1Y9LA

The x-ray structure of an secretion system protein
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
110
structure length
110
Chain Sequence
b'EKEWHIVPVSKDYFSIPNDLLWSFNTTNKSINVYSKCISGKAVYSFNAGKFMGNFNVKEVDGCFMDAQKIAIDKLFSMLKDGVVLKGNKINDTILIEKDGEVKLKLIRGI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipoprotein mxiM
publication title Structure and biochemical analysis of a secretin pilot protein.
pubmed doi rcsb
source organism Shigella flexneri
molecule tags Lipid binding protein
total genus 24
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2004-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11441 MxiM Pilot protein MxiM
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.230 Mainly Beta Beta Barrel Lipocalin Lipocalin 1y9lA00
1Y9LA 1Y9TA 2JW1A
chains in the Genus database with same CATH superfamily
3VG2A 3P02A 1YWBA 3QQ2A 1MX8A 1VWDB 4IB9A 1SXUA 3WJFA 4KT5A 2OL6O 2AL0X 1SWSA 4O3YA 1MM9A 2IZFB 1NC9A 4BX7A 4YFPA 2YMSA 5HCDC 4CDEA 4ORUA 1NQNA 3ZUOA 1OEKA 3FMZA 4NYRA 5LJEA 1KT7A 2RTLA 4CDDA 4OKAA 1DF3A 3B2IA 1K24A 1PTSA 2A2UA 3LTWA 3CQNA 3CMPA 3FYFA 5IRUA 1CBQA 4IB6A 2F73A 1MVGA 2OZQA 2O62A 2CAMA 3VG6A 4O4UA 3EBKA 1SXXA 3WJCA 3WZQA 1E06A 1S2PA 3OE3A 3FLLA 3VU1A 1MUPA 4PJ2A 1AVGI 1IIUA 3LV4A 4WFUA 5EDCA 4XMEA 4YGHA 2QM9A 1LIBA 1QFTA 3HWGA 1LIFA 2A2GA 1B8EA 3CQRA 4GNYA 3RBYA 1HN2A 1ZNHA 4ID2A 4CPFA 3SZIA 2W2AA 1TXLA 3D97A 3UEVA 4ZHHA 3PQSA 1EUOA 1H91A 1UREA 2CBRA 2CZUA 2UYWA 3APWA 3EW1A 2BT9A 5F58A 5HWZA 5LKFA 1A3YA 1KOIA 2WSJA 4GZVA 1LUQA 2R73A 4LZUA 4QZUA 1LIEA 4AZRA 4IB8A 3VGWA 5D4AA 1VYFA 1RXJA 4FBVA 4BX6A 3F6ZB 1EALA 3F9DA 2AT6X 4NP1A 4UU3A 5K67A 4CDCA 4ZR2A 4BJ8A 1I05A 1A57A 1KXOA 5F1EA 3EYCA 4ML7B 1FDQA 3WJBA 1UZ2X 1VWPB 2HLVA 4YDBA 5EPQA 2CBSA 3U0DA 1JMXA 1NGLA 3T1DA 4CPHA 1FENA 3FIDA 1LKEA 4QGVA 2XSTA 3RDMA 4ORSA 5F7GA 4MVLA 4BVMA 4GUZA 3T2WA 2Q39A 3KFHA 1DFVA 1RBPA 4KC7A 4DCBA 3I0AA 4OMXA 3NPOA 1KL5A 3CBSA 1ADLA 3AUMO 4GGZA 2G79A 1CBSA 1AQBA 1SRHA 3L4RA 3SZHA 3O2YA 3KVNA 3NR3A 2OY8A 4OMWA 2ANSA 1O1UA 2JGSA 1DF8A 1TOWA 3NBXX 4WBKA 3ZW0A 4XMFA 2VFBA 3FR4A 4NNSA 1SY0A 3DSZA 2AT0X 2HYSA 1RSTB 1YWAA 4GKCA 1FE3A 5B3MO 2DJGA 1LFOA 1SMPI 2JMBA 2G5LA 2X8TA 4NLJA 3AKMA 3RWXA 5H9NA 2L5PA 2OY5O 1Y9LA 2ZAGA 1W5RA 3APXA 4N7CA 2KW1A 1SLEB 2EU7X 3RKGA 3FENA 5B5GA 3TF6A 2AVIA 5CYBA 1ACDA 3NQ9A 3HWDA 1BSQA 5FAZA 4OEMA 4Z2VA 2L67A 2Z4IA 3G7XA 4PSQA 1SWOA 4LQZA 3RSWA 3OD9A 2QO6A 2X45A 2JU8A 5AJBA 1T8VA 4ON1A 4BX5B 4BX7B 2FLJA 2QMIA 1BWYA 1KZXA 5AQ6A 1STSB 4ZJ0A 3FIQA 4QZTA 3RY2A 1TOUA 4L3RA 3APUA 4JNJA 1AELA 5L8NA 1SWFA 4I6SA 5AJCA 2OYBO 3SLOA 1SY3A 3HK1A 3WYQA 3ZW2A 1DZJA 5IRAA 1VWQB 3FR2A 3MM0A 2OF8A 3FA9A 1ZNDA 1R0UA 1O8VA 1X71A 2OVAA 2Q4NA 5KIDA 2IZDB 1KT4A 1PMPA 1VWKB 2RTNB 1DZKA 1X89A 1HMSA 3PP6A 5EZ2A 4GE1A 1A2DA 1SWKA 3VE2A 3MG5A 1HY2A 2LKKA 1KL4A 3CBCA 3E3CA 1SWDA 2RTPB 4O3XB 5HTEA 5F2BA 1GT5A 1PBOA 1CBRA 1ICNA 3SOTA 3WVMA 4OS8A 5B27A 3N91A 4IRWA 4A1HA 2BS6A 4YDAA 2OFAA 1X8QA 4TLJA 1E5PA 3ZQ3A 1KT5A 4YKOA 4GDZA 4L1NA 1NBXA 2RTOB 1DV9A 3CKFA 1LELA 2IZHB 3CWKA 3RDSA 4RUUA 1BBPA 1UYOX 3FEPA 1EPBA 1LCZA 4U8UN 3BU9A 2XKLA 3KFIA 4IAXA 5HBSA 2MF6A 3Q6LA 3FW5A 1GX9A 4BX6B 4FBRA 1I4UA 5LJKA 3WZOA 4FGIB 5FQ6E 4A8ZA 5F6BA 4Y0SA 2GTLN 1N9YA 2M4LA 2A3FX 3HTYA 1DC9A 3NP1A 1RAVA 3MBTA 3NX1A 4N7DA 4XMCA 4U8UO 1N4JA 1Y53X 2RA6A 4KIIA 1YUPA 4NYQA 3IFBA 2FTBA 3WZNA 1VWCB 5L3YA 2UZ2A 1DZMA 3T2XA 3VHMA 1OPBA 3B2HA 4MVKA 2ZSCA 4ORXA 4ZH9A 4AZOA 1D2UA 4QNIA 4FBOA 2RTKA 1NDJA 1OBUA 4XMGA 4A60A 2C1SA 4JHQA 2MO5A 4EXZA 2HZQA 3WZPA 4AZNA 5B29A 1JYDA 2NNDA 3QKGA 5LJBA 1JIWI 1VWFB 4GH7A 1SRIA 2FKJA 1EQDA 2RTAA 1I04A 2IZKA 4YKMA 2JU7A 1VWIB 2JW1A 1TW4A 1STPA 2IZAA 1N9MA 2OY1O 2C1QA 3EMMA 3LHNA 4U46A 4EEJA 5HZ6A 1JJUA 4TKBA 4YVBA 1FELA 3BU1A 4GJVA 1JMZA 1FJ1E 2CM9A 4KCAA 1Y52X 2IZEB 2RTHB 5BYPA 5HZ5A 1N43A 3WJEA 2DJFA 1AVEA 3B2KA 4NW4A 2BSZA 1IKJA 1YP7A 2N93A 4I3CA 3ZZVA 4R0BA 5L8OA 1G5WA 1CRBA 1LF7A 2BS5A 2AT5X 3BX8A 4JGLA 1PM1X 1HXZA 4WFVA 5FQ7E 1SWLA 4U9CA 4GK9A 2AF5A 4CK4A 3IA8A 3D9WA 1SRGA 4QAEA 5HCEC 2IZLB 4I60A 5DG4A 4XMHA 1QABE 1W6FA 3S26A 3SAOA 