 1HJ0A 5APTA 5APXA 2C9NY 1BGYD 5KLVG 2E43A 4WWIA 1KB9D 1SQVG 3L72D 4XFJA 3D6ZA 1KB9I 3E1IA 2IBZD 1N86A 3CWBE 2GUSA 2ZT9C 2A06G 3AE8C 1PGPA 3M0AA 1GD2E 2XDJA 1JY2P 1OXZA 2R5BA 3AEBC 3V4QA 1D7MA 2WSCJ 3G6EP 1H0TA 3RBXA 3FXEA 3CLQA 1KFNA 1SQXG 2LR2A 2JKVA 1E79H 3BRTB 4U7JA 1NTZD 4BRYA 1NU1J 3U1CA 2NRGA 3HUSA 1KZUB 1KTMA 1QEXA 4PJ0E 2RKLA 1BSNA 2B88A 2W8ZA 1AJYA 1FDOA 3LW5J 5CCGA 1L0ND 3L74D 2NPSC 1K05A 3CWBG 5AVUB 1KQFB 5K5GB 1N73C 2OYHC 1KYOH 4IL6H 5AVZB 3OW2O 2WSFJ 5DJUB 3BCCG 1VQKP 4WY4D 1DX7A 2KNCA 1GW3A 2JEEA 1LJ2A 1LTBC 1NOHA 1NTMK 1ZN5A 3H1IJ 4R4LA 2V7QJ 2HODA 2FY8A 2E74C 3L73G 3TGUJ 3VYIA 2FXMA 3TGUE 1VQLP 5KJ7D 2A45I 1KILC 2YMYA 1HJBA 2GA1A 1FZFA 1P84I 3HUSB 5AVXB 3JCUE 3RK3B 1L0LE 1Y8AA 2XKMA 3SSUA 1BE3E 3EWKA 3HD7A 1OX3A 5KJ7A 3CCRP 1NTMG 2CK3H 3WUUA 2HG5D 2PAJA 1AVOA 3CXHI 2RH0A 3H1JD 3TSIA 3BCCE 3M9QA 1Q81Q 2QG4A 1JCCA 2WPQA 3N7NA 3HE4B 3Q3DA 3AE7C 3FWNA 1BCCD 2BCCG 2I1KA 2JJLA 4NPDA 1JY3P 2YXRB 4PJ0H 3U59A 3ZDMA 5B5EH 1LT9C 4K35A 5AW0B 2H7HA 3D70A 5AW6B 1SQQG 2WSSH 2KIKA 3KQGA 1PP9G 1JY2O 4LC1A 2QJPC 1FAVA 1T3JA 1IFJA 1QL1A 1LTIC 1OIPA 3P8CE 3L4FA 1JMMA 4RESB 1FBMA 1JOCA 1OVRA 4PD4E 1IFPA 3O6QA 3ABVC 1KILE 3B5NC 1VQ5P 3IR9A 2UWJE 1KYOI 1EDKA 1EDIA 3RK3D 1CSBA 1SQQK 2R44A 3HTKA 1EXIA 3KPEA 1FZCA 2QEXP 1SQPD 2Q3EA 5KLIB 1OW7A 2QIWA 1T3UA 4BXLA 1JY3N 3SWFA 3D71A 4OGQB 2Z5IA 2OYOA 1L0LJ 2IYPA 1E5WA 4L76A 1BGYJ 3P7KA 3H1JG 1GTWA 2XU6A 2WSEH 1BGYG 3CI9A 3L72J 3AE2C 1LWUB 2FYUG 5KLVD 3H1HG 5AVRB 1YJNP 2OTJP 1ZXGA 1PV3A 1AV1A 3H1HJ 4JQ0D 1FOSF 1S5LE 1EDJA 2IBZG 4H44C 1OWAA 1IK9A 2BEZF 3H1KG 1NTKD 4HKZH 1UIXA 1DD4A 2E76C 2N1TC 1IFMA 2FYUK 2P58A 2M3EA 3WU2E 5BU8B 3LIEA 3CCMP 3CWBJ 4I2LC 3CXHH 2PP6A 1NTZG 3TNUA 4KHXA 5KJ7C 2FYNB 2WWWA 4ZKPA 1NYHA 1EQ7A 3CCSP 3CCLP 1VQ9P 1PPJE 2A45H 3JC22 3O8ZA 1KQSO 3O6QB 3V2RA 3F89A 2AEMA 3H1KE 2ZXXA 3L74J 4O9BA 1N7SB 2O01H 1NWQA 4U3FG 2GM4A 1NKNA 1Y9BA 1GK6A 3PH0A 4QMAA 1NTZK 5AVWB 3L70E 3C1LA 3V5BA 2ZVOB 3VMXA 4DCKA 4ZNCA 2K37A 5CCHD 4H0LD 2POHA 5KAFH 3I56P 1LWUA 1Q7YQ 4I7ZB 2R3SA 2YIUC 1N73A 1XTCC 2OARA 3BATA 1Q86Q 1JO5A 2IYOA 1URQB 2W6AA 1VDFA 3H32B 3A0HH 3W67A 1IJDB 1GMJA 1VQ8P 1J2JB 5E79E 1HF9A 1QVGO 1RQVA 3WUVA 1M56D 2MKVA 4M3LA 4WY4C 2B87A 1LNQA 4U3FJ 5APVA 1HBWA 1CI6A 1SLQA 4UB6E 2FYNC 1JNMA 2H89C 4W7ZA 1KQGB 2WITA 3B5ND 4WB4A 1JY3O 4BWNA 3H1IG 1KC8Q 3L73J 1VF5C 3RK3C 3B5NA 5H2FH 1OZHA 1L0NE 1YIJP 2QJYB 4YPCA 1KMIZ 1LTGC 1ZV8A 3Q5RA 1M1KQ 2AEJA 3IN6A 2ZAEB 2YKPA 4IFDK 1OFCX 2GUVA 5APUA 5CJ4A 1BCCJ 1IFIA 3A2AA 3JCUH 1YITP 1N73B 3H1LE 1LTSC 2KLVA 3CX5D 4H0LB 2K9JA 3FWLA 1K8AQ 1GL2A 4AUWA 3H1JE 3A5TA 1SQVJ 5CBOA 3R2PA 1JB0J 1KB9E 3B5NB 5B66H 4UB6H 1KV4A 1X79B 3AEFC 4LGDE 2JR8A 4A7PA 3AE5C 3H1HD 1LT1A 4H13C 3U1AA 1VQPP 3MUDA 1HWTC 2FBWC 1RF0A 