1Y9LA

The x-ray structure of an secretion system protein
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
110
structure length
110
Chain Sequence
EKEWHIVPVSKDYFSIPNDLLWSFNTTNKSINVYSKCISGKAVYSFNAGKFMGNFNVKEVDGCFMDAQKIAIDKLFSMLKDGVVLKGNKINDTILIEKDGEVKLKLIRGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipoprotein mxiM
publication title Structure and biochemical analysis of a secretin pilot protein.
pubmed doi rcsb
source organism Shigella flexneri
molecule tags Lipid binding protein
total genus 24
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2004-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11441 MxiM Pilot protein MxiM
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.230 Mainly Beta Beta Barrel Lipocalin Lipocalin 1y9lA00
1Y9TA 2JW1A 1Y9LA
chains in the Genus database with same CATH superfamily
1SXUA 2LBAA 5LJHA 3K3LA 1B4MA 5IRWA 2X46A 3WZNA 1HN2A 2CBRA 4BVMA 2XKLA 3D96A 4NNTA 5D45A 4ZGFA 4XMEA 3WBGA 1KT4A 1SY1A 2K23A 2W2FA 3IA8A 3UEUA 2OVDA 1CBIA 2OL8O 5F7GA 2IZGB 1B8EA 1SY2A 4GGRA 3RDSA 2RCTA 2CZTA 4ZHCA 1W4TA 3PH6A 4ZGUA 5IO5A 1JYJA 2GTLO 2RTMA 5CYBA 3PEDA 4YBUA 4K19A 4TKHA 5AJCA 1TXLA 2VFBA 3HWEA 1JIWI 3P6DA 3HPEA 3O22A 2ZSCA 1YWDA 2A0AA 1R0UA 5FQ7E 4BBOA 2A5BA 2BSZA 2JU8A 1LDOA 1ICMA 3F9DA 1A18A 2Q2MA 2WPUA 4HPCA 4ML7B 3OE3A 3UAQA 4COTA 3RDMA 2Q2PA 3RBYA 1NC9A 1RXJA 1Y52X 1GX9A 2ALLX 1OPAA 4I9RA 4CDFA 3BY0A 4BQUA 2X34A 3WZPA 4QGWA 1Y0GA 1LKEA 3CBSA 4AZOA 4AZRA 3WYPA 1CJ5A 3ZZVA 4JNJA 1E2TA 1JQPA 1DZMA 3APUA 1I78A 2IZEB 1KZXA 1ML7A 1SWLA 1Y9TA 2A2GA 2ZAGA 3BU9A 4WFVA 2G8CO 3BS2A 2GC9A 4LZUA 3TGBA 3MVFA 1T0VA 1VWRB 2AT0X 2A5CA 2CBSA 2GH7A 3S5XA 1UYNX 2RTKA 3FDCA 3VG3A 1SWQA 3KFFA 2W2BA 3UEWA 4JO6A 3RY1A 5HAEA 1EW3A 1LUQA 3SAOA 4PJ2A 2VFCA 3OBLA 1PBOA 2HZRA 1OEJA 2O62A 4ZH9A 3FEPA 1PEEA 1MUPA 2BS5A 2Y3EA 4GDZA 3NQ9A 3BSZE 2FHLA 2HMBA 1KOIA 4BGFA 4O4XA 1AVDA 1NP1A 2CAMA 2HZQA 1ADLA 4XMCA 4ES7A 2EU7X 4ZHDA 1A57A 2IZHB 4DNEA 2X8TA 5LJGA 5HTDA 2I5VO 1NBXA 5CHKA 1IIUA 2HKDA 4O4SA 5DPQA 2Y32A 3CBCA 3RDUA 3C78X 3KQ0A 3ZQ3A 1ERXA 1VYFA 3STMX 3FYFA 4GE1A 3AEHA 1CBSA 4YGZA 1NQMA 1E06A 2MM3A 4BCSA 1SMPI 3OD9A 4GD9A 4AW8A 3B2JA 3L4RA 3SZIA 3T2XA 5IO7A 1SWCA 1ZNDA 2RA6A 4GNYA 1JMZA 3FA9A 3ZUOA 4AZQA 4I6SA 1B0OA 2X8FA 1IKJA 1LIFA 1FELA 1SLDB 4ZHGA 4O4UA 1YWAA 3BRNA 3WJDA 4Z2VA 2G78A 1LNMA 1MOYA 3FMZA 2QMIA 5F1EA 1ALBA 1ICNA 3EW2A 3S26A 1AQBA 3RE6A 2RTHB 1BRQA 1VWAB 1VWMB 2AVIA 1KZWA 3NX2A 3JQOA 2IFBA 2GTLM 1QFVA 5FQ6E 1SRIA 4GU8A 3U9PC 4FBRA 1IFCA 1N7YA 2A3FX 3PK2A 1U18A 5EEEA 3WOVA 1STRB 4CDCA 1JBHA 1S2PA 3E3CA 2OFBA 2LB6A 4MIRA 1NP4A 1SWUA 1X8OA 4KC8A 1PM1X 4U8UN 4DCBA 1E00A 2ANSA 2OL7A 1LIDA 5BYPA 4OMWA 3PDFA 4YCEA 3BX7A 2FTBA 3PPTA 5IRUA 3TGAA 4NYQA 1EUOA 2POAA 2R56A 1SRJA 3T6LA 1LCWA 2RTNB 3WYQA 3JS1A 4N7CA 1GKAA 1RBPA 3PQUA 1BSOA 1QG5A 1LIEA 1UREA 4EQAC 4NV8A 1IW2A 2LKKA 1SWNA 2YG2A 3T1DA 2FRSA 5EPQA 2RN4A 2ZAIA 3KFIA 1HBQA 1KXOA 2G5LA 2JU7A 5EEDA 3AKNA 4BX6A 2UZ2A 2HNXA 3X00A 4DQ3A 3VHMA 5H9NA 1OEKA 2OFMX 2RTIB 3FIQA 2OF9A 1DZPA 4B55A 1SXXA 4AZPA 4GNWA 3WJCA 4HFOA 3P02A 1S44A 1G85A 5K67A 1SRFA 3B2LA 3UEXA 5FENA 1AVGI 1CRBA 4ID2A 4JHQA 1KL4A 1OBUA 3G7XA 1FTPA 1SRHA 1RXKA 3RWXA 3CQRA 4HPDA 4Z27A 3AKMA 1ZNHA 1X8UA 2BS6A 2C4IA 4YDBA 5F58A 2BC3A 2GTLN 1MM9A 1QY0A 3I17A 5D48A 3DTQA 3FR4A 1STSB 1OBPA 2X45A 1MX8A 3B2HA 5F6ZA 3C77X 4AYHA 4N7DA 5C0NA 4TKBA 1KQWA 2BHVA 1KT6A 1SRGA 1VPRA 1LCVA 1YIVA 3BLGA 2RTFB 3CWKA 3I0AA 4MEEA 3F8AA 3TZSA 1L6MA 3FW4A 2FKGA 1HMTA 1VWBB 1FE3A 1N0SA 1SWRA 1BWYA 4I3BA 4RUUA 4Z28A 2RTPB 1GXAA 3D97A 1DF3A 3HK1A 4UU2A 2OZQA 3S60A 4EDEA 4MVEA 3WJBA 3U0DA 4QZUA 1S7DA 2WQAE 4ORRA 3EC5A 4GJVA 4OS8A 5HBSA 1YWBA 4D6BA 3FLLA 5LJDA 5AJBA 5IRAA 1JMXA 4NLJA 1EPBA 2NNDA 1DV9A 3BU1A 1KT3A 5FAZA 1UYOX 5HZ6A 3WZQA 3VHHA 1IFBA 1XKIA 2OVSA 5AQ6A 3WVMA 3HOLA 4ORXA 2MF6A 4ZCBA 3RDXA 1GX8A 2VDFA 4KH8A 3APXA 3P6EA 5F2BA 1QFTA 4GH7A 3EYCA 2DJGA 4IBAA 1SWJA 4TQ2A 2FR3A 2L5PA 2NP1A 3PH5A 1H91A 4O49A 3ZI8A 4CSBA 1GKAB 1VWKB 2RD7C 2OVEA 3DSZA 1KQXA 1N9MA 1X8PA 5LKEA 1JJJA 1RSTB 4IB9A 5LJCA 4XMGA 3N91A 4QGVA 2E4JA 2NNQA 4BX6B 4ORSA 