4MISA 1G7NA 1T68X 3C78X 2HKDA 5LJGA 1G74A 1SLGB 2A5BA 3PK2A 2R56A 2A8GA 1Y0GA 4Y0QA 1W4TA 5K68A 1SXYA 2ALLX 2X32A 1N7YA 3EC5A 3P6CA 4HPCA 1ERXA 1VWAB 1YWCA 4U8UM 4YBUA 3KFGA 3SLJA 1XKIA 4GJSA 1GX3A 2CM4A 2K23A 1ICMA 3UEWA 3X00A 5JR8A 1MOYA 1HQPA 2A0AA 3AKNA 4LZVA 5LKEA 1JZUA 3Q34A 1BRPA 2QOSC 3NQ3A 5F6ZA 5HTDA 1B0OA 4Y5DA 1EIOA 4WHIA 5IRWA 2GC9A 1X8PA 2X4MA 1GKAA 1SWRA 3GAQA 3PH6A 3NX2A 2OF9A 2WEXA 2AT3X 1ZNLA 2FHLA 5FFHA 2JN3A 2W2FA 5IO7A 5B2AO 3H3IA 1D3SA 1A18A 4Y0RA 2OFMX 4TKHA 4I3BA 1RSUB 4ODDA 1VWEB 1GT1A 4Y59A 2CZTA 4ORYA 2QO4A 5JD2A 1ZNEA 5BVQA 3STMX 3SZJA 4JO6A 4BGFA 2Z4HA 5H9AA 5HAEA 5D48A 3RE6A 2JU3A 3FA6A 1VPRA 1SLDB 4BOEA 4BBOA 1VWOB 1U17A 4NV7A 1L6MA 4HFOA 4ZH6A 2WWPA 4MIRA 3MVFA 4CPEA 2Q9SA 1HMTA 3VG3A 4ALOA 3P6DA 5FENA 1EW3A 1VWLB 1XCAA 3D96A 4FQBB 3P6HA 3PDFA 3S60A 3ELZA 4IAWA 4YFQA 1CJ5A 3DTQA 3KFFA 2ASNX 1LCWA 2RTDB 4OS0A 4ZHDA 5AEOA 1G85A 1YIVA 1LDQA 4I9RA 5L8IA 4HPAA 3K3LA 4Z2PA 3GE2A 4AW8A 1ZRYA 5DPQA 5CHKA 3KQ0A 5CSEA 1JQPA 1I9HA 1SA8A 3C76X 4O4SA 1QG5A 1KQXA 2Y3EA 3BLGA 2WR6A 3FELA 2FR2A 3RE5A 3VHHA 2RCTA 5LJCA 1QWDA 3RZYA 1SRJA 1YWDA 1EXSA 2RTGB 3RDXA 5D8JA 1VWJB 2GH7A 1RXKA 2MJIA 4C5PA 4I3DA 3VG4A 1BLRA 5HA1A 4QYNA 2AH7X 4Z2OA 3PECA 1SXWA 3BX7A 3BSZE 4YH0A 3S5XA 4COTA 4ZGFA 4NNTA 4GETA 2ACOA 3ZW1A 4D6AA 3JSQA 1KGLA 2WQAE 3HPEA 1FEMA 4XMDA 1QY2A 2AT8X 1SWUA 2BLGA 1E02A 1QY1A 1UYNX 1VWHB 4NLIA 3KZAA 1NP1A 2HMBA 5C0NA 1STRB 5EEEA 1U0XA 3VG7A 1LCVA 2RTEB 3PH5A 1VWGB 3HWFA 4CDFA 2NNEA 2L68A 1VWMB 3B2LA 4IB7A 1RXHA 3SLTA 3WYPA 2KD2A 2G7BA 2OVDA 1SY1A 1B4MA 4U3QA 1SRFA 4YCHA 1BM5A 5BVSA 1SWCA 4Z28A 3JS1A 4GDAA 1VYGA 3BDRA 2JOZA 2PI3O 2MHDA 2IZCB 1JV4A 4O4OA 4TKJA 4AZPA 1ERBA 1EI5A 4TNNA 4DNEA 5HZ9A 5K06A 3FA7A 2VDFA 4HPBA 1Y55X 2IFBA 3U03A 4A1YA 3APVA 2E4JA 2LB6A 1JBHA 2LA7A 1SWNA 2FR3A 2IZIA 3AEHA 3B2JA 2GTLO 4CPHB 4O3ZA 1HBQA 3O22A 4IMNA 1QY0A 4O49A 1WBIA 1BSOA 5HZ8A 1X8OA 3ZWEA 4QQ1A 1LICA 4YBPA 4GGTA 4BX5A 2L9CA 3HOEA 3WBGA 2RQ0A 1MX7A 1SWHA 2I5ZO 4D6BA 2OY7A 4GNWA 2AKQA 1BEBA 2IZGB 4HWMA 1AB0A 3P6EA 1KFFA 1JJXA 4HPDA 2KTDA 3V8UA 5HCCC 3WXQA 2WUTA 2PY1A 3P6FA 2FKGA 3NADA 3O19A 4O9SA 2RTIB 2RCQA 4ZHFA 1GKAB 2OL7A 2A13A 2QO5A 3ZW0B 4CPIA 3ELXA 4GGRA 4ZHCA 1Z24A 1B56A 2LFOA 2FHNX 4YFRA 5EDBA 4ZCBA 5B5FA 4YCEA 1EIIA 4GU8A 1OBPA 1AVDA 4O3WA 1N0SA 3TGBA 3P24A 1QFVA 2Y32A 2RD7C 2OVEA 2X8FA 4MEEA 1NP4A 3PEDA 2DM5A 2RN4A 3STNA 1E00A 2QOMA 3T6LA 2G8CO 3BY0A 2FS6A 1IW2A 3HOLA 4EDEA 1KL3A 3VPJE 2NP1A 2G78A 3EBWA 4KC8A 1I06A 1KQWA 1E2TA 3D95A 2ZAIA 3RDQA 1MEPA 4YMYA 2RTFB 5EEDA 5LJDA 4EQAC 1LNMA 1IKEA 1GM6A 1SWEA 1KT3A 2RTJA 3JQOA 4AZMA 3TZSA 2F01A 3RDOA 1IJ8A 2Q2PA 5D45A 5D47A 1ALBA 2Y3FA 1S7DA 3HWEA 1GXAA 2KTSA 3TGAA 3OBLA 4QYPA 3RY1A 2A5CA 2RTRB 3WJGA 1VWNB 2GTLM 2MWHA 4BQUA 1GT3A 3VHIA 3CR6A 1RLBE 3VE1A 2WEWA 1CBIA 1SLFB 1OEJA 4UU2A 2ACPX 2FRSA 3FR5A 1WUBA 1IFBA 1SWJA 3F8AA 1DZPA 1JYJA 2VFCA 1MDCA 2LBVA 5KHPA 1FTPA 4ZGUA 2FWVA 1VWBB 2FT9A 2OVSA 4KH8A 1TVQA 4MVIA 3C77X 1X8NA 5HA0A 1K3BA 3WOVA 5IO6A 2I5VO 3PQUA 1OBQA 4DQ4A 4IMOA 4ZHGA 1VWRB 3ZW1B 2RTQB 5BVTA 1ML7A 3FDCA 4ORWA 2MM3A 1SWBA 2RTCB 1NQMA 1P6PA 5LJHA 2RTMA 3UEXA 2RTBB 3WJDA 1BRQA 2YG2A 2OFRX 2P8GA 2K62A 1HMRA 1SWGA 1VYOA 3FA8A 4M7MA 5HZQA 1OEEA 2X34A 2GJ5A 4Z6JA 3UEUA 2GTFX 3I17A 2X55A 4I95A 2NNQA 5IXGA 4I9SA 4LKPA 1HXLA 1SREA 4ALBA 4EKVA 2BC3A 1X8UA 3T6FA 5H9KA 1MK5A 1S44A 2C4IA 2X46A 5H8TA 1GT4A 1SY2A 1U18A 3VG5A 4AYHA 3TGCA 4B55A 1Y9TA 1JJJA 1GX8A 4M6SA 1HQQA 5FQ8E 5IO5A 4GD9A 2Q2MA 3D4RA 4O4XA 3NQKA 4YGZA 5CE4A 4ORRA 3OJYC 3EM0A 4CSBA 2OL8O 4QGWA 3P6GA 4QGXA 4ZFXA 1SWQA 1YP6A 4Y0PA 2BHVA 2IZJA 1ZNKA 2WQ9A 1PEEA 3BS2A 1KT6A 2FGSA 4MVEA 2IZBA 4CV7A 2R74A 4ARHA 3U9PC 1SWAA 2FS7A 2X56A 1EPAA 3FW4A 4NV8A 4IABA 4IBAA 1OSPO 2HNXA 3RDUA 4ES7A 4TQ2A 1SWPA 2KT4B 2OFBA 3S5VA 1IFCA 1LPJA 5B10O 4EFGA 3BRNA 1SWTA 3PPTA 3FEKA 3MX7A 4K19A 3STKA 1T0VA 4OS3A 1QQSA 5KICA 2X8SA 1PBYA 4TJZA 5H9LA 1KZWA 3ZUIA 4AZQA 2AMMX 2F09A 1GGLA 2WPUA 1BJ7A 3EW2A 4OELA 4QRLA 1LDOA 2QCBA 4RUNA 4BCSA 3ZI8A 1ZNGA 1O1VA 2POAA 4DQ3A 3UAQA 3CKGA 2HZRA 1LIDA 2W2BA 4Z27A 1OPAA 2LBAA 4GRJA 4YGGA 1I78A 5B11O 4INNA 1BSYA 1HBPA 4LKTA