2KS1B 1J1DB 2DW3A 1JEKA 1SFCC 1SQQD 2WSEJ 1URQC 2YO2A 3H1KD 3GF7A 5CCHC 4RJTA 3SWKA 2WT7A 1NGMB 1NU1K 2RN0A 4YXDC 1IFNA 3HD7B 4EOTA 4CPGA 2FXOA 2AXTE 2ITAA 3B8EB 1UIIA 3FX0A 1L4AA 5AVSB 2HPCA 1YTZI 5GTHE 2ZT9D 1ZLLA 3E1RA 1U57A 1DEBA 3RK2C 1PPJG 3TYYA 3W68A 3CCUP 2H43A 3BVHA 3AE4C 1KQLA 1S9KD 3Q1MA 5AW1B 1HTLC 1WMKA 2JWDA 2R5DA 3HE4A 2XNXA 2B87B 3MZWB 4PD4I 3BRVB 3AE9C 3FXDA 3L75J 2D2CC 3M91A 1NTKJ 3NFQA 3P8MC 2FYUD 4R4MA 1QGKB 3L73D 2WMMA 2Q7CA 1VQ7P 1NAFA 1Z56A 1SFCB 1EZVI 1SQBK 2I1JA 3AE1C 1DD3A 3G3ZA 1Q90D 2FFDA 4C46A 1RE4C 2ZXEB 4YXWH 1A02J 3QH9A 4D6TJ 2HFED 4IL6X 1M1JC 1NTMD 2K9YA 2M0BA 5AW5B 2QJKB 4DZOA 3A3YB 1SQBJ 1LWUC 2FYUJ 2PRRA 3CXHE 3KDPB 1RF1C 3QWOC 1RY3A 2KS1A 2FXPA 2J59M 5APQA 1K04A 2A45G 1PPJD 3TGUG 1VQ4P 1U7MA 4DT0A 1S1CX 1YYCA 2M3BA 4Y28J 3RBZA 1S2EA 1OVVA 3P8CD 5CCGD 3RGUA 4OH8B 2ZVNB 1R8EA 1L4AD 2WSFH 1IZNB 3T97B 1WT6A 1L0NJ 1GDTA 2FFDC 5AW4B 1USEA 1FS0E 1BCCE 1LTJC 2JWAA 2WQYC 1LP1A 3LW5H 3CXHD 2IDBA 4IOIH 2R32A 2N1TA 3N4XA 5CJ0A 2BCCE 4GOFA 2ZYDA 4Z1MH 1GK4A 1HUCA 1FZGA 2BEQD 1NAYA 2E75C 4EIJA 2WSCH 1SQQE 1URQD 2W6JH 5KLVE 1MUUA 5KLVJ 4JF7A 3L71G 1IFDA 1SQVE 1SP4A 2QM8A 3Q5SA 3G9RA 3AE3C 4I7ZC 4L74A 1FZEA 5L8RJ 4DOJA 1N8RQ 2IZ0A 3MTUE 1BSHA 2H8PD 1GL2C 1SQPE 3OA7A 1PGQA 1SQPJ 3CMAP 2QA4P 2D2CD 1IC2A 1CZQA 1FZBA 3RK2D 4AYCA 3L75D 3IFMA 3KHUA 1FDIA 3MGNA 1X8YA 3OJAB 1X0TA 3FGAD 2YXQB 3RL0C 2OYIB 4MN4C 1BDCA 3V6IA 2P10A 4LLHA 3MD0A 3M9HA 3MIWA 1W2EA 1RE4A 4GOEA 1GU5A 2ZYGA 4NPFX 2YNYA 3IF4A 2ZYAA 1H8AA 1DH3A 4H13D 3SFDC 1SQXK 1J1DC 3B4SA 1FC2C 4XA4A 1S9KE 2N9BA 3AEDC 2QM7A 1NVOA 3TDKA 2E76D 2N1TD 3L37A 2E74B 1N7SA 1CI6B 3PP5A 1KN7A 1LP1B 3NMDA 2IX7C 1FJKA 4D6TG 1SQXJ 2Q6QA 2IPPA 2I8DA 2YKOA 2WPRA 2FFDB 3MHVA 3M9BA 5TISH 4I1LA 1XTGB 1ZMEC 4GIFA 1YHQP 2E42A 2OTKE 2HLOA 2Y0CA 3RL0g 1ZR2A 1OW8A 1MFTA 3KZIH 2OYHB 2O1JA 1L0LG 1M8OB 3HD7D 1L4AC 1PGJA 1PGOA 3L75G 5DJTB 5APYA 4IFMA 3S1KA 2AEFA 1G2CB 2BASA 3VTPC 1LGHB 4N78E 4JYBA 1S72P 1RF1B 5H2FE 1BE3D 2ZT9B 4C7RA 3CCVP 4Y99B 3CD6P 3NTNA 1FDMA 3L70G 1PL5A 1NJIQ 1L0LK 1VF5B 2HODB 2QJPB 1U7JA 3CX5E 3ITKA 3CC4P 5AVQB 3TGUD 1G1JA 3K5BA 5TJHA 2OYIC 1DIPA 2YIUB 3LIDA 3HE5A 2O1KA 3MP7B 1R5SA 3L75E 4L75A 2WTYA 3V2NA 2WT7B 1JCDA 3B71A 3IAOA 1N2DC 2BCCJ 3H6PA 5APSA 3RK2B 5B66E 3AECC 3P32A 4K3AA 1NKZB 1RHZB 4GKGA 2Y9ZA 2V7QH 4AQRD 1VPCA 1JY2N 2W6BA 3H1IE 5KKZC 3VOPA 4IL6E 4C7NA 1HGVA 3L71E 3L71J 4PV1C 3UIAA 1BGYE 1QX8A 4JPZB 1BE3G 5EFWB 1LTJB 2KI7B 3CCEP 1KYOD 1OMIA 3M0DA 3TF5A 1QLED 1ZW0A 2E74D 2E76B 2N1TB 1X22A 2IBZE 1T8ZA 2JO1A 2V4HA 1AA0A 3CX5H 3EFFK 3S4RA 1HVVA 2ZJSE 4WVZA 2Q1KA 2R3CA 1L4AB 3AEEC 3BCCJ 2L5GB 2E75B 3L72E 4TLFA 4N6JA 2M5AB 3VMZA 2K1AA 3R4YA 4ASWA 3MUDC 1MKMA 1KD1Q 2K88A 1FZAA 3JSVC 1Y47A 2O01N 2FKWB 2YMKA 