1HBPA 1G74A 1VWQB 3RY2A 3LTWA 1PTSA 3ELZA 2C1QA 2F01A 1SWAA 4KC7A 4OS3A 4UU3A 1SXWA 2IZJA 2R74A 2RTDB 2WQ9A 3CQNA 2KW1A 1RSUB 2HYSA 3FR5A 2N93A 3HWGA 3NP1A 3PP6A 4HPBA 1STPA 5LJBA 4A60A 2K62A 4ORUA 3VPJE 1KL3A 3B2IA 4FBVA 4HPAA 5EDCA 4Z6JA 2RTEB 2WR6A 2MWHA 4ZJ0A 1O8VA 1SLEB 2IZAA 3STNA 2IZLB 1I06A 4ZHFA 5AEOA 1GX3A 4CPHA 5BVTA 2PY1A 2GTFX 2RTBB 2JN3A 3LHNA 1YP7A 5HZ5A 2AT8X 2LA7A 1D2UA 2FLJA 1DF8A 4CDDA 2YMSA 2X4MA 1VWPB 1VYGA 1EALA 3QQ2A 4FBOA 2OY8A 2CM4A 3NR3A 2JGSA 5HCEC 1MX7A 2X32A 4ARHA 1MK5A 2IZCB 1SWHA 2WWPA 5D4AA 1VWOB 3BX8A 3NQ3A 1LCZA 3F6ZB 1IKEA 1TOWA 4KT5A 1ZNEA 1K3BA 3BDRA 1VWNB 3KVNA 5BVQA 2X55A 1P6PA 3KFHA 1N4JA 3P6FA 4O3XB 4U3QA 5B5GA 3ZW0A 1WUBA 1K24A 1YWCA 3MM0A 2QCBA 4BJ8A 4CV7A 3VG4A 4IRWA 1RXHA 2F73A 4LQZA 1XCAA 3APWA 1OSPO 4I95A 1SWBA 2IZDB 4M6SA 4MVLA 1GT1A 4ODDA 2DJFA 4O3ZA 4TNNA 5EZ2A 5LJEA 1WBIA 4DQ4A 2A2UA 1EIOA 5HA0A 1U0XA 4Y0QA 4OELA 1BLRA 4I60A 2NNEA 3FA6A 1SWOA 1VYOA 4TJZA 2RTRB 5HA1A 4NYRA 3KFGA 4YVBA 3VG6A 1ZNKA 2AL0X 2RTCB 3FENA 4YGGA 1GT3A 1VWHB 2KD2A 1JV4A 2MHDA 3WJFA 3TF6A 2RQ0A 2FHNX 2Q39A 1I4UA 2LBVA 2AT6X 3MG5A 3PECA 4IB6A 2L9CA 4U9CA 5B5FA 4ALOA 1FDQA 2AT3X 4GRJA 5BVSA 1N43A 3NQKA 1SY3A 1YP6A 1VWJB 2A8GA 1BBPA 4IMNA 4IAWA 3SLTA 4HWMA 4OEMA 4Y0RA 4YMYA 2RTQB 1CBRA 4IMOA 3CKGA 3QKGA 4FGIB 3VE1A 4YKMA 1BSYA 1KT5A 4ON1A 1X89A 2OYBO 2KT4B 1QQSA 2QO4A 1O1UA 1X8QA 1ZNGA 2HLVA 3NPOA 1UZ2X 2JU3A 2QM9A 4A1HA 4MISA 4YCHA 1X8NA 3O19A 3MBTA 4MVKA 5D47A 3SZJA 2QOMA 3SOTA 1VWLB 1MVGA 1SWFA 3SLJA 5KIDA 1N9YA 3MX7A 4YKOA 1Y9LA 4NNSA 4U8UO 4QQ1A 3S5VA 2R73A 2OFAA 4CPHB 4A1YA 3FEKA 3SZHA 1HXLA 2IZKA 5F6BA 1W6FA 4A8ZA 1D3SA 2G79A 1LF7A 4BX5A 1SWDA 2OL6O 2C1SA 4YH0A 3HTYA 4AZNA 2RTAA 4M7MA 2IZFB 1ACDA 1KL5A 1W5RA 1QABE 1GT5A 2M4LA 4ALBA 3RSWA 3RE5A 3FA7A 3TGCA 2GJ5A 1SA8A 3FIDA 3HWFA 1O1VA 1SWEA 4BX7A 2AMMX 4ZH6A 3P6GA 4I3DA 3EBKA 4GGTA 2ACPX 3WXQA 1BEBA 4LZVA 2RTJA 5HWZA 3D95A 5B11O 1T68X 5FQ8E 4L3RA 4O4OA 5CSEA 3GAQA 3ZW0B 1OBQA 2OY5O 5CE4A 1EQDA 4LKPA 1LELA 2WEXA 4O3YA 4WFUA 4L1NA 1BSQA 2MJIA 1HQQA 2WEWA 2JMBA 4TKJA 1VWGB 1LIBA 5L3YA 1QY2A 1FEMA 3NADA 3VGWA 3RDOA 3WJGA 4I3CA 4LKTA 1SWKA 5HZQA 4CPIA 1TVQA 3FR2A 2WUTA 4EEJA 5JR8A 1X71A 2FWVA 4GZVA 4QZTA 5EDBA 5H8TA 4EXZA 2RTOB 1VWCB 3T2WA 1SREA 4MVIA 2OY1O 3NX1A 4ZR2A 4EKVA 3APVA 4CPFA 5KICA 2FS6A 4INNA 3ZW2A 3RKGA 3VHIA 3U03A 1SXYA 1QWDA 1EXSA 1E5PA 5B3MO 3VG7A 1YUPA 1BJ7A 2CM9A 2KTDA 1KFFA 1EI5A 3LV4A 3P6CA 4FQBB 4WBKA 4XMDA 2QO5A 2RTGB 1CBQA 3RZYA 2BLGA 2OY7A 4O3WA 2BT9A 3EMMA 3SLOA 4QYNA 1DZKA 1LFOA 1SLGB 3OJYC 4Y59A 4CK4A 2FKJA 1Y55X 2LFOA 2L68A 3STKA 1MEPA 1SWTA 3RDQA 3ZW1A 4AZMA 4QNIA 1DC9A 1HQPA 4GUZA 2Z4HA 2JOZA 1JYDA 4KIIA 4IABA 5H9LA 1LICA 2JW1A 1GT4A 4IAXA 5LJKA 3NBXX 4Z2OA 3B2KA 4BX5B 4U8UM 2G7BA 4YBPA 4OMXA 1BRPA 1I05A 1RAVA 4YDAA 1KT7A 2ACOA 4BOEA 4QRLA 4I9SA 1ZNLA 1RLBE 4Z2PA 5D8JA 1BM5A 4XMHA 1U17A 3JSQA 1HMSA 1JJXA 2XSTA 4R0BA 5HZ9A 5L8NA 4BX7B 1Y53X 2CZUA 1TW4A 3FA8A 1FJ1E 5LKFA 1ERBA 4C5PA 1OEEA 1Z24A 1E02A 3HWDA 4Y0PA 1SWPA 2DM5A 1FENA 5HCCC 4PSQA 4OS0A 4ORYA 1SLFB 3VG5A 2FT9A 3Q6LA 5JD2A 5HZ8A 2IZIA 5KHPA 1PMPA 5L8IA 5H9KA 1VWIB 2AT5X 4CPEA 4ZHHA 4RUNA 1NGLA 4GETA 1KGLA 3EW1A 1HXZA 3H3IA 1B56A 3CR6A 2Q4NA 2A13A 3O2YA 1AB0A 3KZAA 1DZJA 4NV7A 5B2AO 3CMPA 3ZWEA 4CDEA 3VG2A 1G5WA 5B29A 4WHIA 3HOEA 3CKFA 4D6AA 4EFGA 1DFVA 1PBYA 2FGSA 2FR2A 1EPAA 2OVAA 4O9SA 5K06A 2OF8A 4GK9A 1NQNA 1MDCA 3AUMO 1JJUA 1NDJA 2X8SA 3P6HA 3WZOA 5IO6A 2I5ZO 1EIIA 1SWGA 4ZFXA 2AF5A 2ASNX 4YFRA 1VWDB 4TLJA 1G7NA 2AH7X 2Z4IA 3D9WA 2MO5A 5FFHA 3D4RA 3P24A 1GM6A 3Q34A 5H9AA 4U46A 3WJEA 4IB8A 2RCQA 4KCAA 3IFBA 2PI3O 3FW5A 2WSJA 3ELXA 4GJSA 2IZBA 1JZUA 2AKQA 2KTSA 4IB7A 3EBWA 3ZUIA 1VWFB 2QOSC 2Y3FA 2QO6A 5HTEA 3V8UA 5HCDC 3T6FA 4Y0SA 3C76X 3EM0A 3ZW1B 5L8OA 1VWEB 3GE2A 1T8VA 1I9HA 1QY1A 4NLIA 4NW4A 3FELA 3UEVA 1A3YA 1SWSA 2OFRX 4JGLA 2X56A 4OKAA 4ORWA 1AVEA 2UYWA 4QAEA 5DG4A 1I04A 2Q9SA 4Y5DA 4GDAA 4YFQA 5IXGA 4GKCA 1OPBA 1LDQA 4XMFA 1SY0A 4QGXA 2FS7A 2W2AA 4NP1A 4QYPA 5B10O 1TOUA 2L67A 5K68A 1HMRA 1GGLA 1A2DA 2F09A 3PQSA 4GGZA 2P8GA 4YGHA 3VE2A 4YFPA 5B27A 1IJ8A 1LPJA 1AELA 1HY2A 3VU1A 2RTLA 1ZRYA