chains in the Genus database with same CATH topology
3VG2A 3P02A 1YWBA 1MX8A 4IB9A 1SXUA 3WJFA 4KT5A 2AL0X 4O3YA 4YFPA 2YMSA 5HCDC 4ORUA 3ZUOA 1OEKA 3FMZA 4NYRA 5LJEA 1KT7A 1DF3A 3B2IA 2A2UA 3CQNA 3CMPA 3FYFA 1CBQA 4IB6A 2F73A 1MVGA 2OZQA 2O62A 3VG6A 4O4UA 3EBKA 1SXXA 3WJCA 1E06A 1S2PA 3OE3A 3FLLA 3VU1A 1MUPA 4PJ2A 1AVGI 1IIUA 3LV4A 4WFUA 5EDCA 4XMEA 4YGHA 2QM9A 1LIBA 1QFTA 3HWGA 1LIFA 2A2GA 1B8EA 3CQRA 4GNYA 3RBYA 1HN2A 1ZNHA 4ID2A 2W2AA 1TXLA 3D97A 3UEVA 4ZHHA 3PQSA 1EUOA 1H91A 1UREA 2CBRA 2CZUA 3APWA 5F58A 2BT9A 5HWZA 5LKFA 1A3YA 1KOIA 2WSJA 4GZVA 2R73A 4LZUA 4QZUA 1LIEA 4IB8A 5D4AA 1VYFA 4FBVA 1EALA 3F6ZB 3F9DA 2AT6X 4NP1A 4UU3A 4ZR2A 1A57A 1I05A 1KXOA 5F1EA 3EYCA 4ML7B 1FDQA 3WJBA 1UZ2X 2HLVA 4YDBA 5EPQA 2CBSA 3U0DA 1NGLA 3T1DA 1FENA 1LKEA 4QGVA 2XSTA 4ORSA 5F7GA 4MVLA 4BVMA 2Q39A 3KFHA 1DFVA 1RBPA 4KC7A 3I0AA 4OMXA 3NPOA 3CBSA 1ADLA 2G79A 1CBSA 1AQBA 3L4RA 3O2YA 3NR3A 4OMWA 2ANSA 1O1UA 3NBXX 1TOWA 4WBKA 3ZW0A 4XMFA 3FR4A 4NNSA 1SY0A 3DSZA 2AT0X 2HYSA 1YWAA 4GKCA 1FE3A 1LFOA 1SMPI 2JMBA 2X8TA 4NLJA 3AKMA 3RWXA 5H9NA 2L5PA 1Y9LA 2ZAGA 3APXA 4N7CA 2KW1A 2EU7X 3RKGA 3FENA 3TF6A 5CYBA 1ACDA 3NQ9A 3HWDA 1BSQA 5FAZA 2L67A 2Z4IA 3G7XA 4PSQA 4LQZA 3RSWA 3OD9A 2QO6A 2X45A 2JU8A 5AJBA 1T8VA 4ON1A 1BWYA 2FLJA 2QMIA 5AQ6A 4ZJ0A 3FIQA 4QZTA 1TOUA 4L3RA 3APUA 1AELA 5L8NA 4I6SA 5AJCA 1SY3A 3HK1A 3ZW2A 1DZJA 1HBPA 3FR2A 3FA9A 1ZNDA 1R0UA 1O8VA 1X71A 2OVAA 2Q4NA 5KIDA 1KT4A 1PMPA 1DZKA 1X89A 1HMSA 3PP6A 5EZ2A 4GE1A 1A2DA 3VE2A 2LKKA 3CBCA 3E3CA 4O3XB 5HTEA 1GT5A 1PBOA 1ICNA 3SOTA 3WVMA 4OS8A 5B27A 3N91A 4A1HA 2BS6A 4YDAA 1X8QA 4TLJA 1E5PA 3ZQ3A 1KT5A 4YKOA 4GDZA 4L1NA 1DV9A 3CWKA 4RUUA 1BBPA 3FEPA 1EPBA 4U8UN 3BU9A 2XKLA 3KFIA 4IAXA 5HBSA 4FBRA 3Q6LA 3FW5A 1GX9A 5LJKA 1I4UA 4FGIB 5FQ6E 4A8ZA 5F6BA 4Y0SA 2GTLN 2M4LA 2A3FX 3HTYA 1DC9A 3NP1A 3MBTA 3NX1A 4N7DA 4XMCA 4U8UO 4KIIA 2RA6A 1YUPA 4NYQA 3IFBA 2FTBA 1DZMA 1OPBA 3B2HA 4MVKA 4ORXA 4ZH9A 4AZOA 1D2UA 4QNIA 4FBOA 1OBUA 4XMGA 4A60A 4EXZA 2MO5A 2HZQA 4AZNA 5B29A 1JYDA 2NNDA 3QKGA 5LJBA 1JIWI 4GH7A 1EQDA 1I04A 4YKMA 2JU7A 2JW1A 1TW4A 3EMMA 4EEJA 5HZ6A 3LHNA 4TKBA 1FELA 3BU1A 2CM9A 4KCAA 5BYPA 5HZ5A 3WJEA 3B2KA 4NW4A 1IKJA 1YP7A 2N93A 4I3CA 3ZZVA 4R0BA 5L8OA 1G5WA 1CRBA 1LF7A 2BS5A 2AT5X 3BX8A 4JGLA 1PM1X 4WFVA 5FQ7E 4U9CA 4GK9A 4CK4A 3IA8A 4QAEA 5HCEC 5DG4A 4XMHA 1QABE 3S26A 3SAOA 4MISA 1G7NA 1T68X 3C78X 5LJGA 1G74A 2R56A 4Y0QA 1SXYA 2ALLX 1KZXA 3P6CA 4HPCA 4U8UM 1ERXA 1YWCA 4YBUA 3KFGA 1XKIA 2CM4A 2K23A 1ICMA 3UEWA 5JR8A 5LKEA 1HQPA 2A0AA 3AKNA 4LZVA 1JZUA 1BRPA 2QOSC 3NQ3A 5F6ZA 5HTDA 1B0OA 1EIOA 4WHIA 2GC9A 1X8PA 1GKAA 3GAQA 3PH6A 3NX2A 2WEXA 2AT3X 1ZNLA 5FFHA 5IO7A 2JN3A 2W2FA 3H3IA 1D3SA 1A18A 4Y0RA 2OFMX 4TKHA 4I3BA 4ODDA 5BVQA 1GT1A 2CZTA 4ORYA 2QO4A 3STMX 1ZNEA 2Z4HA 5H9AA 5HAEA 5D48A 2JU3A 3FA6A 1VPRA 4BOEA 1U17A 1L6MA 4HFOA 4ZH6A 2WWPA 4MIRA 3MVFA 2Q9SA 1HMTA 3VG3A 4ALOA 3P6DA 5FENA 1EW3A 1XCAA 3D96A 4FQBB 3P6HA 1CJ5A 3S60A 3ELZA 4IAWA 4YFQA 3DTQA 3KFFA 2ASNX 4OS0A 4ZHDA 5AEOA 1G85A 1YIVA 4I9RA 5L8IA 4HPAA 3K3LA 3GE2A 4AW8A 1ZRYA 5DPQA 3KQ0A 1SA8A 4O4SA 3C76X 1QG5A 1KQXA 3BLGA 3FELA 2WR6A 2FR2A 2RCTA 5LJCA 1QWDA 3RZYA 1YWDA 1EXSA 5D8JA 2MJIA 4I3DA 3VG4A 1BLRA 5HA1A 4QYNA 2AH7X 3PECA 1SXWA 3BX7A 3BSZE 4YH0A 3S5XA 4COTA 4ZGFA 4NNTA 4GETA 2ACOA 3ZW1A 4D6AA 3JSQA 1KGLA 2WQAE 1FEMA 4XMDA 1QY2A 2AT8X 2BLGA 1E02A 1QY1A 4NLIA 3KZAA 1NP1A 2HMBA 5C0NA 5EEEA 1U0XA 3VG7A 3PH5A 3HWFA 2NNEA 2L68A 3B2LA 4IB7A 2KD2A 2G7BA 2OVDA 1SY1A 1B4MA 4U3QA 4YCHA 1BM5A 5BVSA 3JS1A 1VYGA 3BDRA 2JOZA 2MHDA 4AZPA 1JV4A 4O4OA 4TKJA 5HZ9A 1ERBA 1EI5A 4TNNA 5K06A 3FA7A 4HPBA 2IFBA 3U03A 4A1YA 3APVA 2E4JA 2LB6A 1JBHA 2LA7A 3B2JA 2FR3A 2GTLO 4O3ZA 1HBQA 3O22A 4IMNA 1QY0A 4O49A 1BSOA 5HZ8A 1X8OA 3ZWEA 4QQ1A 1LICA 4YBPA 2L9CA 3HOEA 3WBGA 2RQ0A 1MX7A 4D6BA 4GNWA 2AKQA 1BEBA 4HWMA 1AB0A 3P6EA 1JJXA 4HPDA 2KTDA 3V8UA 5HCCC 3WXQA 2WUTA 2PY1A 3P6FA 3NADA 3O19A 4O9SA 4ZHFA 2RCQA 1GKAB 2A13A 2QO5A 3ZW0B 4ZHCA 3ELXA 1Z24A 1B56A 2LFOA 4YFRA 5EDBA 4ZCBA 4YCEA 1EIIA 4GU8A 1OBPA 4O3WA 1N0SA 3TGBA 3P24A 1QFVA 2RD7C 2OVEA 2X8FA 1NP4A 3PEDA 2DM5A 