1W5CE 1YQ4C 3AEAC 3HTKB 3PJSK 4C7NB 4Y99C 4ZKUA 3OAKA 4H0LC 1NU1E 1FU1A 2A06E 5AVYB 5KTBA 1W2BO 1A02F 1JTHA 1MFZA 1S4XA 2KSJA 4ASVA 2QJYC 4RO0A 1ZR4A 1RF1A 3H1KJ 4WBAA 4H44B 1MV8A 1J1EC 4JYCA 3V2PA 1T2KC 2HPCB 1EZVE 4TT3H 5CCHA 1GU4A 1SFCD 2XZRA 3Q2YA 1FZCC 1ZRTE 2KXPB 3GW6A 5APWA 3VMAA 1NH4A 1RH5B 2FYUE 2KZJA 2OGUA 3H1HE 1AFOA 4B86A 2J58A 3CMEP 1JM0A 2LXCB 4JBZA 3KYQA 2Y0DA 3CL3D 1CW5A 2AXCA 2YKQA 4PV1B 5AW8B 2H88C 1BE3J 2D2CB 2O01J 5GTIH 2XNDH 4EDFA 1G1IA 1S3JA 1RQUA 3L73E 3M06A 3I55P 1EZVG 1IK7A 4GODA 2KOGA 2FYZA 3EQ2A 1L2PA 4PD4D 3GG2A 3PRJA 2IFMA 2M5AA 2OYHA 5BVZA 1NTZJ 1NTZE 2WZ7A 3C8VA 4H44D 4I6MC 3V4WA 3PHLA 3WMM0 1WRGA 2LKMA 1G2CA 1GZLA 1L0NG 2SPZA 1VQOP 3L74E 5CHXA 3WU2H 3HUSC 3T97A 1LTTC 4D6TD 1KFMA 1EDLA 1PIXA 2PGDA 3L36A 5C39A 4PV1D 3H1LJ 1SQBD 5BU5A 2VRSA 1YJWP 1URQA 2C9LY 2Z4EA 2OQQA 1NO4A 1SFCA 1USDA 3KZIE 3G4SP 2CPBA 2PFXA 2WVRA 3PTZA 3TK1A 1L0NK 5AW3B 3CCJP 2OTLP 1L0LD 1SVFA 2KB7P 4ZMDA 3L70J
chains in the Genus database with same CATH topology
3AEBC 1VF5C 2WSCJ 1KMIZ 3SFEC 2NZ2A 3Q5RA 4U7JA 3IN6A 1KTMA 1ZMEC 3RL0g 1OW8A 2QSIA 1FDOA 3LW5J 1S5LX 2QJKC 4H0LB 1KQFB 1K05A 3Q5PA 2WSFJ 2ZT9B 1JB0J 3AE6C 4OGQC 2WPVB 3AEFC 2E75D 4R4LA 2V7QJ 1PL5A 2E74C 3AE5C 1VF5B 4H13C 4KT0J 4YTPC 2FBWC 1ZOYC 2WSEJ 3GF7A 1DIPA 4RKUJ 3EWKA 1NGMB 4YXDC 3B71A 3GLMA 3IAOA 3Q3DA 1TU3F 3AE7C 2ZT9D 3AECC 1U57A 1KORA 2J5UA 3D70A 3AE4C 3Q1MA 1WMKA 5KKZC 2QJPC 4PV1C 4H13B 3AE9C 4R4MA 2D2CC 3O6QA 3H25A 3ABVC 1KILE 1OMIA 1VL2A 2E74D 2E76B 5M1BA 2JO1A 3AE1C 1EXIA 2JP3A 1AJYA 1DD3A 2G3AA 1Q90D 3AEEC 2E75B 1OW7A 2QIWA 1EXJA 3R4YA 3D71A 3D6YA 1MKMA 4IL6X 4OGQB 2K9YA 2YMKA 3AEAC 1YQ4C 1ZP0C 2FXPA 3AE2C 1K04A 4H0LC 1PV3A 2G8YA 4H44C 1S1CX 3GF3A 4OGQD 2BEZF 4Y28J 2QJYC 3GMAA 4H44B 1UIXA 1R8EA 1DD4A 1VF5D 2E76C 5KLIC 4TT3H 3T97B 3Q2YA 2WQYC 4GDOA 3RK3E 1ZRTE 2IDBA 1NYHA 4Z1MH 2BEQD 2E75C 4PV1B 2H88C 2D2CB 2O01J 1Y9BA 1RQUA 3AEGC 3Q5SA 3G9RA 3AE3C 1IK7A 4I7ZC 4H0LD 5L8RJ 1OW6A 4I7ZB 2YIUC 3S9OA 4H44D 3C8VA 2D2CD 1YQ3C 1GMJA 1FDIA 1HF9A 3FGAD 1RQVA 1HJ0A 1PIXA 2MKVA 2P10A 4PV1D 2FYNC 2H89C 2OQQA 4XFJA 4H13D 3SFDC 1KQGB 3D6ZA 3AEDC 2ZT9C 2E76D 3AE8C 2E74B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JP3 A;  1Y9B A;  2MKV A;  2JO1 A; 
#chains in the Genus database with same CATH topology
 4WY4 A;  2Q9I A;  1J1E B;  1Q2N A;  2W83 C;  5GTI E;  2W27 A;  3BAS A;  3L71 D;  4UB8 H;  3SFE C;  2NPS A;  2NZ2 A;  5CCG C;  4N78 D;  1PZQ A;  1H88 A;  2KSE A;  1M57 D;  2WPS A;  3L72 G;  5GTH H;  1BCC G;  3H1L D;  1JMB A;  3NXS A;  4OVN F;  2QSI A;  1FOS E;  3A7O A;  3EFG A;  3A0H E;  1S5L X;  2QJK C;  3Q5P A;  1QL2 A;  4N3Y B;  1PP9 D;  4HYT B;  1RF0 C;  2B9B A;  1VQM P;  1AQ5 A;  1GW4 A;  1SQP K;  2KP8 A;  1X9V A;  