chains in the Genus database with same CATH topology
1SXUA 2LBAA 5LJHA 3K3LA 1B4MA 2X46A 1HN2A 2CBRA 4BVMA 2XKLA 3D96A 4NNTA 5D45A 4ZGFA 4XMEA 3WBGA 1KT4A 1SY1A 2K23A 2W2FA 3IA8A 3UEUA 2OVDA 1CBIA 5F7GA 1B8EA 1SY2A 4ZHCA 2RCTA 2CZTA 3PH6A 4ZGUA 5IO5A 1JYJA 2GTLO 5CYBA 3PEDA 4YBUA 4K19A 4TKHA 5AJCA 1TXLA 3HWEA 1JIWI 3P6DA 3O22A 1YWDA 2A0AA 1R0UA 5FQ7E 3F9DA 2JU8A 1ICMA 4ML7B 1A18A 2Q2MA 4HPCA 3UAQA 3OE3A 4COTA 2Q2PA 3RBYA 1GX9A 2ALLX 1OPAA 4I9RA 3BY0A 4BQUA 4QGWA 1LKEA 3CBSA 4AZOA 4AZRA 1CJ5A 3ZZVA 1DZMA 3APUA 1KZXA 1ML7A 1Y9TA 2A2GA 3BU9A 2ZAGA 4WFVA 3TGBA 3BS2A 2GC9A 4LZUA 3MVFA 1T0VA 2AT0X 2CBSA 3S5XA 3VG3A 3KFFA 2W2BA 3UEWA 5HAEA 1EW3A 3SAOA 4PJ2A 3OBLA 1PBOA 2HZRA 1OEJA 2O62A 4ZH9A 3FEPA 1MUPA 2BS5A 4GDZA 3NQ9A 3BSZE 2HMBA 1KOIA 4O4XA 1NP1A 2HZQA 4ES7A 1ADLA 4XMCA 4ZHDA 2EU7X 1A57A 2X8TA 5LJGA 5HTDA 1IIUA 4O4SA 5DPQA 3CBCA 3C78X 3KQ0A 3ZQ3A 1ERXA 1VYFA 3STMX 3FYFA 4GE1A 1CBSA 4YGZA 1E06A 2MM3A 1SMPI 3OD9A 4AW8A 3B2JA 3L4RA 5IO7A 1ZNDA 2RA6A 4GNYA 3ZUOA 3FA9A 4AZQA 4I6SA 1B0OA 2X8FA 1IKJA 1LIFA 1FELA 4ZHGA 4O4UA 1YWAA 3BRNA 3WJDA 2G78A 1LNMA 3FMZA 5F1EA 2QMIA 1ALBA 1ICNA 3S26A 1AQBA 1BRQA 1KZWA 3NX2A 3JQOA 2IFBA 2GTLM 1QFVA 5FQ6E 4GU8A 3U9PC 4FBRA 1IFCA 2A3FX 5EEEA 3WOVA 1U18A 1JBHA 1S2PA 3E3CA 2LB6A 4MIRA 1NP4A 1X8OA 4KC8A 1PM1X 4U8UN 1E00A 2ANSA 5BYPA 1LIDA 4OMWA 4YCEA 3BX7A 2FTBA 3PPTA 3TGAA 4NYQA 1EUOA 2POAA 2R56A 3JS1A 4N7CA 1GKAA 1RBPA 3PQUA 1BSOA 1QG5A 1LIEA 1UREA 4EQAC 1IW2A 2LKKA 2YG2A 3T1DA 2FRSA 5EPQA 2RN4A 2ZAIA 3KFIA 1HBQA 1KXOA 2JU7A 5EEDA 4DQ3A 3AKNA 2HNXA 5H9NA 1OEKA 2OFMX 3FIQA 1DZPA 1SXXA 4AZPA 4GNWA 3WJCA 4HFOA 3P02A 1S44A 1G85A 3B2LA 3UEXA 5FENA 1AVGI 1CRBA 4ID2A 1OBUA 3G7XA 1FTPA 3RWXA 3CQRA 4HPDA 3AKMA 1ZNHA 1X8UA 2BS6A 4YDBA 5F58A 2GTLN 1QY0A 3I17A 5D48A 3DTQA 3FR4A 5HA1A 1OBPA 2X45A 1MX8A 3B2HA 5F6ZA 3C77X 4AYHA 4N7DA 5C0NA 4TKBA 1KQWA 2BHVA 1KT6A 1VPRA 3CWKA 1YIVA 3BLGA 3I0AA 3F8AA 3TZSA 1L6MA 3FW4A 1HMTA 1FE3A 1N0SA 1BWYA 4I3BA 4RUUA 1GXAA 3D97A 1DF3A 3HK1A 4UU2A 2OZQA 3S60A 4EDEA 4MVEA 3WJBA 3U0DA 4QZUA 1S7DA 2WQAE 4ORRA 4OS8A 5HBSA 1YWBA 4D6BA 3FLLA 5LJDA 5AJBA 4NLJA 1EPBA 2NNDA 1DV9A 3BU1A 1KT3A 5FAZA 5HZ6A 1IFBA 1XKIA 2OVSA 5AQ6A 3WVMA 3HOLA 4ORXA 4ZCBA 1GX8A 4KH8A 3APXA 3P6EA 1QFTA 4GH7A 3EYCA 4IBAA 4TQ2A 2FR3A 2L5PA 2NP1A 3PH5A 1H91A 4O49A 3ZI8A 4CSBA 1GKAB 3DSZA 2RD7C 2OVEA 5LKEA 1KQXA 1X8PA 1JJJA 4IB9A 5LJCA 4XMGA 3N91A 4QGVA 2E4JA 2NNQA 1HBPA 1G74A 4UU3A 3ELZA 4KC7A 4OS3A 1SXWA 2R74A 3CQNA 2WQ9A 3FR5A 3HWGA 2KW1A 2HYSA 4ORSA 3NP1A 2N93A 3PP6A 4HPBA 5LJBA 4A60A 2K62A 4ORUA 3VPJE 3B2IA 4FBVA 4HPAA 5EDCA 2WR6A 4ZJ0A 2MWHA 1O8VA 4ZHFA 3STNA 5AEOA 1I06A 5BVTA 2PY1A 2GTFX 2JN3A 3LHNA 1YP7A 5HZ5A 2LA7A 2AT8X 1D2UA 2FLJA 2YMSA 1VYGA 1EALA 4FBOA 2CM4A 3NR3A 5HCEC 1MX7A 4ARHA 2WWPA 5D4AA 3NQ3A 3BX8A 3F6ZB 1IKEA 1TOWA 4KT5A 1ZNEA 3BDRA 5BVQA 1P6PA 3KFHA 4O3XB 3P6FA 4U3QA 3ZW0A 1YWCA 4CV7A 3VG4A 2F73A 4LQZA 1XCAA 3APWA 4I95A 4M6SA 4MVLA 4ODDA 1GT1A 5EZ2A 5LJEA 4O3ZA 4TNNA 4DQ4A 2A2UA 1EIOA 5HA0A 1U0XA 4Y0QA 1BLRA 2NNEA 3FA6A 4TJZA 4NYRA 3KFGA 3VG6A 1ZNKA 2AL0X 3FENA 4YGGA 1GT3A 2KD2A 2MHDA 1JV4A 3WJFA 3TF6A 2RQ0A 2LBVA 2Q39A 1I4UA 2AT6X 3PECA 4IB6A 4U9CA 2L9CA 4ALOA 1FDQA 2AT3X 4GRJA 5BVSA 3SOTA 3NQKA 1SY3A 1YP6A 4IMNA 1BBPA 4IAWA 4HWMA 4Y0RA 4YMYA 1CBRA 4IMOA 3QKGA 4FGIB 3VE1A 4YKMA 1BSYA 1KT5A 4ON1A 1X89A 2KT4B 1QQSA 2QO4A 1O1UA 1X8QA 1ZNGA 2HLVA 3NPOA 1UZ2X 2JU3A 2QM9A 4A1HA 4MISA 4YCHA 1X8NA 3O19A 3MBTA 4MVKA 5D47A 1MVGA 5KIDA 3MX7A 4YKOA 1Y9LA 4NNSA 4U8UO 4QQ1A 3S5VA 2R73A 4A1YA 3FEKA 5F6BA 4A8ZA 1D3SA 2G79A 1LF7A 4YH0A 3HTYA 4AZNA 4M7MA 1ACDA 1QABE 1GT5A 2M4LA 4ALBA 3RSWA 3FA7A 3TGCA 2GJ5A 1SA8A 3HWFA 1O1VA 2AMMX 4ZH6A 3P6GA 4I3DA 3EBKA 2ACPX 3WXQA 1BEBA 4LZVA 5HWZA 3D95A 1T68X 5FQ8E 4L3RA 4O4OA 3GAQA 3ZW0B 1OBQA 5CE4A 1EQDA 4LKPA 2WEXA 4O3YA 4WFUA 4L1NA 1BSQA 2MJIA 4TKJA 2WEWA 2JMBA 1LIBA 1QY2A 1FEMA 3NADA 3WJGA 4I3CA 4LKTA 5HZQA 1TVQA 3FR2A 2WUTA 4EEJA 5JR8A 1X71A 2FWVA 4GZVA 4QZTA 5EDBA 5H8TA 4EXZA 4MVIA 3NX1A 4ZR2A 5KICA 3APVA 2FS6A 4INNA 3ZW2A 3RKGA 3U03A 1SXYA 1QWDA 1EXSA 1E5PA 3VG7A 1YUPA 2CM9A 1BJ7A 