2RN4A 3STNA 1E00A 3BY0A 2FS6A 1IW2A 3HOLA 4EDEA 3VPJE 2NP1A 2G78A 3EBWA 4KC8A 1I06A 1KQWA 3D95A 2ZAIA 4YMYA 4EQAC 5EEDA 5LJDA 1LNMA 1IKEA 1GM6A 4AZMA 1KT3A 3JQOA 3TZSA 2Q2PA 5D47A 5D45A 1ALBA 1S7DA 3HWEA 1GXAA 2KTSA 3TGAA 3OBLA 4QYPA 3WJGA 3TGCA 4BQUA 2GTLM 2MWHA 1GT3A 3CR6A 1RLBE 3VE1A 2WEWA 1CBIA 1OEJA 4UU2A 2ACPX 2FRSA 3FR5A 1IFBA 3F8AA 1DZPA 1JYJA 2LBVA 1MDCA 5KHPA 1FTPA 4ZGUA 2FWVA 2FT9A 2OVSA 4KH8A 1TVQA 4MVIA 3C77X 1X8NA 5HA0A 3WOVA 5IO6A 3PQUA 1OBQA 4DQ4A 4IMOA 4ZHGA 3ZW1B 5BVTA 1ML7A 4ORWA 2MM3A 1P6PA 5LJHA 3UEXA 3WJDA 1BRQA 2YG2A 2OFRX 2P8GA 2K62A 1HMRA 3FA8A 4M7MA 5HZQA 1OEEA 2GJ5A 3UEUA 2GTFX 3I17A 4I95A 2NNQA 4I9SA 4LKPA 4ALBA 1X8UA 5H9KA 1S44A 5H8TA 2X46A 3VG5A 1GT4A 1SY2A 1U18A 4AYHA 1Y9TA 1JJJA 1GX8A 4M6SA 5FQ8E 5IO5A 2Q2MA 3D4RA 4O4XA 3NQKA 4YGZA 5CE4A 4ORRA 3OJYC 3EM0A 4CSBA 4QGWA 3P6GA 4QGXA 4ZFXA 1YP6A 4Y0PA 2BHVA 1ZNKA 2WQ9A 1PEEA 3BS2A 1KT6A 4MVEA 4CV7A 2R74A 4ARHA 3U9PC 2FS7A 1EPAA 3FW4A 4IABA 4IBAA 4ES7A 2HNXA 4TQ2A 3S5VA 2KT4B 4EFGA 1IFCA 1LPJA 3BRNA 3PPTA 3FEKA 3MX7A 4K19A 3STKA 1T0VA 4OS3A 1QQSA 5KICA 2X8SA 4TJZA 5H9LA 1KZWA 3ZUIA 4AZQA 2AMMX 2F09A 1GGLA 4RUNA 1BJ7A 4AZRA 4QRLA 3ZI8A 1ZNGA 1O1VA 2POAA 4DQ3A 3UAQA 2HZRA 1LIDA 2W2BA 1OPAA 2LBAA 4GRJA 4YGGA 4INNA 1BSYA 1CBRA 4LKTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y9L A;  1Y9T A;  2JW1 A; 
#chains in the Genus database with same CATH topology
 3VG2 A;  3P02 A;  1YWB A;  3QQ2 A;  1MX8 A;  1VWD B;  4IB9 A;  1SXU A;  3WJF A;  4KT5 A;  2OL6 O;  2AL0 X;  1SWS A;  4O3Y A;  1MM9 A;  2IZF B;  1NC9 A;  4BX7 A;  4YFP A;  2YMS A;  5HCD C;  4CDE A;  4ORU A;  1NQN A;  3ZUO A;  1OEK A;  3FMZ A;  4NYR A;  5LJE A;  1KT7 A;  2RTL A;  4CDD A;  4OKA A;  1DF3 A;  3B2I A;  1K24 A;  1PTS A;  2A2U A;  3LTW A;  3CQN A;  3CMP A;  3FYF A;  5IRU A;  1CBQ A;  4IB6 A;  2F73 A;  1MVG A;  2OZQ A;  2O62 A;  2CAM A;  3VG6 A;  4O4U A;  3EBK A;  1SXX A;  3WJC A;  3WZQ A;  1E06 A;  1S2P A;  3OE3 A;  3FLL A;  3VU1 A;  1MUP A;  4PJ2 A;  1AVG I;  1IIU A;  3LV4 A;  4WFU A;  5EDC A;  4XME A;  4YGH A;  2QM9 A;  1LIB A;  1QFT A;  3HWG A;  1LIF A;  2A2G A;  1B8E A;  3CQR A;  4GNY A;  3RBY A;  1HN2 A;  1ZNH A;  4ID2 A;  4CPF A;  3SZI A;  2W2A A;  1TXL A;  3D97 A;  3UEV A;  4ZHH A;  3PQS A;  1EUO A;  1H91 A;  1URE A;  2CBR A;  2CZU A;  2UYW A;  3APW A;  3EW1 A;  2BT9 A;  5F58 A;  5HWZ A;  5LKF A;  1A3Y A;  1KOI A;  2WSJ A;  4GZV A;  1LUQ A;  2R73 A;  4LZU A;  4QZU A;  1LIE A;  4AZR A;  4IB8 A;  3VGW A;  5D4A A;  1VYF A;  1RXJ A;  4FBV A;  4BX6 A;  3F6Z B;  1EAL A;  3F9D A;  2AT6 X;  4NP1 A;  4UU3 A;  5K67 A;  4CDC A;  4ZR2 A;  4BJ8 A;  1I05 A;  1A57 A;  1KXO A;  5F1E A;  3EYC A;  4ML7 B;  1FDQ A;  3WJB A;  1UZ2 X;  1VWP B;  2HLV A;  4YDB A;  5EPQ A;  2CBS A;  3U0D A;  1JMX A;  1NGL A;  3T1D A;  4CPH A;  1FEN A;  3FID A;  1LKE A;  4QGV A;  2XST A;  3RDM A;  4ORS A;  5F7G A;  4MVL A;  4BVM A;  4GUZ A;  3T2W A;  2Q39 A;  3KFH A;  1DFV A;  1RBP A;  4KC7 A;  4DCB A;  3I0A A;  4OMX A;  3NPO A;  1KL5 A;  3CBS A;  1ADL A;  3AUM O;  4GGZ A;  2G79 A;  1CBS A;  1AQB A;  1SRH A;  3L4R A;  3SZH A;  3O2Y A;  3KVN A;  3NR3 A;  2OY8 A;  4OMW A;  2ANS A;  1O1U A;  2JGS A;  1DF8 A;  1TOW A;  3NBX X;  4WBK A;  3ZW0 A;  4XMF A;  2VFB A;  3FR4 A;  4NNS A;  1SY0 A;  3DSZ A;  2AT0 X;  2HYS A;  1RST B;  1YWA A;  4GKC A;  1FE3 A;  5B3M O;  2DJG A;  1LFO A;  1SMP I;  2JMB A;  2G5L A;  2X8T A;  4NLJ A;  3AKM A;  3RWX A;  5H9N A;  2L5P A;  2OY5 O;  1Y9L A;  2ZAG A;  1W5R A;  3APX A;  4N7C A;  2KW1 A;  1SLE B;  2EU7 X;  3RKG A;  3FEN A;  5B5G A;  3TF6 A;  2AVI A;  5CYB A;  1ACD A;  3NQ9 A;  3HWD A;  1BSQ A;  5FAZ A;  4OEM A;  4Z2V A;  2L67 A;  2Z4I A;  3G7X A;  4PSQ A;  1SWO A;  4LQZ A;  3RSW A;  3OD9 A;  2QO6 A;  2X45 A;  2JU8 A;  5AJB A;  1T8V A;  4ON1 A;  4BX5 B;  4BX7 B;  2FLJ A;  2QMI A;  1BWY A;  1KZX A;  5AQ6 A;  1STS B;  4ZJ0 A;  3FIQ A;  4QZT A;  3RY2 A;  1TOU A;  4L3R A;  3APU A;  4JNJ A;  1AEL A;  5L8N A;  1SWF A;  4I6S A;  5AJC A;  2OYB O;  3SLO A;  1SY3 A;  3HK1 A;  3WYQ A;  3ZW2 A;  1DZJ A;  5IRA A;  1VWQ B;  3FR2 A;  