3AE6 C;  2RMZ A;  2ZFC A;  3PLN A;  2C0W A;  4OGQ C;  2WPV B;  1NU1 G;  1T2K D;  1FJP A;  1JTH B;  2E75 D;  4XE5 B;  5B5E E;  4KT0 J;  2K9J B;  3L35 A;  1K73 Q;  3F5H A;  4YTP C;  1ZOY C;  1SQP G;  2M8R A;  4W7Y A;  1HH0 A;  1P84 E;  3CWB D;  4RKU J;  1LT9 A;  1N7L A;  1SQQ J;  1YTZ T;  2KZI A;  2MJZ A;  3II6 A;  3VMY A;  3VP8 A;  3HE5 B;  1YJ9 P;  4NPE A;  2JDI H;  2P1J A;  3GHG B;  3GLM A;  5AW2 B;  1YBK A;  1SQV D;  1TU3 F;  4W80 A;  4WY4 B;  5KAI H;  2KUB A;  3A0B H;  1SS1 A;  1KOR A;  1T6A A;  2QE7 H;  1MZ9 A;  2J5U A;  4HJG H;  3RL0 B;  3VN0 A;  1NTM J;  2W90 A;  2XV5 A;  4U3F E;  5AW7 B;  1RE3 C;  3G71 P;  4L73 A;  1BDD A;  4H13 B;  1KB9 H;  4EYY Q;  1SQB E;  1ZRT D;  3CPW O;  1HGZ A;  2IZ1 A;  1N7S C;  1SQX D;  3H25 A;  1K9M Q;  4D6T E;  1NU1 D;  1VL2 A;  2Q3I A;  2Y9Y A;  1AQT A;  3L70 D;  5CBN A;  1VQN P;  5M1B A;  1M1J A;  3HD7 C;  3HRN A;  1LTA C;  3CCQ P;  3TNU B;  2JP3 A;  2P2U A;  2G3A A;  1VQ6 P;  4IFF A;  3L74 G;  1OVU A;  1P84 H;  1EXJ A;  1KIL B;  3D6Y A;  2HR3 A;  3CX5 I;  2NPS B;  2Y0E A;  1H89 A;  5AW9 B;  2E5Y A;  3KXD A;  4U3F D;  2AXT H;  2C0X A;  1JUN A;  1FZC B;  3USS A;  1M7L A;  1SQB G;  1ZP0 C;  5AVV B;  3RL0 D;  4PD4 H;  3VP9 A;  3CC7 P;  4KJM A;  5KAI E;  2KYV A;  3A0B E;  4GT1 A;  1RE3 A;  2QRX A;  3V2Q A;  4EI2 A;  1GL2 D;  2G8Y A;  3GF3 A;  4OGQ D;  1NTK E;  1Q82 Q;  1DEE G;  2KLU A;  3CC2 P;  1EC5 A;  3GMA A;  2CPS A;  1YI2 P;  3H1J J;  1VF5 D;  2K3R A;  5KLI C;  2O3J A;  3E7K A;  1P84 D;  2OYI A;  1EZV D;  1KIL A;  1NTM E;  3C9I A;  4GDO A;  5KAF E;  3RK3 E;  1QVF O;  2NPS D;  2P67 A;  3H32 A;  2BCC D;  3I5C A;  4HH2 A;  2B89 A;  2E5T A;  1KIL D;  3H1L G;  3GHG A;  1M1J B;  5KKZ B;  3WUT A;  3H1I D;  5E79 H;  4BRY B;  2A06 D;  1NHL A;  3M0D C;  1S5L H;  1LTJ A;  1LT9 B;  2KK7 A;  2QVA A;  1NTK G;  2IBZ I;  4DJG A;  5CMZ A;  5AVT B;  1PP9 J;  2YO3 A;  1PP9 E;  1M90 Q;  1PFI A;  2P7J A;  2L91 A;  3AEG C;  2IFN A;  1H0T B;  1GL2 B;  1IO4 A;  1OW6 A;  2HYN A;  2LXB A;  5TIS E;  5KLV K;  2KNC B;  1FE6 A;  1AVY A;  3S9O A;  1SQV K;  4HB1 A;  1NTK K;  1N7S D;  4OWF A;  1YQ3 C;  2N9Y B;  2Q5U A;  4UB8 E;  1R5L A;  2Z5H A;  3BCC D;  1KYO E;  3GHG C;  3SWY A;  1SQX E;  1HJ0 A;  5APT A;  5APX A;  2C9N Y;  1BGY D;  5KLV G;  2E43 A;  4WWI A;  1KB9 D;  1SQV G;  3L72 D;  4XFJ A;  3D6Z A;  1KB9 I;  3E1I A;  2IBZ D;  1N86 A;  3CWB E;  2GUS A;  2ZT9 C;  2A06 G;  3AE8 C;  1PGP A;  3M0A A;  1GD2 E;  2XDJ A;  1JY2 P;  1OXZ A;  2R5B A;  3AEB C;  3V4Q A;  1D7M A;  2WSC J;  3G6E P;  1H0T A;  3RBX A;  3FXE A;  3CLQ A;  1KFN A;  1SQX G;  2LR2 A;  2JKV A;  1E79 H;  3BRT B;  4U7J A;  1NTZ D;  4BRY A;  1NU1 J;  3U1C A;  2NRG A;  3HUS A;  1KZU B;  1KTM A;  1QEX A;  4PJ0 