2KTDA 1EI5A 3LV4A 3P6CA 4FQBB 4WBKA 4XMDA 2QO5A 3RZYA 1CBQA 2BLGA 4O3WA 2BT9A 3EMMA 4QYNA 1DZKA 1LFOA 3OJYC 4CK4A 2LFOA 2L68A 3STKA 3ZW1A 4AZMA 4QNIA 1DC9A 1HQPA 2Z4HA 2JOZA 1JYDA 4KIIA 4IABA 5H9LA 1LICA 2JW1A 1GT4A 4IAXA 5LJKA 3NBXX 3B2KA 4U8UM 2G7BA 4YBPA 4OMXA 1BRPA 1I05A 4YDAA 1KT7A 2ACOA 4BOEA 4QRLA 4I9SA 1ZNLA 1RLBE 5D8JA 1BM5A 4XMHA 1U17A 3JSQA 1HMSA 1JJXA 2XSTA 4R0BA 5HZ9A 5L8NA 2CZUA 1TW4A 3FA8A 5LKFA 1ERBA 1OEEA 1Z24A 1E02A 3HWDA 4Y0PA 2DM5A 1FENA 5HCCC 4PSQA 4OS0A 4ORYA 3VG5A 2FT9A 3Q6LA 5HZ8A 5KHPA 1PMPA 5L8IA 5H9KA 2AT5X 4ZHHA 4RUNA 1NGLA 4GETA 1KGLA 3O2YA 3H3IA 1B56A 3CR6A 2Q4NA 2A13A 1PEEA 1AB0A 3KZAA 1DZJA 3ZWEA 3CMPA 3VG2A 1G5WA 5B29A 4WHIA 3HOEA 4D6AA 4EFGA 1DFVA 2FR2A 1EPAA 2OVAA 4O9SA 5K06A 4GK9A 1MDCA 5IO6A 3P6HA 2X8SA 1EIIA 4ZFXA 2ASNX 4YFRA 4TLJA 1G7NA 2AH7X 2Z4IA 5H9AA 2MO5A 5FFHA 3D4RA 3P24A 1GM6A 3WJEA 4IB8A 2RCQA 4KCAA 3IFBA 3FW5A 2WSJA 3ELXA 1JZUA 2AKQA 2KTSA 4IB7A 3EBWA 3ZUIA 2QOSC 5HTEA 3V8UA 2QO6A 5HCDC 4Y0SA 3C76X 3EM0A 3ZW1B 5L8OA 3GE2A 1T8VA 1QY1A 4NLIA 4NW4A 3FELA 3UEVA 1A3YA 2OFRX 4ORWA 4JGLA 5DG4A 4QAEA 1I04A 2Q9SA 4YFQA 4GKCA 1OPBA 4XMFA 1SY0A 4QGXA 2FS7A 2W2AA 4NP1A 4QYPA 1TOUA 2L67A 1HMRA 1GGLA 1A2DA 2F09A 3PQSA 4YGHA 2P8GA 3VE2A 4YFPA 5B27A 1LPJA 1AELA 3VU1A 1ZRYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y9T A;  2JW1 A;  1Y9L A; 
#chains in the Genus database with same CATH topology
 1SXU A;  2LBA A;  5LJH A;  3K3L A;  1B4M A;  5IRW A;  2X46 A;  3WZN A;  1HN2 A;  2CBR A;  4BVM A;  2XKL A;  3D96 A;  4NNT A;  5D45 A;  4ZGF A;  4XME A;  3WBG A;  1KT4 A;  1SY1 A;  2K23 A;  2W2F A;  3IA8 A;  3UEU A;  2OVD A;  1CBI A;  2OL8 O;  5F7G A;  2IZG B;  1B8E A;  1SY2 A;  4GGR A;  3RDS A;  2RCT A;  2CZT A;  4ZHC A;  1W4T A;  3PH6 A;  4ZGU A;  5IO5 A;  1JYJ A;  2GTL O;  2RTM A;  5CYB A;  3PED A;  4YBU A;  4K19 A;  4TKH A;  5AJC A;  1TXL A;  2VFB A;  3HWE A;  1JIW I;  3P6D A;  3HPE A;  3O22 A;  2ZSC A;  1YWD A;  2A0A A;  1R0U A;  5FQ7 E;  4BBO A;  2A5B A;  2BSZ A;  2JU8 A;  1LDO A;  1ICM A;  3F9D A;  1A18 A;  2Q2M A;  2WPU A;  4HPC A;  4ML7 B;  3OE3 A;  3UAQ A;  4COT A;  3RDM A;  2Q2P A;  3RBY A;  1NC9 A;  1RXJ A;  1Y52 X;  1GX9 A;  2ALL X;  1OPA A;  4I9R A;  4CDF A;  3BY0 A;  4BQU A;  2X34 A;  3WZP A;  4QGW A;  1Y0G A;  1LKE A;  3CBS A;  4AZO A;  4AZR A;  3WYP A;  1CJ5 A;  3ZZV A;  4JNJ A;  1E2T A;  1JQP A;  1DZM A;  3APU A;  1I78 A;  2IZE B;  1KZX A;  1ML7 A;  1SWL A;  1Y9T A;  2A2G A;  2ZAG A;  3BU9 A;  4WFV A;  2G8C O;  3BS2 A;  2GC9 A;  4LZU A;  3TGB A;  3MVF A;  1T0V A;  1VWR B;  2AT0 X;  2A5C A;  2CBS A;  2GH7 A;  3S5X A;  1UYN X;  2RTK A;  3FDC A;  3VG3 A;  1SWQ A;  3KFF A;  2W2B A;  3UEW A;  4JO6 A;  3RY1 A;  5HAE A;  1EW3 A;  1LUQ A;  3SAO A;  4PJ2 A;  2VFC A;  3OBL A;  1PBO A;  2HZR A;  1OEJ A;  2O62 A;  4ZH9 A;  3FEP A;  1PEE A;  1MUP A;  2BS5 A;  2Y3E A;  4GDZ A;  3NQ9 A;  3BSZ E;  2FHL A;  2HMB A;  1KOI A;  4BGF A;  4O4X A;  1AVD A;  1NP1 A;  2CAM A;  2HZQ A;  1ADL A;  4XMC A;  4ES7 A;  2EU7 X;  4ZHD A;  1A57 A;  2IZH B;  4DNE A;  2X8T A;  5LJG A;  5HTD A;  2I5V O;  1NBX A;  5CHK A;  1IIU A;  2HKD A;  4O4S A;  5DPQ A;  2Y32 A;  3CBC A;  3RDU A;  3C78 X;  3KQ0 A;  3ZQ3 A;  1ERX A;  1VYF A;  3STM X;  3FYF A;  4GE1 A;  3AEH A;  1CBS A;  4YGZ A;  1NQM A;  1E06 A;  2MM3 A;  4BCS A;  1SMP I;  3OD9 A;  4GD9 A;  4AW8 A;  3B2J A;  3L4R A;  3SZI A;  3T2X A;  5IO7 A;  1SWC A;  1ZND A;  2RA6 A;  4GNY A;  1JMZ A;  3FA9 A;  3ZUO A;  4AZQ A;  4I6S A;  1B0O A;  2X8F A;  1IKJ A;  1LIF A;  1FEL A;  1SLD B;  4ZHG A;  4O4U A;  1YWA A;  3BRN A;  3WJD A;  4Z2V A;  2G78 A;  1LNM A;  1MOY A;  3FMZ A;  2QMI A;  5F1E A;  1ALB A;  1ICN A;  3EW2 A;  3S26 A;  1AQB A;  3RE6 A;  2RTH B;  1BRQ A;  1VWA B;  1VWM B;  2AVI A;  1KZW A;  3NX2 A;  3JQO A;  2IFB A;  2GTL M;  1QFV A;  5FQ6 E;  1SRI A;  4GU8 A;  3U9P C;  4FBR A;  1IFC A;  1N7Y A;  2A3F X;  3PK2 A;  1U18 A;  5EEE A;  3WOV A;  1STR B;  4CDC A;  1JBH A;  1S2P A;  3E3C A;  2OFB A;  2LB6 A;  4MIR A;  1NP4 A;  1SWU A;  1X8O A;  4KC8 A;  1PM1 X;  4U8U N;  4DCB A;  1E00 A;  2ANS A;  