3MM0 A;  2OF8 A;  3FA9 A;  1ZND A;  1R0U A;  1O8V A;  1X71 A;  2OVA A;  2Q4N A;  5KID A;  2IZD B;  1KT4 A;  1PMP A;  1VWK B;  2RTN B;  1DZK A;  1X89 A;  1HMS A;  3PP6 A;  5EZ2 A;  4GE1 A;  1A2D A;  1SWK A;  3VE2 A;  3MG5 A;  1HY2 A;  2LKK A;  1KL4 A;  3CBC A;  3E3C A;  1SWD A;  2RTP B;  4O3X B;  5HTE A;  5F2B A;  1GT5 A;  1PBO A;  1CBR A;  1ICN A;  3SOT A;  3WVM A;  4OS8 A;  5B27 A;  3N91 A;  4IRW A;  4A1H A;  2BS6 A;  4YDA A;  2OFA A;  1X8Q A;  4TLJ A;  1E5P A;  3ZQ3 A;  1KT5 A;  4YKO A;  4GDZ A;  4L1N A;  1NBX A;  2RTO B;  1DV9 A;  3CKF A;  1LEL A;  2IZH B;  3CWK A;  3RDS A;  4RUU A;  1BBP A;  1UYO X;  3FEP A;  1EPB A;  1LCZ A;  4U8U N;  3BU9 A;  2XKL A;  3KFI A;  4IAX A;  5HBS A;  2MF6 A;  3Q6L A;  3FW5 A;  1GX9 A;  4BX6 B;  4FBR A;  1I4U A;  5LJK A;  3WZO A;  4FGI B;  5FQ6 E;  4A8Z A;  5F6B A;  4Y0S A;  2GTL N;  1N9Y A;  2M4L A;  2A3F X;  3HTY A;  1DC9 A;  3NP1 A;  1RAV A;  3MBT A;  3NX1 A;  4N7D A;  4XMC A;  4U8U O;  1N4J A;  1Y53 X;  2RA6 A;  4KII A;  1YUP A;  4NYQ A;  3IFB A;  2FTB A;  3WZN A;  1VWC B;  5L3Y A;  2UZ2 A;  1DZM A;  3T2X A;  3VHM A;  1OPB A;  3B2H A;  4MVK A;  2ZSC A;  4ORX A;  4ZH9 A;  4AZO A;  1D2U A;  4QNI A;  4FBO A;  2RTK A;  1NDJ A;  1OBU A;  4XMG A;  4A60 A;  2C1S A;  4JHQ A;  2MO5 A;  4EXZ A;  2HZQ A;  3WZP A;  4AZN A;  5B29 A;  1JYD A;  2NND A;  3QKG A;  5LJB A;  1JIW I;  1VWF B;  4GH7 A;  1SRI A;  2FKJ A;  1EQD A;  2RTA A;  1I04 A;  2IZK A;  4YKM A;  2JU7 A;  1VWI B;  2JW1 A;  1TW4 A;  1STP A;  2IZA A;  1N9M A;  2OY1 O;  2C1Q A;  3EMM A;  3LHN A;  4U46 A;  4EEJ A;  5HZ6 A;  1JJU A;  4TKB A;  4YVB A;  1FEL A;  3BU1 A;  4GJV A;  1JMZ A;  1FJ1 E;  2CM9 A;  4KCA A;  1Y52 X;  2IZE B;  2RTH B;  5BYP A;  5HZ5 A;  1N43 A;  3WJE A;  2DJF A;  1AVE A;  3B2K A;  4NW4 A;  2BSZ A;  1IKJ A;  1YP7 A;  2N93 A;  4I3C A;  3ZZV A;  4R0B A;  5L8O A;  1G5W A;  1CRB A;  1LF7 A;  2BS5 A;  2AT5 X;  3BX8 A;  4JGL A;  1PM1 X;  1HXZ A;  4WFV A;  5FQ7 E;  1SWL A;  4U9C A;  4GK9 A;  2AF5 A;  4CK4 A;  3IA8 A;  3D9W A;  1SRG A;  4QAE A;  5HCE C;  2IZL B;  4I60 A;  5DG4 A;  4XMH A;  1QAB E;  1W6F A;  3S26 A;  3SAO A;  4MIS A;  1G7N A;  1T68 X;  3C78 X;  2HKD A;  5LJG A;  1G74 A;  1SLG B;  2A5B A;  3PK2 A;  2R56 A;  2A8G A;  1Y0G A;  4Y0Q A;  1W4T A;  5K68 A;  1SXY A;  2ALL X;  2X32 A;  1N7Y A;  3EC5 A;  3P6C A;  4HPC A;  1ERX A;  1VWA B;  1YWC A;  4U8U M;  4YBU A;  3KFG A;  3SLJ A;  1XKI A;  4GJS A;  1GX3 A;  2CM4 A;  2K23 A;  1ICM A;  3UEW A;  3X00 A;  5JR8 A;  1MOY A;  1HQP A;  2A0A A;  3AKN A;  4LZV A;  5LKE A;  1JZU A;  3Q34 A;  1BRP A;  2QOS C;  3NQ3 A;  5F6Z A;  5HTD A;  1B0O A;  4Y5D A;  1EIO A;  4WHI A;  5IRW A;  2GC9 A;  1X8P A;  2X4M A;  1GKA A;  1SWR A;  3GAQ A;  3PH6 A;  3NX2 A;  2OF9 A;  2WEX A;  2AT3 X;  1ZNL A;  2FHL A;  5FFH A;  2JN3 A;  2W2F A;  5IO7 A;  5B2A O;  3H3I A;  1D3S A;  1A18 A;  4Y0R A;  2OFM X;  4TKH A;  4I3B A;  1RSU B;  4ODD A;  1VWE B;  1GT1 A;  4Y59 A;  2CZT A;  4ORY A;  2QO4 A;  5JD2 A;  1ZNE A;  5BVQ A;  3STM X;  3SZJ A;  4JO6 A;  4BGF A;  2Z4H A;  5H9A A;  5HAE A;  5D48 A;  3RE6 A;  2JU3 A;  3FA6 A;  1VPR A;  1SLD B;  4BOE A;  4BBO A;  1VWO B;  1U17 A;  4NV7 A;  1L6M A;  4HFO A;  4ZH6 A;  2WWP A;  4MIR A;  3MVF A;  4CPE A;  2Q9S A;  1HMT A;  3VG3 A;  4ALO A;  3P6D A;  5FEN A;  1EW3 A;  1VWL B;  1XCA A;  3D96 A;  4FQB B;  3P6H A;  3PDF A;  3S60 A;  3ELZ A;  4IAW A;  4YFQ A;  1CJ5 A;  3DTQ A;  3KFF A;  2ASN X;  1LCW A;  2RTD B;  4OS0 A;  4ZHD A;  5AEO A;  1G85 A;  1YIV A;  1LDQ A;  4I9R A;  5L8I A;  4HPA A;  3K3L A;  4Z2P A;  3GE2 A;  4AW8 A;  1ZRY A;  5DPQ A;  5CHK A;  3KQ0 A;  5CSE A;  1JQP A;  1I9H A;  1SA8 A;  3C76 X;  4O4S A;  1QG5 A;  1KQX A;  2Y3E A;  3BLG A;  2WR6 A;  3FEL A;  2FR2 A;  3RE5 A;  3VHH A;  2RCT A;  5LJC A;  1QWD A;  3RZY A;  1SRJ A;  1YWD A;  1EXS A;  2RTG B;  3RDX A;  5D8J A;  1VWJ B;  2GH7 A;  1RXK A;  2MJI A;  4C5P A;  4I3D A;  3VG4 A;  1BLR A;  5HA1 A;  4QYN A;  2AH7 X;  4Z2O A;  3PEC A;  1SXW A;  3BX7 A;  3BSZ E;  4YH0 A;  3S5X A;  4COT A;  4ZGF A;  4NNT A;  4GET A;  2ACO A;  3ZW1 A;  4D6A