E;  2RKL A;  1BSN A;  2B88 A;  2W8Z A;  1AJY A;  1FDO A;  3LW5 J;  5CCG A;  1L0N D;  3L74 D;  2NPS C;  1K05 A;  3CWB G;  5AVU B;  1KQF B;  5K5G B;  1N73 C;  2OYH C;  1KYO H;  4IL6 H;  5AVZ B;  3OW2 O;  2WSF J;  5DJU B;  3BCC G;  1VQK P;  4WY4 D;  1DX7 A;  2KNC A;  1GW3 A;  2JEE A;  1LJ2 A;  1LTB C;  1NOH A;  1NTM K;  1ZN5 A;  3H1I J;  4R4L A;  2V7Q J;  2HOD A;  2FY8 A;  2E74 C;  3L73 G;  3TGU J;  3VYI A;  2FXM A;  3TGU E;  1VQL P;  5KJ7 D;  2A45 I;  1KIL C;  2YMY A;  1HJB A;  2GA1 A;  1FZF A;  1P84 I;  3HUS B;  5AVX B;  3JCU E;  3RK3 B;  1L0L E;  1Y8A A;  2XKM A;  3SSU A;  1BE3 E;  3EWK A;  3HD7 A;  1OX3 A;  5KJ7 A;  3CCR P;  1NTM G;  2CK3 H;  3WUU A;  2HG5 D;  2PAJ A;  1AVO A;  3CXH I;  2RH0 A;  3H1J D;  3TSI A;  3BCC E;  3M9Q A;  1Q81 Q;  2QG4 A;  1JCC A;  2WPQ A;  3N7N A;  3HE4 B;  3Q3D A;  3AE7 C;  3FWN A;  1BCC D;  2BCC G;  2I1K A;  2JJL A;  4NPD A;  1JY3 P;  2YXR B;  4PJ0 H;  3U59 A;  3ZDM A;  5B5E H;  1LT9 C;  4K35 A;  5AW0 B;  2H7H A;  3D70 A;  5AW6 B;  1SQQ G;  2WSS H;  2KIK A;  3KQG A;  1PP9 G;  1JY2 O;  4LC1 A;  2QJP C;  1FAV A;  1T3J A;  1IFJ A;  1QL1 A;  1LTI C;  1OIP A;  3P8C E;  3L4F A;  1JMM A;  4RES B;  1FBM A;  1JOC A;  1OVR A;  4PD4 E;  1IFP A;  3O6Q A;  3ABV C;  1KIL E;  3B5N C;  1VQ5 P;  3IR9 A;  2UWJ E;  1KYO I;  1EDK A;  1EDI A;  3RK3 D;  1CSB A;  1SQQ K;  2R44 A;  3HTK A;  1EXI A;  3KPE A;  1FZC A;  2QEX P;  1SQP D;  2Q3E A;  5KLI B;  1OW7 A;  2QIW A;  1T3U A;  4BXL A;  1JY3 N;  3SWF A;  3D71 A;  4OGQ B;  2Z5I A;  2OYO A;  1L0L J;  2IYP A;  1E5W A;  4L76 A;  1BGY J;  3P7K A;  3H1J G;  1GTW A;  2XU6 A;  2WSE H;  1BGY G;  3CI9 A;  3L72 J;  3AE2 C;  1LWU B;  2FYU G;  5KLV D;  3H1H G;  5AVR B;  1YJN P;  2OTJ P;  1ZXG A;  1PV3 A;  1AV1 A;  3H1H J;  4JQ0 D;  1FOS F;  1S5L E;  1EDJ A;  2IBZ G;  4H44 C;  1OWA A;  1IK9 A;  2BEZ F;  3H1K G;  1NTK D;  4HKZ H;  1UIX A;  1DD4 A;  2E76 C;  2N1T C;  1IFM A;  2FYU K;  2P58 A;  2M3E A;  3WU2 E;  5BU8 B;  3LIE A;  3CCM P;  3CWB J;  4I2L C;  3CXH H;  2PP6 A;  1NTZ G;  3TNU A;  4KHX A;  5KJ7 C;  2FYN B;  2WWW A;  4ZKP A;  1NYH A;  1EQ7 A;  3CCS P;  3CCL P;  1VQ9 P;  1PPJ E;  2A45 H;  3JC2 2;  3O8Z A;  1KQS O;  3O6Q B;  3V2R A;  3F89 A;  2AEM A;  3H1K E;  2ZXX A;  3L74 J;  4O9B A;  1N7S B;  2O01 H;  1NWQ A;  4U3F G;  2GM4 A;  1NKN A;  1Y9B A;  1GK6 A;  3PH0 A;  4QMA A;  1NTZ K;  5AVW B;  3L70 E;  3C1L A;  3V5B A;  2ZVO B;  3VMX A;  4DCK A;  4ZNC A;  2K37 A;  5CCH D;  4H0L D;  2POH A;  5KAF H;  3I56 P;  1LWU A;  1Q7Y Q;  4I7Z B;  2R3S A;  2YIU C;  1N73 A;  1XTC C;  2OAR A;  3BAT A;  1Q86 Q;  1JO5 A;  2IYO A;  1URQ B;  2W6A A;  1VDF A;  3H32 B;  3A0H H;  3W67 A;  1IJD B;  1GMJ A;  1VQ8 P;  1J2J B;  5E79 E;  1HF9 A;  1QVG O;  1RQV