2OL7 A;  1LID A;  5BYP A;  4OMW A;  3PDF A;  4YCE A;  3BX7 A;  2FTB A;  3PPT A;  5IRU A;  3TGA A;  4NYQ A;  1EUO A;  2POA A;  2R56 A;  1SRJ A;  3T6L A;  1LCW A;  2RTN B;  3WYQ A;  3JS1 A;  4N7C A;  1GKA A;  1RBP A;  3PQU A;  1BSO A;  1QG5 A;  1LIE A;  1URE A;  4EQA C;  4NV8 A;  1IW2 A;  2LKK A;  1SWN A;  2YG2 A;  3T1D A;  2FRS A;  5EPQ A;  2RN4 A;  2ZAI A;  3KFI A;  1HBQ A;  1KXO A;  2G5L A;  2JU7 A;  5EED A;  3AKN A;  4BX6 A;  2UZ2 A;  2HNX A;  3X00 A;  4DQ3 A;  3VHM A;  5H9N A;  1OEK A;  2OFM X;  2RTI B;  3FIQ A;  2OF9 A;  1DZP A;  4B55 A;  1SXX A;  4AZP A;  4GNW A;  3WJC A;  4HFO A;  3P02 A;  1S44 A;  1G85 A;  5K67 A;  1SRF A;  3B2L A;  3UEX A;  5FEN A;  1AVG I;  1CRB A;  4ID2 A;  4JHQ A;  1KL4 A;  1OBU A;  3G7X A;  1FTP A;  1SRH A;  1RXK A;  3RWX A;  3CQR A;  4HPD A;  4Z27 A;  3AKM A;  1ZNH A;  1X8U A;  2BS6 A;  2C4I A;  4YDB A;  5F58 A;  2BC3 A;  2GTL N;  1MM9 A;  1QY0 A;  3I17 A;  5D48 A;  3DTQ A;  3FR4 A;  1STS B;  1OBP A;  2X45 A;  1MX8 A;  3B2H A;  5F6Z A;  3C77 X;  4AYH A;  4N7D A;  5C0N A;  4TKB A;  1KQW A;  2BHV A;  1KT6 A;  1SRG A;  1VPR A;  1LCV A;  1YIV A;  3BLG A;  2RTF B;  3CWK A;  3I0A A;  4MEE A;  3F8A A;  3TZS A;  1L6M A;  3FW4 A;  2FKG A;  1HMT A;  1VWB B;  1FE3 A;  1N0S A;  1SWR A;  1BWY A;  4I3B A;  4RUU A;  4Z28 A;  2RTP B;  1GXA A;  3D97 A;  1DF3 A;  3HK1 A;  4UU2 A;  2OZQ A;  3S60 A;  4EDE A;  4MVE A;  3WJB A;  3U0D A;  4QZU A;  1S7D A;  2WQA E;  4ORR A;  3EC5 A;  4GJV A;  4OS8 A;  5HBS A;  1YWB A;  4D6B A;  3FLL A;  5LJD A;  5AJB A;  5IRA A;  1JMX A;  4NLJ A;  1EPB A;  2NND A;  1DV9 A;  3BU1 A;  1KT3 A;  5FAZ A;  1UYO X;  5HZ6 A;  3WZQ A;  3VHH A;  1IFB A;  1XKI A;  2OVS A;  5AQ6 A;  3WVM A;  3HOL A;  4ORX A;  2MF6 A;  4ZCB A;  3RDX A;  1GX8 A;  2VDF A;  4KH8 A;  3APX A;  3P6E A;  5F2B A;  1QFT A;  4GH7 A;  3EYC A;  2DJG A;  4IBA A;  1SWJ A;  4TQ2 A;  2FR3 A;  2L5P A;  2NP1 A;  3PH5 A;  1H91 A;  4O49 A;  3ZI8 A;  4CSB A;  1GKA B;  1VWK B;  2RD7 C;  2OVE A;  3DSZ A;  1KQX A;  1N9M A;  1X8P A;  5LKE A;  1JJJ A;  1RST B;  4IB9 A;  5LJC A;  4XMG A;  3N91 A;  4QGV A;  2E4J A;  2NNQ A;  4BX6 B;  4ORS A;  1HBP A;  1G74 A;  1VWQ B;  3RY2 A;  3LTW A;  1PTS A;  3ELZ A;  2C1Q A;  2F01 A;  1SWA A;  4KC7 A;  4OS3 A;  4UU3 A;  1SXW A;  2IZJ A;  2R74 A;  2RTD B;  2WQ9 A;  3CQN A;  2KW1 A;  1RSU B;  2HYS A;  3FR5 A;  2N93 A;  3HWG A;  3NP1 A;  3PP6 A;  4HPB A;  1STP A;  5LJB A;  4A60 A;  2K62 A;  4ORU A;  3VPJ E;  1KL3 A;  3B2I A;  4FBV A;  4HPA A;  5EDC A;  4Z6J A;  2RTE B;  2WR6 A;  2MWH A;  4ZJ0 A;  1O8V A;  1SLE B;  2IZA A;  3STN A;  2IZL B;  1I06 A;  4ZHF A;  5AEO A;  1GX3 A;  4CPH A;  5BVT A;  2PY1 A;  2GTF X;  2RTB B;  2JN3 A;  3LHN A;  1YP7 A;  5HZ5 A;  2AT8 X;  2LA7 A;  1D2U A;  2FLJ A;  1DF8 A;  4CDD A;  2YMS A;  2X4M A;  1VWP B;  1VYG A;  1EAL A;  3QQ2 A;  4FBO A;  2OY8 A;  2CM4 A;  3NR3 A;  2JGS A;  5HCE C;  1MX7 A;  2X32 A;  4ARH A;  1MK5 A;  2IZC B;  1SWH A;  2WWP A;  5D4A A;  1VWO B;  3BX8 A;  3NQ3 A;  1LCZ A;  3F6Z B;  1IKE A;  1TOW A;  4KT5 A;  1ZNE A;  1K3B A;  3BDR A;  1VWN B;  3KVN A;  5BVQ A;  2X55 A;  1P6P A;  3KFH A;  1N4J A;  3P6F A;  4O3X B;  4U3Q A;  5B5G A;  3ZW0 A;  1WUB A;  1K24 A;  1YWC A;  3MM0 A;  2QCB A;  4BJ8 A;  4CV7 A;  3VG4 A;  4IRW A;  1RXH A;  2F73 A;  4LQZ A;  1XCA A;  3APW A;  1OSP O;  4I95 A;  1SWB A;  2IZD B;  4M6S A;  4MVL A;  1GT1 A;  4ODD A;  2DJF A;  4O3Z A;  4TNN A;  5EZ2 A;  5LJE A;  1WBI A;  4DQ4 A;  2A2U A;  1EIO A;  5HA0 A;  1U0X A;  4Y0Q A;  4OEL A;  1BLR A;  4I60 A;  2NNE A;  3FA6 A;  1SWO A;  1VYO A;  4TJZ A;  2RTR B;  5HA1 A;  4NYR A;  3KFG A;  4YVB A;  3VG6 A;  1ZNK A;  2AL0 X;  2RTC B;  3FEN A;  4YGG A;  1GT3 A;  1VWH B;  2KD2 A;  1JV4 A;  2MHD A;  3WJF A;  3TF6 A;  2RQ0 A;  2FHN X;  2Q39 A;  1I4U A;  2LBV A;  2AT6 X;  3MG5 A;  3PEC A;  4IB6 A;  2L9C A;  4U9C A;  5B5F A;  4ALO A;  1FDQ A;  2AT3 X;  4GRJ A;  5BVS A;  1N43 A;  3NQK A;  1SY3 A;  1YP6 A;  1VWJ B;  2A8G A;  1BBP A;  4IMN A;  4IAW A;  3SLT A;  4HWM A;  4OEM A;  4Y0R A;  4YMY A;  2RTQ B;  1CBR A;  4IMO A;  3CKG A;  3QKG