A;  3JSQ A;  1KGL A;  2WQA E;  3HPE A;  1FEM A;  4XMD A;  1QY2 A;  2AT8 X;  1SWU A;  2BLG A;  1E02 A;  1QY1 A;  1UYN X;  1VWH B;  4NLI A;  3KZA A;  1NP1 A;  2HMB A;  5C0N A;  1STR B;  5EEE A;  1U0X A;  3VG7 A;  1LCV A;  2RTE B;  3PH5 A;  1VWG B;  3HWF A;  4CDF A;  2NNE A;  2L68 A;  1VWM B;  3B2L A;  4IB7 A;  1RXH A;  3SLT A;  3WYP A;  2KD2 A;  2G7B A;  2OVD A;  1SY1 A;  1B4M A;  4U3Q A;  1SRF A;  4YCH A;  1BM5 A;  5BVS A;  1SWC A;  4Z28 A;  3JS1 A;  4GDA A;  1VYG A;  3BDR A;  2JOZ A;  2PI3 O;  2MHD A;  2IZC B;  1JV4 A;  4O4O A;  4TKJ A;  4AZP A;  1ERB A;  1EI5 A;  4TNN A;  4DNE A;  5HZ9 A;  5K06 A;  3FA7 A;  2VDF A;  4HPB A;  1Y55 X;  2IFB A;  3U03 A;  4A1Y A;  3APV A;  2E4J A;  2LB6 A;  1JBH A;  2LA7 A;  1SWN A;  2FR3 A;  2IZI A;  3AEH A;  3B2J A;  2GTL O;  4CPH B;  4O3Z A;  1HBQ A;  3O22 A;  4IMN A;  1QY0 A;  4O49 A;  1WBI A;  1BSO A;  5HZ8 A;  1X8O A;  3ZWE A;  4QQ1 A;  1LIC A;  4YBP A;  4GGT A;  4BX5 A;  2L9C A;  3HOE A;  3WBG A;  2RQ0 A;  1MX7 A;  1SWH A;  2I5Z O;  4D6B A;  2OY7 A;  4GNW A;  2AKQ A;  1BEB A;  2IZG B;  4HWM A;  1AB0 A;  3P6E A;  1KFF A;  1JJX A;  4HPD A;  2KTD A;  3V8U A;  5HCC C;  3WXQ A;  2WUT A;  2PY1 A;  3P6F A;  2FKG A;  3NAD A;  3O19 A;  4O9S A;  2RTI B;  2RCQ A;  4ZHF A;  1GKA B;  2OL7 A;  2A13 A;  2QO5 A;  3ZW0 B;  4CPI A;  3ELX A;  4GGR A;  4ZHC A;  1Z24 A;  1B56 A;  2LFO A;  2FHN X;  4YFR A;  5EDB A;  4ZCB A;  5B5F A;  4YCE A;  1EII A;  4GU8 A;  1OBP A;  1AVD A;  4O3W A;  1N0S A;  3TGB A;  3P24 A;  1QFV A;  2Y32 A;  2RD7 C;  2OVE A;  2X8F A;  4MEE A;  1NP4 A;  3PED A;  2DM5 A;  2RN4 A;  3STN A;  1E00 A;  2QOM A;  3T6L A;  2G8C O;  3BY0 A;  2FS6 A;  1IW2 A;  3HOL A;  4EDE A;  1KL3 A;  3VPJ E;  2NP1 A;  2G78 A;  3EBW A;  4KC8 A;  1I06 A;  1KQW A;  1E2T A;  3D95 A;  2ZAI A;  3RDQ A;  1MEP A;  4YMY A;  2RTF B;  5EED A;  5LJD A;  4EQA C;  1LNM A;  1IKE A;  1GM6 A;  1SWE A;  1KT3 A;  2RTJ A;  3JQO A;  4AZM A;  3TZS A;  2F01 A;  3RDO A;  1IJ8 A;  2Q2P A;  5D45 A;  5D47 A;  1ALB A;  2Y3F A;  1S7D A;  3HWE A;  1GXA A;  2KTS A;  3TGA A;  3OBL A;  4QYP A;  3RY1 A;  2A5C A;  2RTR B;  3WJG A;  1VWN B;  2GTL M;  2MWH A;  4BQU A;  1GT3 A;  3VHI A;  3CR6 A;  1RLB E;  3VE1 A;  2WEW A;  1CBI A;  1SLF B;  1OEJ A;  4UU2 A;  2ACP X;  2FRS A;  3FR5 A;  1WUB A;  1IFB A;  1SWJ A;  3F8A A;  1DZP A;  1JYJ A;  2VFC A;  1MDC A;  2LBV A;  5KHP A;  1FTP A;  4ZGU A;  2FWV A;  1VWB B;  2FT9 A;  2OVS A;  4KH8 A;  1TVQ A;  4MVI A;  3C77 X;  1X8N A;  5HA0 A;  1K3B A;  3WOV A;  5IO6 A;  2I5V O;  3PQU A;  1OBQ A;  4DQ4 A;  4IMO A;  4ZHG A;  1VWR B;  3ZW1 B;  2RTQ B;  5BVT A;  1ML7 A;  3FDC A;  4ORW A;  2MM3 A;  1SWB A;  2RTC B;  1NQM A;  1P6P A;  5LJH A;  2RTM A;  3UEX A;  2RTB B;  3WJD A;  1BRQ A;  2YG2 A;  2OFR X;  2P8G A;  2K62 A;  1HMR A;  1SWG A;  1VYO A;  3FA8 A;  4M7M A;  5HZQ A;  1OEE A;  2X34 A;  2GJ5 A;  4Z6J A;  3UEU A;  2GTF X;  3I17 A;  2X55 A;  4I95 A;  2NNQ A;  5IXG A;  4I9S A;  4LKP A;  1HXL A;  1SRE A;  4ALB A;  4EKV A;  2BC3 A;  1X8U A;  3T6F A;  5H9K A;  1MK5 A;  1S44 A;  2C4I A;  2X46 A;  5H8T A;  1GT4 A;  1SY2 A;  1U18 A;  3VG5 A;  4AYH A;  3TGC A;  4B55 A;  1Y9T A;  1JJJ A;  1GX8 A;  4M6S A;  1HQQ A;  5FQ8 E;  5IO5 A;  4GD9 A;  2Q2M A;  3D4R A;  4O4X A;  3NQK A;  4YGZ A;  5CE4 A;  4ORR A;  3OJY C;  3EM0 A;  4CSB A;  2OL8 O;  4QGW A;  3P6G A;  4QGX A;  4ZFX A;  1SWQ A;  1YP6 A;  4Y0P A;  2BHV A;  2IZJ A;  1ZNK A;  2WQ9 A;  1PEE A;  3BS2 A;  1KT6 A;  2FGS A;  4MVE A;  2IZB A;  4CV7 A;  2R74 A;  4ARH A;  3U9P C;  1SWA A;  2FS7 A;  2X56 A;  1EPA A;  3FW4 A;  4NV8 A;  4IAB A;  4IBA A;  1OSP O;  2HNX A;  3RDU A;  4ES7 A;  4TQ2 A;  1SWP A;  2KT4 B;  2OFB A;  3S5V A;  1IFC A;  1LPJ A;  5B10 O;  4EFG A;  3BRN A;  1SWT A;  3PPT A;  3FEK A;  3MX7 A;  4K19 A;  3STK A;  1T0V A;  4OS3 A;  1QQS A;  5KIC A;  2X8S A;  1PBY A;  4TJZ A;  5H9L A;  1KZW A;  3ZUI A;  4AZQ A;  2AMM X;  2F09 A;  1GGL A;  2WPU A;  1BJ7 A;  3EW2 A;  4OEL A;  4QRL A;  1LDO A;  2QCB A;  4RUN A;  4BCS A;  3ZI8 A;  1ZNG A;  1O1V A;  2POA A;  4DQ3 A;  3UAQ A;  3CKG A;  2HZR A;  1LID A;  2W2B A;  4Z27 A;  1OPA A;  2LBA A;  4GRJ A;  4YGG A;  1I78 A;  5B11 O;  4INN A;  1BSY A;  1HBP A;  4LKT A; 