A;  3WUV A;  1M56 D;  2MKV A;  4M3L A;  4WY4 C;  2B87 A;  1LNQ A;  4U3F J;  5APV A;  1HBW A;  1CI6 A;  1SLQ A;  4UB6 E;  2FYN C;  1JNM A;  2H89 C;  4W7Z A;  1KQG B;  2WIT A;  3B5N D;  4WB4 A;  1JY3 O;  4BWN A;  3H1I G;  1KC8 Q;  3L73 J;  1VF5 C;  3RK3 C;  3B5N A;  5H2F H;  1OZH A;  1L0N E;  1YIJ P;  2QJY B;  4YPC A;  1KMI Z;  1LTG C;  1ZV8 A;  3Q5R A;  1M1K Q;  2AEJ A;  3IN6 A;  2ZAE B;  2YKP A;  4IFD K;  1OFC X;  2GUV A;  5APU A;  5CJ4 A;  1BCC J;  1IFI A;  3A2A A;  3JCU H;  1YIT P;  1N73 B;  3H1L E;  1LTS C;  2KLV A;  3CX5 D;  4H0L B;  2K9J A;  3FWL A;  1K8A Q;  1GL2 A;  4AUW A;  3H1J E;  3A5T A;  1SQV J;  5CBO A;  3R2P A;  1JB0 J;  1KB9 E;  3B5N B;  5B66 H;  4UB6 H;  1KV4 A;  1X79 B;  3AEF C;  4LGD E;  2JR8 A;  4A7P A;  3AE5 C;  3H1H D;  1LT1 A;  4H13 C;  3U1A A;  1VQP P;  3MUD A;  1HWT C;  2FBW C;  1RF0 A;  2KS1 B;  1J1D B;  2DW3 A;  1JEK A;  1SFC C;  1SQQ D;  2WSE J;  1URQ C;  2YO2 A;  3H1K D;  3GF7 A;  5CCH C;  4RJT A;  3SWK A;  2WT7 A;  1NGM B;  1NU1 K;  2RN0 A;  4YXD C;  1IFN A;  3HD7 B;  4EOT A;  4CPG A;  2FXO A;  2AXT E;  2ITA A;  3B8E B;  1UII A;  3FX0 A;  1L4A A;  5AVS B;  2HPC A;  1YTZ I;  5GTH E;  2ZT9 D;  1ZLL A;  3E1R A;  1U57 A;  1DEB A;  3RK2 C;  1PPJ G;  3TYY A;  3W68 A;  3CCU P;  2H43 A;  3BVH A;  3AE4 C;  1KQL A;  1S9K D;  3Q1M A;  5AW1 B;  1HTL C;  1WMK A;  2JWD A;  2R5D A;  3HE4 A;  2XNX A;  2B87 B;  3MZW B;  4PD4 I;  3BRV B;  3AE9 C;  3FXD A;  3L75 J;  2D2C C;  3M91 A;  1NTK J;  3NFQ A;  3P8M C;  2FYU D;  4R4M A;  1QGK B;  3L73 D;  2WMM A;  2Q7C A;  1VQ7 P;  1NAF A;  1Z56 A;  1SFC B;  1EZV I;  1SQB K;  2I1J A;  3AE1 C;  1DD3 A;  3G3Z A;  1Q90 D;  2FFD A;  4C46 A;  1RE4 C;  2ZXE B;  4YXW H;  1A02 J;  3QH9 A;  4D6T J;  2HFE D;  4IL6 X;  1M1J C;  1NTM D;  2K9Y A;  2M0B A;  5AW5 B;  2QJK B;  4DZO A;  3A3Y B;  1SQB J;  1LWU C;  2FYU J;  2PRR A;  3CXH E;  3KDP B;  1RF1 C;  3QWO C;  1RY3 A;  2KS1 A;  2FXP A;  2J59 M;  5APQ A;  1K04 A;  2A45 G;  1PPJ D;  3TGU G;  1VQ4 P;  1U7M A;  4DT0 A;  1S1C X;  1YYC A;  2M3B A;  4Y28 J;  3RBZ A;  1S2E A;  1OVV A;  3P8C D;  5CCG D;  3RGU A;  4OH8 B;  2ZVN B;  1R8E A;  1L4A D;  2WSF H;  1IZN B;  3T97 B;  1WT6 A;  1L0N J;  1GDT A;  2FFD C;  5AW4 B;  1USE A;  1FS0 E;  1BCC E;  1LTJ C;  2JWA A;  2WQY C;  1LP1 A;  3LW5 H;  3CXH D;  2IDB A;  4IOI H;  2R32 A;  2N1T A;  3N4X A;  5CJ0 A;  2BCC E;  4GOF A;  2ZYD A;  4Z1M H;  1GK4 A;  1HUC A;  1FZG A;  2BEQ D;  1NAY A;  2E75 C;  4EIJ A;  2WSC H;  1SQQ E;  1URQ D;  2W6J H;  5KLV E;  1MUU A;  5KLV J;  4JF7 A;  3L71 G;  1IFD A;  1SQV E;  1SP4 A;  2QM8 A;  3Q5S A;  3G9R A;  3AE3 C;  4I7Z C;  4L74 A;  1FZE A;  5L8R J;  4DOJ A;  1N8R Q;  2IZ0 A;  3MTU E;  1BSH A;  2H8P D;  1GL2 C;  1SQP E;  3OA7 