A;  4FGI B;  3VE1 A;  4YKM A;  1BSY A;  1KT5 A;  4ON1 A;  1X89 A;  2OYB O;  2KT4 B;  1QQS A;  2QO4 A;  1O1U A;  1X8Q A;  1ZNG A;  2HLV A;  3NPO A;  1UZ2 X;  2JU3 A;  2QM9 A;  4A1H A;  4MIS A;  4YCH A;  1X8N A;  3O19 A;  3MBT A;  4MVK A;  5D47 A;  3SZJ A;  2QOM A;  3SOT A;  1VWL B;  1MVG A;  1SWF A;  3SLJ A;  5KID A;  1N9Y A;  3MX7 A;  4YKO A;  1Y9L A;  4NNS A;  4U8U O;  4QQ1 A;  3S5V A;  2R73 A;  2OFA A;  4CPH B;  4A1Y A;  3FEK A;  3SZH A;  1HXL A;  2IZK A;  5F6B A;  1W6F A;  4A8Z A;  1D3S A;  2G79 A;  1LF7 A;  4BX5 A;  1SWD A;  2OL6 O;  2C1S A;  4YH0 A;  3HTY A;  4AZN A;  2RTA A;  4M7M A;  2IZF B;  1ACD A;  1KL5 A;  1W5R A;  1QAB E;  1GT5 A;  2M4L A;  4ALB A;  3RSW A;  3RE5 A;  3FA7 A;  3TGC A;  2GJ5 A;  1SA8 A;  3FID A;  3HWF A;  1O1V A;  1SWE A;  4BX7 A;  2AMM X;  4ZH6 A;  3P6G A;  4I3D A;  3EBK A;  4GGT A;  2ACP X;  3WXQ A;  1BEB A;  4LZV A;  2RTJ A;  5HWZ A;  3D95 A;  5B11 O;  1T68 X;  5FQ8 E;  4L3R A;  4O4O A;  5CSE A;  3GAQ A;  3ZW0 B;  1OBQ A;  2OY5 O;  5CE4 A;  1EQD A;  4LKP A;  1LEL A;  2WEX A;  4O3Y A;  4WFU A;  4L1N A;  1BSQ A;  2MJI A;  1HQQ A;  2WEW A;  2JMB A;  4TKJ A;  1VWG B;  1LIB A;  5L3Y A;  1QY2 A;  1FEM A;  3NAD A;  3VGW A;  3RDO A;  3WJG A;  4I3C A;  4LKT A;  1SWK A;  5HZQ A;  4CPI A;  1TVQ A;  3FR2 A;  2WUT A;  4EEJ A;  5JR8 A;  1X71 A;  2FWV A;  4GZV A;  4QZT A;  5EDB A;  5H8T A;  4EXZ A;  2RTO B;  1VWC B;  3T2W A;  1SRE A;  4MVI A;  2OY1 O;  3NX1 A;  4ZR2 A;  4EKV A;  3APV A;  4CPF A;  5KIC A;  2FS6 A;  4INN A;  3ZW2 A;  3RKG A;  3VHI A;  3U03 A;  1SXY A;  1QWD A;  1EXS A;  1E5P A;  5B3M O;  3VG7 A;  1YUP A;  1BJ7 A;  2CM9 A;  2KTD A;  1KFF A;  1EI5 A;  3LV4 A;  3P6C A;  4FQB B;  4WBK A;  4XMD A;  2QO5 A;  2RTG B;  1CBQ A;  3RZY A;  2BLG A;  2OY7 A;  4O3W A;  2BT9 A;  3EMM A;  3SLO A;  4QYN A;  1DZK A;  1LFO A;  1SLG B;  3OJY C;  4Y59 A;  4CK4 A;  2FKJ A;  1Y55 X;  2LFO A;  2L68 A;  3STK A;  1MEP A;  1SWT A;  3RDQ A;  3ZW1 A;  4AZM A;  4QNI A;  1DC9 A;  1HQP A;  4GUZ A;  2Z4H A;  2JOZ A;  1JYD A;  4KII A;  4IAB A;  5H9L A;  1LIC A;  2JW1 A;  1GT4 A;  4IAX A;  5LJK A;  3NBX X;  4Z2O A;  3B2K A;  4BX5 B;  4U8U M;  2G7B A;  4YBP A;  4OMX A;  1BRP A;  1I05 A;  1RAV A;  4YDA A;  1KT7 A;  2ACO A;  4BOE A;  4QRL A;  4I9S A;  1ZNL A;  1RLB E;  4Z2P A;  5D8J A;  1BM5 A;  4XMH A;  1U17 A;  3JSQ A;  1HMS A;  1JJX A;  2XST A;  4R0B A;  5HZ9 A;  5L8N A;  4BX7 B;  1Y53 X;  2CZU A;  1TW4 A;  3FA8 A;  1FJ1 E;  5LKF A;  1ERB A;  4C5P A;  1OEE A;  1Z24 A;  1E02 A;  3HWD A;  4Y0P A;  1SWP A;  2DM5 A;  1FEN A;  5HCC C;  4PSQ A;  4OS0 A;  4ORY A;  1SLF B;  3VG5 A;  2FT9 A;  3Q6L A;  5JD2 A;  5HZ8 A;  2IZI A;  5KHP A;  1PMP A;  5L8I A;  5H9K A;  1VWI B;  2AT5 X;  4CPE A;  4ZHH A;  4RUN A;  1NGL A;  4GET A;  1KGL A;  3EW1 A;  1HXZ A;  3H3I A;  1B56 A;  3CR6 A;  2Q4N A;  2A13 A;  3O2Y A;  1AB0 A;  3KZA A;  1DZJ A;  4NV7 A;  5B2A O;  3CMP A;  3ZWE A;  4CDE A;  3VG2 A;  1G5W A;  5B29 A;  4WHI A;  3HOE A;  3CKF A;  4D6A A;  4EFG A;  1DFV A;  1PBY A;  2FGS A;  2FR2 A;  1EPA A;  2OVA A;  4O9S A;  5K06 A;  2OF8 A;  4GK9 A;  1NQN A;  1MDC A;  3AUM O;  1JJU A;  1NDJ A;  2X8S A;  3P6H A;  3WZO A;  5IO6 A;  2I5Z O;  1EII A;  1SWG A;  4ZFX A;  2AF5 A;  2ASN X;  4YFR A;  1VWD B;  4TLJ A;  1G7N A;  2AH7 X;  2Z4I A;  3D9W A;  2MO5 A;  5FFH A;  3D4R A;  3P24 A;  1GM6 A;  3Q34 A;  5H9A A;  4U46 A;  3WJE A;  4IB8 A;  2RCQ A;  4KCA A;  3IFB A;  2PI3 O;  3FW5 A;  2WSJ A;  3ELX A;  4GJS A;  2IZB A;  1JZU A;  2AKQ A;  2KTS A;  4IB7 A;  3EBW A;  3ZUI A;  1VWF B;  2QOS C;  2Y3F A;  2QO6 A;  5HTE A;  3V8U A;  5HCD C;  3T6F A;  4Y0S A;  3C76 X;  3EM0 A;  3ZW1 B;  5L8O A;  1VWE B;  3GE2 A;  1T8V A;  1I9H A;  1QY1 A;  4NLI A;  4NW4 A;  3FEL A;  3UEV A;  1A3Y A;  1SWS A;  2OFR X;  4JGL A;  2X56 A;  4OKA A;  4ORW A;  1AVE A;  2UYW A;  4QAE A;  5DG4 A;  1I04 A;  2Q9S A;  4Y5D A;  4GDA A;  4YFQ A;  5IXG A;  4GKC A;  1OPB A;  1LDQ A;  4XMF A;  1SY0 A;  4QGX A;  2FS7 A;  2W2A A;  4NP1 A;  4QYP A;  5B10 O;  1TOU A;  2L67 A;  5K68 A;  1HMR A;  1GGL A;  1A2D A;  2F09 A;  3PQS A;  4GGZ A;  2P8G A;  4YGH A;  3VE2 A;  4YFP A;  5B27 A;  1IJ8 A;  1LPJ A;  1AEL A;  1HY2 A;  3VU1 A;  2RTL A;  1ZRY A; 