#chains in the Genus database with same CATH homology
 3VG2 A;  3P02 A;  1YWB A;  1MX8 A;  4IB9 A;  1SXU A;  3WJF A;  4KT5 A;  2AL0 X;  4O3Y A;  4YFP A;  2YMS A;  5HCD C;  4ORU A;  3ZUO A;  1OEK A;  3FMZ A;  4NYR A;  5LJE A;  1KT7 A;  1DF3 A;  3B2I A;  2A2U A;  3CQN A;  3CMP A;  3FYF A;  1CBQ A;  4IB6 A;  2F73 A;  1MVG A;  2OZQ A;  2O62 A;  3VG6 A;  4O4U A;  3EBK A;  1SXX A;  3WJC A;  1E06 A;  1S2P A;  3OE3 A;  3FLL A;  3VU1 A;  1MUP A;  4PJ2 A;  1AVG I;  1IIU A;  3LV4 A;  4WFU A;  5EDC A;  4XME A;  4YGH A;  2QM9 A;  1LIB A;  1QFT A;  3HWG A;  1LIF A;  2A2G A;  1B8E A;  3CQR A;  4GNY A;  3RBY A;  1HN2 A;  1ZNH A;  4ID2 A;  2W2A A;  1TXL A;  3D97 A;  3UEV A;  4ZHH A;  3PQS A;  1EUO A;  1H91 A;  1URE A;  2CBR A;  2CZU A;  3APW A;  5F58 A;  2BT9 A;  5HWZ A;  5LKF A;  1A3Y A;  1KOI A;  2WSJ A;  4GZV A;  2R73 A;  4LZU A;  4QZU A;  1LIE A;  4IB8 A;  5D4A A;  1VYF A;  4FBV A;  1EAL A;  3F6Z B;  3F9D A;  2AT6 X;  4NP1 A;  4UU3 A;  4ZR2 A;  1A57 A;  1I05 A;  1KXO A;  5F1E A;  3EYC A;  4ML7 B;  1FDQ A;  3WJB A;  1UZ2 X;  2HLV A;  4YDB A;  5EPQ A;  2CBS A;  3U0D A;  1NGL A;  3T1D A;  1FEN A;  1LKE A;  4QGV A;  2XST A;  4ORS A;  5F7G A;  4MVL A;  4BVM A;  2Q39 A;  3KFH A;  1DFV A;  1RBP A;  4KC7 A;  3I0A A;  4OMX A;  3NPO A;  3CBS A;  1ADL A;  2G79 A;  1CBS A;  1AQB A;  3L4R A;  3O2Y A;  3NR3 A;  4OMW A;  2ANS A;  1O1U A;  3NBX X;  1TOW A;  4WBK A;  3ZW0 A;  4XMF A;  3FR4 A;  4NNS A;  1SY0 A;  3DSZ A;  2AT0 X;  2HYS A;  1YWA A;  4GKC A;  1FE3 A;  1LFO A;  1SMP I;  2JMB A;  2X8T A;  4NLJ A;  3AKM A;  3RWX A;  5H9N A;  2L5P A;  1Y9L A;  2ZAG A;  3APX A;  4N7C A;  2KW1 A;  2EU7 X;  3RKG A;  3FEN A;  3TF6 A;  5CYB A;  1ACD A;  3NQ9 A;  3HWD A;  1BSQ A;  5FAZ A;  2L67 A;  2Z4I A;  3G7X A;  4PSQ A;  4LQZ A;  3RSW A;  3OD9 A;  2QO6 A;  2X45 A;  2JU8 A;  5AJB A;  1T8V A;  4ON1 A;  1BWY A;  2FLJ A;  2QMI A;  5AQ6 A;  4ZJ0 A;  3FIQ A;  4QZT A;  1TOU A;  4L3R A;  3APU A;  1AEL A;  5L8N A;  4I6S A;  5AJC A;  1SY3 A;  3HK1 A;  3ZW2 A;  1DZJ A;  1HBP A;  3FR2 A;  3FA9 A;  1ZND A;  1R0U A;  1O8V A;  1X71 A;  2OVA A;  2Q4N A;  5KID A;  1KT4 A;  1PMP A;  1DZK A;  1X89 A;  1HMS A;  3PP6 A;  5EZ2 A;  4GE1 A;  1A2D A;  3VE2 A;  2LKK A;  3CBC A;  3E3C A;  4O3X B;  5HTE A;  1GT5 A;  1PBO A;  1ICN A;  3SOT A;  3WVM A;  4OS8 A;  5B27 A;  3N91 A;  4A1H A;  2BS6 A;  4YDA A;  1X8Q A;  4TLJ A;  1E5P A;  3ZQ3 A;  1KT5 A;  4YKO A;  4GDZ A;  4L1N A;  1DV9 A;  3CWK A;  4RUU A;  1BBP A;  3FEP A;  1EPB A;  4U8U N;  3BU9 A;  2XKL A;  3KFI A;  4IAX A;  5HBS A;  4FBR A;  3Q6L A;  3FW5 A;  1GX9 A;  5LJK A;  1I4U A;  4FGI B;  5FQ6 E;  4A8Z A;  5F6B A;  4Y0S A;  2GTL N;  2M4L A;  2A3F X;  3HTY A;  1DC9 A;  3NP1 A;  3MBT A;  3NX1 A;  4N7D A;  4XMC A;  4U8U O;  4KII A;  2RA6 A;  1YUP A;  4NYQ A;  3IFB A;  2FTB A;  1DZM A;  1OPB A;  3B2H A;  4MVK A;  4ORX A;  4ZH9 A;  4AZO A;  1D2U A;  4QNI A;  4FBO A;  1OBU A;  4XMG A;  4A60 A;  4EXZ A;  2MO5 A;  2HZQ A;  4AZN A;  5B29 A;  1JYD A;  2NND A;  3QKG A;  5LJB A;  1JIW I;  4GH7 A;  1EQD A;  1I04 A;  4YKM A;  2JU7 A;  2JW1 A;  1TW4 A;  3EMM A;  4EEJ A;  5HZ6 A;  3LHN A;  4TKB A;  1FEL A;  3BU1 A;  2CM9 A;  4KCA A;  5BYP A;  5HZ5 A;  3WJE A;  3B2K A;  4NW4 A;  1IKJ A;  1YP7 A;  2N93 A;  4I3C A;  3ZZV A;  4R0B A;  5L8O A;  1G5W A;  1CRB A;  1LF7 A;  2BS5 A;  2AT5 X;  3BX8 A;  4JGL A;  1PM1 X;  4WFV A;  5FQ7 E;  4U9C A;  4GK9 A;  4CK4 A;  3IA8 A;  4QAE A;  5HCE C;  5DG4 A;  4XMH A;  1QAB E;  3S26 A;  3SAO A;  4MIS A;  1G7N A;  1T68 X;  3C78 X;  5LJG A;  1G74 A;  2R56 A;  4Y0Q A;  1SXY A;  2ALL X;  1KZX A;  3P6C A;  4HPC A;  4U8U M;  1ERX A;  1YWC A;  4YBU A;  3KFG A;  1XKI A;  2CM4 A;  2K23 A;  1ICM A;  3UEW A;  5JR8 A;  5LKE A;  1HQP A;  2A0A A;  3AKN A;  4LZV A;  1JZU A;  1BRP A;  2QOS C;  3NQ3 A;  5F6Z A;  5HTD A;  1B0O A;  1EIO A;  4WHI A;  2GC9 A;  1X8P A;  1GKA A;  3GAQ A;  3PH6 A;  3NX2 A;  2WEX A;  2AT3 X;  1ZNL A;  5FFH A;  5IO7 A;  2JN3 A;  