A;  1PGQ A;  1SQP J;  3CMA P;  2QA4 P;  2D2C D;  1IC2 A;  1CZQ A;  1FZB A;  3RK2 D;  4AYC A;  3L75 D;  3IFM A;  3KHU A;  1FDI A;  3MGN A;  1X8Y A;  3OJA B;  1X0T A;  3FGA D;  2YXQ B;  3RL0 C;  2OYI B;  4MN4 C;  1BDC A;  3V6I A;  2P10 A;  4LLH A;  3MD0 A;  3M9H A;  3MIW A;  1W2E A;  1RE4 A;  4GOE A;  1GU5 A;  2ZYG A;  4NPF X;  2YNY A;  3IF4 A;  2ZYA A;  1H8A A;  1DH3 A;  4H13 D;  3SFD C;  1SQX K;  1J1D C;  3B4S A;  1FC2 C;  4XA4 A;  1S9K E;  2N9B A;  3AED C;  2QM7 A;  1NVO A;  3TDK A;  2E76 D;  2N1T D;  3L37 A;  2E74 B;  1N7S A;  1CI6 B;  3PP5 A;  1KN7 A;  1LP1 B;  3NMD A;  2IX7 C;  1FJK A;  4D6T G;  1SQX J;  2Q6Q A;  2IPP A;  2I8D A;  2YKO A;  2WPR A;  2FFD B;  3MHV A;  3M9B A;  5TIS H;  4I1L A;  1XTG B;  1ZME C;  4GIF A;  1YHQ P;  2E42 A;  2OTK E;  2HLO A;  2Y0C A;  3RL0 g;  1ZR2 A;  1OW8 A;  1MFT A;  3KZI H;  2OYH B;  2O1J A;  1L0L G;  1M8O B;  3HD7 D;  1L4A C;  1PGJ A;  1PGO A;  3L75 G;  5DJT B;  5APY A;  4IFM A;  3S1K A;  2AEF A;  1G2C B;  2BAS A;  3VTP C;  1LGH B;  4N78 E;  4JYB A;  1S72 P;  1RF1 B;  5H2F E;  1BE3 D;  2ZT9 B;  4C7R A;  3CCV P;  4Y99 B;  3CD6 P;  3NTN A;  1FDM A;  3L70 G;  1PL5 A;  1NJI Q;  1L0L K;  1VF5 B;  2HOD B;  2QJP B;  1U7J A;  3CX5 E;  3ITK A;  3CC4 P;  5AVQ B;  3TGU D;  1G1J A;  3K5B A;  5TJH A;  2OYI C;  1DIP A;  2YIU B;  3LID A;  3HE5 A;  2O1K A;  3MP7 B;  1R5S A;  3L75 E;  4L75 A;  2WTY A;  3V2N A;  2WT7 B;  1JCD A;  3B71 A;  3IAO A;  1N2D C;  2BCC J;  3H6P A;  5APS A;  3RK2 B;  5B66 E;  3AEC C;  3P32 A;  4K3A A;  1NKZ B;  1RHZ B;  4GKG A;  2Y9Z A;  2V7Q H;  4AQR D;  1VPC A;  1JY2 N;  2W6B A;  3H1I E;  5KKZ C;  3VOP A;  4IL6 E;  4C7N A;  1HGV A;  3L71 E;  3L71 J;  4PV1 C;  3UIA A;  1BGY E;  1QX8 A;  4JPZ B;  1BE3 G;  5EFW B;  1LTJ B;  2KI7 B;  3CCE P;  1KYO D;  1OMI A;  3M0D A;  3TF5 A;  1QLE D;  1ZW0 A;  2E74 D;  2E76 B;  2N1T B;  1X22 A;  2IBZ E;  1T8Z A;  2JO1 A;  2V4H A;  1AA0 A;  3CX5 H;  3EFF K;  3S4R A;  1HVV A;  2ZJS E;  4WVZ A;  2Q1K A;  2R3C A;  1L4A B;  3AEE C;  3BCC J;  2L5G B;  2E75 B;  3L72 E;  4TLF A;  4N6J A;  2M5A B;  3VMZ A;  2K1A A;  3R4Y A;  4ASW A;  3MUD C;  1MKM A;  1KD1 Q;  2K88 A;  1FZA A;  3JSV C;  1Y47 A;  2O01 N;  2FKW B;  2YMK A;  1W5C E;  1YQ4 C;  3AEA C;  3HTK B;  3PJS K;  4C7N B;  4Y99 C;  4ZKU A;  3OAK A;  4H0L C;  1NU1 E;  1FU1 A;  2A06 E;  5AVY B;  5KTB A;  1W2B O;  1A02 F;  1JTH A;  1MFZ A;  1S4X A;  2KSJ A;  4ASV A;  2QJY C;  4RO0 A;  1ZR4 A;  1RF1 A;  3H1K J;  4WBA A;  4H44 B;  1MV8 A;  1J1E C;  4JYC A;  3V2P A;  1T2K C;  2HPC B;  1EZV E;  4TT3 H;  5CCH A;  1GU4 A;  1SFC D;  2XZR A;  3Q2Y A;  1FZC C;  1ZRT E;  2KXP B;  3GW6 A;  5APW A;  3VMA A;  1NH4 A;  1RH5 B;  2FYU E;  2KZJ A;  2OGU A;  3H1H E;  1AFO A;  