#chains in the Genus database with same CATH homology
 1SXU A;  2LBA A;  5LJH A;  3K3L A;  1B4M A;  2X46 A;  1HN2 A;  2CBR A;  4BVM A;  2XKL A;  3D96 A;  4NNT A;  5D45 A;  4ZGF A;  4XME A;  3WBG A;  1KT4 A;  1SY1 A;  2K23 A;  2W2F A;  3IA8 A;  3UEU A;  2OVD A;  1CBI A;  5F7G A;  1B8E A;  1SY2 A;  4ZHC A;  2RCT A;  2CZT A;  3PH6 A;  4ZGU A;  5IO5 A;  1JYJ A;  2GTL O;  5CYB A;  3PED A;  4YBU A;  4K19 A;  4TKH A;  5AJC A;  1TXL A;  3HWE A;  1JIW I;  3P6D A;  3O22 A;  1YWD A;  2A0A A;  1R0U A;  5FQ7 E;  3F9D A;  2JU8 A;  1ICM A;  4ML7 B;  1A18 A;  2Q2M A;  4HPC A;  3UAQ A;  3OE3 A;  4COT A;  2Q2P A;  3RBY A;  1GX9 A;  2ALL X;  1OPA A;  4I9R A;  3BY0 A;  4BQU A;  4QGW A;  1LKE A;  3CBS A;  4AZO A;  4AZR A;  1CJ5 A;  3ZZV A;  1DZM A;  3APU A;  1KZX A;  1ML7 A;  1Y9T A;  2A2G A;  3BU9 A;  2ZAG A;  4WFV A;  3TGB A;  3BS2 A;  2GC9 A;  4LZU A;  3MVF A;  1T0V A;  2AT0 X;  2CBS A;  3S5X A;  3VG3 A;  3KFF A;  2W2B A;  3UEW A;  5HAE A;  1EW3 A;  3SAO A;  4PJ2 A;  3OBL A;  1PBO A;  2HZR A;  1OEJ A;  2O62 A;  4ZH9 A;  3FEP A;  1MUP A;  2BS5 A;  4GDZ A;  3NQ9 A;  3BSZ E;  2HMB A;  1KOI A;  4O4X A;  1NP1 A;  2HZQ A;  4ES7 A;  1ADL A;  4XMC A;  4ZHD A;  2EU7 X;  1A57 A;  2X8T A;  5LJG A;  5HTD A;  1IIU A;  4O4S A;  5DPQ A;  3CBC A;  3C78 X;  3KQ0 A;  3ZQ3 A;  1ERX A;  1VYF A;  3STM X;  3FYF A;  4GE1 A;  1CBS A;  4YGZ A;  1E06 A;  2MM3 A;  1SMP I;  3OD9 A;  4AW8 A;  3B2J A;  3L4R A;  5IO7 A;  1ZND A;  2RA6 A;  4GNY A;  3ZUO A;  3FA9 A;  4AZQ A;  4I6S A;  1B0O A;  2X8F A;  1IKJ A;  1LIF A;  1FEL A;  4ZHG A;  4O4U A;  1YWA A;  3BRN A;  3WJD A;  2G78 A;  1LNM A;  3FMZ A;  5F1E A;  2QMI A;  1ALB A;  1ICN A;  3S26 A;  1AQB A;  1BRQ A;  1KZW A;  3NX2 A;  3JQO A;  2IFB A;  2GTL M;  1QFV A;  5FQ6 E;  4GU8 A;  3U9P C;  4FBR A;  1IFC A;  2A3F X;  5EEE A;  3WOV A;  1U18 A;  1JBH A;  1S2P A;  3E3C A;  2LB6 A;  4MIR A;  1NP4 A;  1X8O A;  4KC8 A;  1PM1 X;  4U8U N;  1E00 A;  2ANS A;  5BYP A;  1LID A;  4OMW A;  4YCE A;  3BX7 A;  2FTB A;  3PPT A;  3TGA A;  4NYQ A;  1EUO A;  2POA A;  2R56 A;  3JS1 A;  4N7C A;  1GKA A;  1RBP A;  3PQU A;  1BSO A;  1QG5 A;  1LIE A;  1URE A;  4EQA C;  1IW2 A;  2LKK A;  2YG2 A;  3T1D A;  2FRS A;  5EPQ A;  2RN4 A;  2ZAI A;  3KFI A;  1HBQ A;  1KXO A;  2JU7 A;  5EED A;  4DQ3 A;  3AKN A;  2HNX A;  5H9N A;  1OEK A;  2OFM X;  3FIQ A;  1DZP A;  1SXX A;  4AZP A;  4GNW A;  3WJC A;  4HFO A;  3P02 A;  1S44 A;  1G85 A;  3B2L A;  3UEX A;  5FEN A;  1AVG I;  1CRB A;  4ID2 A;  1OBU A;  3G7X A;  1FTP A;  3RWX A;  3CQR A;  4HPD A;  3AKM A;  1ZNH A;  1X8U A;  2BS6 A;  4YDB A;  5F58 A;  2GTL N;  1QY0 A;  3I17 A;  5D48 A;  3DTQ A;  3FR4 A;  5HA1 A;  1OBP A;  2X45 A;  1MX8 A;  3B2H A;  5F6Z A;  3C77 X;  4AYH A;  4N7D A;  5C0N A;  4TKB A;  1KQW A;  2BHV A;  1KT6 A;  1VPR A;  3CWK A;  1YIV A;  3BLG A;  3I0A A;  3F8A A;  3TZS A;  1L6M A;  3FW4 A;  1HMT A;  1FE3 A;  1N0S A;  1BWY A;  4I3B A;  4RUU A;  1GXA A;  3D97 A;  1DF3 A;  3HK1 A;  4UU2 A;  2OZQ A;  3S60 A;  4EDE A;  4MVE A;  3WJB A;  3U0D A;  4QZU A;  1S7D A;  2WQA E;  4ORR A;  4OS8 A;  5HBS A;  1YWB A;  4D6B A;  3FLL A;  5LJD A;  5AJB A;  4NLJ A;  1EPB A;  2NND A;  1DV9 A;  3BU1 A;  1KT3 A;  5FAZ A;  5HZ6 A;  1IFB A;  1XKI A;  2OVS A;  5AQ6 A;  3WVM A;  3HOL A;  4ORX A;  4ZCB A;  1GX8 A;  4KH8 A;  3APX A;  3P6E A;  1QFT A;  4GH7 A;  3EYC A;  4IBA A;  4TQ2 A;  2FR3 A;  2L5P A;  2NP1 A;  3PH5 A;  1H91 A;  4O49 A;  3ZI8 A;  4CSB A;  1GKA B;  3DSZ A;  2RD7 C;  2OVE A;  5LKE A;  1KQX A;  1X8P A;  1JJJ A;  4IB9 A;  5LJC A;  4XMG A;  3N91 A;  4QGV A;  2E4J A;  2NNQ A;  1HBP A;  1G74 A;  4UU3 A;  3ELZ A;  4KC7 A;  4OS3 A;  1SXW A;  2R74 A;  3CQN A;  2WQ9 A;  3FR5 A;  3HWG A;  2KW1 A;  2HYS A;  4ORS A;  3NP1 A;  2N93 A;  3PP6 A;  4HPB A;  5LJB A;  4A60 A;  2K62 A;  4ORU A;  3VPJ E;  3B2I A;  4FBV A;  4HPA A;  5EDC A;  2WR6 A;  4ZJ0 A;  2MWH A;  1O8V A;  4ZHF A;  3STN A;  5AEO A;  1I06 A;  5BVT A;  2PY1 A;  2GTF X;  2JN3 A;  