2W2F A;  3H3I A;  1D3S A;  1A18 A;  4Y0R A;  2OFM X;  4TKH A;  4I3B A;  4ODD A;  5BVQ A;  1GT1 A;  2CZT A;  4ORY A;  2QO4 A;  3STM X;  1ZNE A;  2Z4H A;  5H9A A;  5HAE A;  5D48 A;  2JU3 A;  3FA6 A;  1VPR A;  4BOE A;  1U17 A;  1L6M A;  4HFO A;  4ZH6 A;  2WWP A;  4MIR A;  3MVF A;  2Q9S A;  1HMT A;  3VG3 A;  4ALO A;  3P6D A;  5FEN A;  1EW3 A;  1XCA A;  3D96 A;  4FQB B;  3P6H A;  1CJ5 A;  3S60 A;  3ELZ A;  4IAW A;  4YFQ A;  3DTQ A;  3KFF A;  2ASN X;  4OS0 A;  4ZHD A;  5AEO A;  1G85 A;  1YIV A;  4I9R A;  5L8I A;  4HPA A;  3K3L A;  3GE2 A;  4AW8 A;  1ZRY A;  5DPQ A;  3KQ0 A;  1SA8 A;  4O4S A;  3C76 X;  1QG5 A;  1KQX A;  3BLG A;  3FEL A;  2WR6 A;  2FR2 A;  2RCT A;  5LJC A;  1QWD A;  3RZY A;  1YWD A;  1EXS A;  5D8J A;  2MJI A;  4I3D A;  3VG4 A;  1BLR A;  5HA1 A;  4QYN A;  2AH7 X;  3PEC A;  1SXW A;  3BX7 A;  3BSZ E;  4YH0 A;  3S5X A;  4COT A;  4ZGF A;  4NNT A;  4GET A;  2ACO A;  3ZW1 A;  4D6A A;  3JSQ A;  1KGL A;  2WQA E;  1FEM A;  4XMD A;  1QY2 A;  2AT8 X;  2BLG A;  1E02 A;  1QY1 A;  4NLI A;  3KZA A;  1NP1 A;  2HMB A;  5C0N A;  5EEE A;  1U0X A;  3VG7 A;  3PH5 A;  3HWF A;  2NNE A;  2L68 A;  3B2L A;  4IB7 A;  2KD2 A;  2G7B A;  2OVD A;  1SY1 A;  1B4M A;  4U3Q A;  4YCH A;  1BM5 A;  5BVS A;  3JS1 A;  1VYG A;  3BDR A;  2JOZ A;  2MHD A;  4AZP A;  1JV4 A;  4O4O A;  4TKJ A;  5HZ9 A;  1ERB A;  1EI5 A;  4TNN A;  5K06 A;  3FA7 A;  4HPB A;  2IFB A;  3U03 A;  4A1Y A;  3APV A;  2E4J A;  2LB6 A;  1JBH A;  2LA7 A;  3B2J A;  2FR3 A;  2GTL O;  4O3Z A;  1HBQ A;  3O22 A;  4IMN A;  1QY0 A;  4O49 A;  1BSO A;  5HZ8 A;  1X8O A;  3ZWE A;  4QQ1 A;  1LIC A;  4YBP A;  2L9C A;  3HOE A;  3WBG A;  2RQ0 A;  1MX7 A;  4D6B A;  4GNW A;  2AKQ A;  1BEB A;  4HWM A;  1AB0 A;  3P6E A;  1JJX A;  4HPD A;  2KTD A;  3V8U A;  5HCC C;  3WXQ A;  2WUT A;  2PY1 A;  3P6F A;  3NAD A;  3O19 A;  4O9S A;  4ZHF A;  2RCQ A;  1GKA B;  2A13 A;  2QO5 A;  3ZW0 B;  4ZHC A;  3ELX A;  1Z24 A;  1B56 A;  2LFO A;  4YFR A;  5EDB A;  4ZCB A;  4YCE A;  1EII A;  4GU8 A;  1OBP A;  4O3W A;  1N0S A;  3TGB A;  3P24 A;  1QFV A;  2RD7 C;  2OVE A;  2X8F A;  1NP4 A;  3PED A;  2DM5 A;  2RN4 A;  3STN A;  1E00 A;  3BY0 A;  2FS6 A;  1IW2 A;  3HOL A;  4EDE A;  3VPJ E;  2NP1 A;  2G78 A;  3EBW A;  4KC8 A;  1I06 A;  1KQW A;  3D95 A;  2ZAI A;  4YMY A;  4EQA C;  5EED A;  5LJD A;  1LNM A;  1IKE A;  1GM6 A;  4AZM A;  1KT3 A;  3JQO A;  3TZS A;  2Q2P A;  5D47 A;  5D45 A;  1ALB A;  1S7D A;  3HWE A;  1GXA A;  2KTS A;  3TGA A;  3OBL A;  4QYP A;  3WJG A;  3TGC A;  4BQU A;  2GTL M;  2MWH A;  1GT3 A;  3CR6 A;  1RLB E;  3VE1 A;  2WEW A;  1CBI A;  1OEJ A;  4UU2 A;  2ACP X;  2FRS A;  3FR5 A;  1IFB A;  3F8A A;  1DZP A;  1JYJ A;  2LBV A;  1MDC A;  5KHP A;  1FTP A;  4ZGU A;  2FWV A;  2FT9 A;  2OVS A;  4KH8 A;  1TVQ A;  4MVI A;  3C77 X;  1X8N A;  5HA0 A;  3WOV A;  5IO6 A;  3PQU A;  1OBQ A;  4DQ4 A;  4IMO A;  4ZHG A;  3ZW1 B;  5BVT A;  1ML7 A;  4ORW A;  2MM3 A;  1P6P A;  5LJH A;  3UEX A;  3WJD A;  1BRQ A;  2YG2 A;  2OFR X;  2P8G A;  2K62 A;  1HMR A;  3FA8 A;  4M7M A;  5HZQ A;  1OEE A;  2GJ5 A;  3UEU A;  2GTF X;  3I17 A;  4I95 A;  2NNQ A;  4I9S A;  4LKP A;  4ALB A;  1X8U A;  5H9K A;  1S44 A;  5H8T A;  2X46 A;  3VG5 A;  1GT4 A;  1SY2 A;  1U18 A;  4AYH A;  1Y9T A;  1JJJ A;  1GX8 A;  4M6S A;  5FQ8 E;  5IO5 A;  2Q2M A;  3D4R A;  4O4X A;  3NQK A;  4YGZ A;  5CE4 A;  4ORR A;  3OJY C;  3EM0 A;  4CSB A;  4QGW A;  3P6G A;  4QGX A;  4ZFX A;  1YP6 A;  4Y0P A;  2BHV A;  1ZNK A;  2WQ9 A;  1PEE A;  3BS2 A;  1KT6 A;  4MVE A;  4CV7 A;  2R74 A;  4ARH A;  3U9P C;  2FS7 A;  1EPA A;  3FW4 A;  4IAB A;  4IBA A;  4ES7 A;  2HNX A;  4TQ2 A;  3S5V A;  2KT4 B;  4EFG A;  1IFC A;  1LPJ A;  3BRN A;  3PPT A;  3FEK A;  3MX7 A;  4K19 A;  3STK A;  1T0V A;  4OS3 A;  1QQS A;  5KIC A;  2X8S A;  4TJZ A;  5H9L A;  1KZW A;  3ZUI A;  4AZQ A;  2AMM X;  2F09 A;  1GGL A;  4RUN A;  1BJ7 A;  4AZR A;  4QRL A;  3ZI8 A;  1ZNG A;  1O1V A;  2POA A;  4DQ3 A;  3UAQ A;  2HZR A;  1LID A;  2W2B A;  1OPA A;  2LBA A;  4GRJ A;  4YGG A;  4INN A;  1BSY A;  1CBR A;  4LKT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...