4B86 A;  2J58 A;  3CME P;  1JM0 A;  2LXC B;  4JBZ A;  3KYQ A;  2Y0D A;  3CL3 D;  1CW5 A;  2AXC A;  2YKQ A;  4PV1 B;  5AW8 B;  2H88 C;  1BE3 J;  2D2C B;  2O01 J;  5GTI H;  2XND H;  4EDF A;  1G1I A;  1S3J A;  1RQU A;  3L73 E;  3M06 A;  3I55 P;  1EZV G;  1IK7 A;  4GOD A;  2KOG A;  2FYZ A;  3EQ2 A;  1L2P A;  4PD4 D;  3GG2 A;  3PRJ A;  2IFM A;  2M5A A;  2OYH A;  5BVZ A;  1NTZ J;  1NTZ E;  2WZ7 A;  3C8V A;  4H44 D;  4I6M C;  3V4W A;  3PHL A;  3WMM 0;  1WRG A;  2LKM A;  1G2C A;  1GZL A;  1L0N G;  2SPZ A;  1VQO P;  3L74 E;  5CHX A;  3WU2 H;  3HUS C;  3T97 A;  1LTT C;  4D6T D;  1KFM A;  1EDL A;  1PIX A;  2PGD A;  3L36 A;  5C39 A;  4PV1 D;  3H1L J;  1SQB D;  5BU5 A;  2VRS A;  1YJW P;  1URQ A;  2C9L Y;  2Z4E A;  2OQQ A;  1NO4 A;  1SFC A;  1USD A;  3KZI E;  3G4S P;  2CPB A;  2PFX A;  2WVR A;  3PTZ A;  3TK1 A;  1L0N K;  5AW3 B;  3CCJ P;  2OTL P;  1L0L D;  1SVF A;  2KB7 P;  4ZMD A;  3L70 J; 
#chains in the Genus database with same CATH homology
 3AEB C;  1VF5 C;  2WSC J;  1KMI Z;  3SFE C;  2NZ2 A;  3Q5R A;  4U7J A;  3IN6 A;  1KTM A;  1ZME C;  3RL0 g;  1OW8 A;  2QSI A;  1FDO A;  3LW5 J;  1S5L X;  2QJK C;  4H0L B;  1KQF B;  1K05 A;  3Q5P A;  2WSF J;  2ZT9 B;  1JB0 J;  3AE6 C;  4OGQ C;  2WPV B;  3AEF C;  2E75 D;  4R4L A;  2V7Q J;  1PL5 A;  2E74 C;  3AE5 C;  1VF5 B;  4H13 C;  4KT0 J;  4YTP C;  2FBW C;  1ZOY C;  2WSE J;  3GF7 A;  1DIP A;  4RKU J;  3EWK A;  1NGM B;  4YXD C;  3B71 A;  3GLM A;  3IAO A;  3Q3D A;  1TU3 F;  3AE7 C;  2ZT9 D;  3AEC C;  1U57 A;  1KOR A;  2J5U A;  3D70 A;  3AE4 C;  3Q1M A;  1WMK A;  5KKZ C;  2QJP C;  4PV1 C;  4H13 B;  3AE9 C;  4R4M A;  2D2C C;  3O6Q A;  3H25 A;  3ABV C;  1KIL E;  1OMI A;  1VL2 A;  2E74 D;  2E76 B;  5M1B A;  2JO1 A;  3AE1 C;  1EXI A;  2JP3 A;  1AJY A;  1DD3 A;  2G3A A;  1Q90 D;  3AEE C;  2E75 B;  1OW7 A;  2QIW A;  1EXJ A;  3R4Y A;  3D71 A;  3D6Y A;  1MKM A;  4IL6 X;  4OGQ B;  2K9Y A;  2YMK A;  3AEA C;  1YQ4 C;  1ZP0 C;  2FXP A;  3AE2 C;  1K04 A;  4H0L C;  1PV3 A;  2G8Y A;  4H44 C;  1S1C X;  3GF3 A;  4OGQ D;  2BEZ F;  4Y28 J;  2QJY C;  3GMA A;  4H44 B;  1UIX A;  1R8E A;  1DD4 A;  1VF5 D;  2E76 C;  5KLI C;  4TT3 H;  3T97 B;  3Q2Y A;  2WQY C;  4GDO A;  3RK3 E;  1ZRT E;  2IDB A;  1NYH A;  4Z1M H;  2BEQ D;  2E75 C;  4PV1 B;  2H88 C;  2D2C B;  2O01 J;  1Y9B A;  1RQU A;  3AEG C;  3Q5S A;  3G9R A;  3AE3 C;  1IK7 A;  4I7Z C;  4H0L D;  5L8R J;  1OW6 A;  4I7Z B;  2YIU C;  3S9O A;  4H44 D;  3C8V A;  2D2C D;  1YQ3 C;  1GMJ A;  1FDI A;  1HF9 A;  3FGA D;  1RQV A;  1HJ0 A;  1PIX A;  2MKV A;  2P10 A;  4PV1 D;  2FYN C;  2H89 C;  2OQQ A;  4XFJ A;  4H13 D;  3SFD C;  1KQG B;  3D6Z A;  3AED C;  2ZT9 C;  2E76 D;  3AE8 C;  2E74 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...