3LHN A;  1YP7 A;  5HZ5 A;  2LA7 A;  2AT8 X;  1D2U A;  2FLJ A;  2YMS A;  1VYG A;  1EAL A;  4FBO A;  2CM4 A;  3NR3 A;  5HCE C;  1MX7 A;  4ARH A;  2WWP A;  5D4A A;  3NQ3 A;  3BX8 A;  3F6Z B;  1IKE A;  1TOW A;  4KT5 A;  1ZNE A;  3BDR A;  5BVQ A;  1P6P A;  3KFH A;  4O3X B;  3P6F A;  4U3Q A;  3ZW0 A;  1YWC A;  4CV7 A;  3VG4 A;  2F73 A;  4LQZ A;  1XCA A;  3APW A;  4I95 A;  4M6S A;  4MVL A;  4ODD A;  1GT1 A;  5EZ2 A;  5LJE A;  4O3Z A;  4TNN A;  4DQ4 A;  2A2U A;  1EIO A;  5HA0 A;  1U0X A;  4Y0Q A;  1BLR A;  2NNE A;  3FA6 A;  4TJZ A;  4NYR A;  3KFG A;  3VG6 A;  1ZNK A;  2AL0 X;  3FEN A;  4YGG A;  1GT3 A;  2KD2 A;  2MHD A;  1JV4 A;  3WJF A;  3TF6 A;  2RQ0 A;  2LBV A;  2Q39 A;  1I4U A;  2AT6 X;  3PEC A;  4IB6 A;  4U9C A;  2L9C A;  4ALO A;  1FDQ A;  2AT3 X;  4GRJ A;  5BVS A;  3SOT A;  3NQK A;  1SY3 A;  1YP6 A;  4IMN A;  1BBP A;  4IAW A;  4HWM A;  4Y0R A;  4YMY A;  1CBR A;  4IMO A;  3QKG A;  4FGI B;  3VE1 A;  4YKM A;  1BSY A;  1KT5 A;  4ON1 A;  1X89 A;  2KT4 B;  1QQS A;  2QO4 A;  1O1U A;  1X8Q A;  1ZNG A;  2HLV A;  3NPO A;  1UZ2 X;  2JU3 A;  2QM9 A;  4A1H A;  4MIS A;  4YCH A;  1X8N A;  3O19 A;  3MBT A;  4MVK A;  5D47 A;  1MVG A;  5KID A;  3MX7 A;  4YKO A;  1Y9L A;  4NNS A;  4U8U O;  4QQ1 A;  3S5V A;  2R73 A;  4A1Y A;  3FEK A;  5F6B A;  4A8Z A;  1D3S A;  2G79 A;  1LF7 A;  4YH0 A;  3HTY A;  4AZN A;  4M7M A;  1ACD A;  1QAB E;  1GT5 A;  2M4L A;  4ALB A;  3RSW A;  3FA7 A;  3TGC A;  2GJ5 A;  1SA8 A;  3HWF A;  1O1V A;  2AMM X;  4ZH6 A;  3P6G A;  4I3D A;  3EBK A;  2ACP X;  3WXQ A;  1BEB A;  4LZV A;  5HWZ A;  3D95 A;  1T68 X;  5FQ8 E;  4L3R A;  4O4O A;  3GAQ A;  3ZW0 B;  1OBQ A;  5CE4 A;  1EQD A;  4LKP A;  2WEX A;  4O3Y A;  4WFU A;  4L1N A;  1BSQ A;  2MJI A;  4TKJ A;  2WEW A;  2JMB A;  1LIB A;  1QY2 A;  1FEM A;  3NAD A;  3WJG A;  4I3C A;  4LKT A;  5HZQ A;  1TVQ A;  3FR2 A;  2WUT A;  4EEJ A;  5JR8 A;  1X71 A;  2FWV A;  4GZV A;  4QZT A;  5EDB A;  5H8T A;  4EXZ A;  4MVI A;  3NX1 A;  4ZR2 A;  5KIC A;  3APV A;  2FS6 A;  4INN A;  3ZW2 A;  3RKG A;  3U03 A;  1SXY A;  1QWD A;  1EXS A;  1E5P A;  3VG7 A;  1YUP A;  2CM9 A;  1BJ7 A;  2KTD A;  1EI5 A;  3LV4 A;  3P6C A;  4FQB B;  4WBK A;  4XMD A;  2QO5 A;  3RZY A;  1CBQ A;  2BLG A;  4O3W A;  2BT9 A;  3EMM A;  4QYN A;  1DZK A;  1LFO A;  3OJY C;  4CK4 A;  2LFO A;  2L68 A;  3STK A;  3ZW1 A;  4AZM A;  4QNI A;  1DC9 A;  1HQP A;  2Z4H A;  2JOZ A;  1JYD A;  4KII A;  4IAB A;  5H9L A;  1LIC A;  2JW1 A;  1GT4 A;  4IAX A;  5LJK A;  3NBX X;  3B2K A;  4U8U M;  2G7B A;  4YBP A;  4OMX A;  1BRP A;  1I05 A;  4YDA A;  1KT7 A;  2ACO A;  4BOE A;  4QRL A;  4I9S A;  1ZNL A;  1RLB E;  5D8J A;  1BM5 A;  4XMH A;  1U17 A;  3JSQ A;  1HMS A;  1JJX A;  2XST A;  4R0B A;  5HZ9 A;  5L8N A;  2CZU A;  1TW4 A;  3FA8 A;  5LKF A;  1ERB A;  1OEE A;  1Z24 A;  1E02 A;  3HWD A;  4Y0P A;  2DM5 A;  1FEN A;  5HCC C;  4PSQ A;  4OS0 A;  4ORY A;  3VG5 A;  2FT9 A;  3Q6L A;  5HZ8 A;  5KHP A;  1PMP A;  5L8I A;  5H9K A;  2AT5 X;  4ZHH A;  4RUN A;  1NGL A;  4GET A;  1KGL A;  3O2Y A;  3H3I A;  1B56 A;  3CR6 A;  2Q4N A;  2A13 A;  1PEE A;  1AB0 A;  3KZA A;  1DZJ A;  3ZWE A;  3CMP A;  3VG2 A;  1G5W A;  5B29 A;  4WHI A;  3HOE A;  4D6A A;  4EFG A;  1DFV A;  2FR2 A;  1EPA A;  2OVA A;  4O9S A;  5K06 A;  4GK9 A;  1MDC A;  5IO6 A;  3P6H A;  2X8S A;  1EII A;  4ZFX A;  2ASN X;  4YFR A;  4TLJ A;  1G7N A;  2AH7 X;  2Z4I A;  5H9A A;  2MO5 A;  5FFH A;  3D4R A;  3P24 A;  1GM6 A;  3WJE A;  4IB8 A;  2RCQ A;  4KCA A;  3IFB A;  3FW5 A;  2WSJ A;  3ELX A;  1JZU A;  2AKQ A;  2KTS A;  4IB7 A;  3EBW A;  3ZUI A;  2QOS C;  5HTE A;  3V8U A;  2QO6 A;  5HCD C;  4Y0S A;  3C76 X;  3EM0 A;  3ZW1 B;  5L8O A;  3GE2 A;  1T8V A;  1QY1 A;  4NLI A;  4NW4 A;  3FEL A;  3UEV A;  1A3Y A;  2OFR X;  4ORW A;  4JGL A;  5DG4 A;  4QAE A;  1I04 A;  2Q9S A;  4YFQ A;  4GKC A;  1OPB A;  4XMF A;  1SY0 A;  4QGX A;  2FS7 A;  2W2A A;  4NP1 A;  4QYP A;  1TOU A;  2L67 A;  1HMR A;  1GGL A;  1A2D A;  2F09 A;  3PQS A;  4YGH A;  2P8G A;  3VE2 A;  4YFP A;  5B27 A;  1LPJ A;  1AEL A;  3VU1 A;  1ZRY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...